F419221

General Info

Members Datasets Scaffolds Average Seq Length
352 227 704 252

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903058|2676474993
Length 281
Sequence PDTRSDTRPDPRTGVRARRRGGSAGTFLAHSAYLTGRSLRTLTRQPAYLAFTLIQPMIWLLLFGQLFRNVARLPGFGTGSYLEYLTPGVVVMTAMFSAGWAGTSFIQDMERGVMDRNLTSPLSRGALITGSLAFQAVTTVIQSLIVLGVGFAAGARFAGGVPGVLVVLVCAVALAVVFAALSDAIALLVHQQEALIAISQFLILPLSFLSSVMMAPALMPAWVGDVARFNPVDWAAVAARSAVSATPDWGLVSGRLGLLAALVAVMGWLAARAFRSYQRSV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
215 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
216 2643221549 Agromyces sp. Root1464 Isolate Unclassified
217 2643221572 Leifsonia sp. Root60 Isolate Unclassified
218 2643221619 Agromyces sp. Root81 Isolate Unclassified
219 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
220 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
221 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
222 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
223 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
224 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
225 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
226 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
227 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0.28
Rhizoplane 12.5
Rhizosphere 79.55
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002089 3300003203 Bacteria 9433
2 rootH1_10073941 3300003316 Bacteria 2188
3 Ga0070658_10160164 3300005327 Bacteria 1888
4 Ga0068869_100107633 3300005334 Bacteria 2117
5 Ga0070682_100110919 3300005337 Bacteria 1828
6 Ga0068868_100031981 3300005338 Bacteria 4045
7 Ga0070668_100000331 3300005347 Bacteria 31122
8 Ga0070668_100095866 3300005347 Bacteria 2344
9 Ga0070669_100310769 3300005353 Bacteria 1270
10 Ga0070659_100247754 3300005366 Bacteria 1476
11 Ga0070703_10070787 3300005406 Bacteria 1165
12 Ga0070714_100138731 3300005435 Bacteria 2180
13 Ga0070714_100694497 3300005435 Bacteria 981
14 Ga0070713_100110848 3300005436 Bacteria 2392
15 Ga0070713_100776289 3300005436 Bacteria 918
16 Ga0070710_10234291 3300005437 Bacteria 1173
17 Ga0070701_10069920 3300005438 Bacteria 1874
18 Ga0070711_100039140 3300005439 Bacteria 3191
19 Ga0070711_100052418 3300005439 Bacteria 2807
20 Ga0070711_100089746 3300005439 Bacteria 2212
21 Ga0070705_100089346 3300005440 Bacteria 1915
22 Ga0070700_100439405 3300005441 Bacteria 990
23 Ga0070694_100008809 3300005444 Bacteria 6181
24 Ga0070694_100499250 3300005444 Bacteria 968
25 Ga0070708_100108735 3300005445 Bacteria 2547
26 Ga0070663_100573062 3300005455 Bacteria 946
27 Ga0070662_100080137 3300005457 Bacteria 2430
28 Ga0070662_100114092 3300005457 Bacteria 2062
29 Ga0070681_10065167 3300005458 Bacteria 3612
30 Ga0068867_100316282 3300005459 Bacteria 1292
31 Ga0070706_100014981 3300005467 Bacteria 7159
32 Ga0070706_100057838 3300005467 Bacteria 3578
33 Ga0070706_100109939 3300005467 Bacteria 2565
34 Ga0070707_100001638 3300005468 Bacteria 21731
35 Ga0070707_100269280 3300005468 Bacteria 1656
36 Ga0070698_100033814 3300005471 Bacteria 5296
37 Ga0070698_100053900 3300005471 Bacteria 4085
38 Ga0070698_100310097 3300005471 Bacteria 1509
39 Ga0070699_100254838 3300005518 Bacteria 1568
40 Ga0070699_100388087 3300005518 Bacteria 1261
41 Ga0070697_100123993 3300005536 Bacteria 2163
42 Ga0070697_100412772 3300005536 Bacteria 1172
43 Ga0068853_100219967 3300005539 Bacteria 1734
44 Ga0068853_100772730 3300005539 Bacteria 919
45 Ga0070695_100040959 3300005545 Bacteria 2935
46 Ga0070696_100013453 3300005546 Bacteria 5491
47 Ga0070696_100165225 3300005546 Bacteria 1633
48 Ga0068855_100032157 3300005563 Bacteria 6264
49 Ga0070702_100001351 3300005615 Bacteria 9993
50 Ga0068859_100612055 3300005617 Bacteria 1182
51 Ga0068864_100258490 3300005618 Bacteria 1619
52 Ga0068866_10039514 3300005718 Bacteria 2330
53 Ga0068861_100031621 3300005719 Bacteria 3889
54 Ga0068861_100062390 3300005719 Bacteria 2863
55 Ga0068858_100294114 3300005842 Bacteria 1548
56 Ga0068860_100171422 3300005843 Bacteria 2096
57 Ga0081539_10000911 3300005985 Bacteria 55934
58 Ga0081539_10009979 3300005985 Bacteria 7825
59 Ga0075432_10001367 3300006058 Bacteria 7919
60 Ga0070715_10022508 3300006163 Bacteria 2459
61 Ga0070715_10033932 3300006163 Bacteria 2089
62 Ga0070715_10133750 3300006163 Bacteria 1196
63 Ga0070716_100121276 3300006173 Bacteria 1637
64 Ga0070712_100004384 3300006175 Bacteria 8712
65 Ga0070712_100008489 3300006175 Bacteria 6464
66 Ga0097621_100450489 3300006237 Bacteria 1159
67 Ga0075428_100002591 3300006844 Bacteria 19652
68 Ga0075428_100027893 3300006844 Bacteria 6247
69 Ga0075428_100521563 3300006844 Bacteria 1271
70 Ga0075431_100011223 3300006847 Bacteria 9023
71 Ga0075431_100031273 3300006847 Bacteria 5483
72 Ga0075431_100045161 3300006847 Bacteria 4542
73 Ga0075431_100302538 3300006847 Bacteria 1615
74 Ga0075433_10019533 3300006852 Bacteria 5649
75 Ga0075433_10068273 3300006852 Bacteria 3121
76 Ga0075433_10334176 3300006852 Bacteria 1340
77 Ga0075434_100014395 3300006871 Bacteria 7559
78 Ga0075434_100089095 3300006871 Bacteria 3087
79 Ga0075429_100027396 3300006880 Bacteria 4946
80 Ga0075429_100703485 3300006880 Bacteria 885
81 Ga0075436_100036063 3300006914 Bacteria 3412
82 Ga0075436_100067254 3300006914 Bacteria 2477
83 Ga0075436_100098377 3300006914 Bacteria 2036
84 Ga0097620_100611984 3300006931 Bacteria 1182
85 Ga0075435_100006699 3300007076 Bacteria 8169
86 Ga0075435_100023883 3300007076 Bacteria 4736
87 Ga0111539_10031788 3300009094 Bacteria 6413
88 Ga0111539_10295001 3300009094 Bacteria 1887
89 Ga0111539_10501517 3300009094 Bacteria 1414
90 Ga0105245_10005748 3300009098 Bacteria 10885
91 Ga0105245_10033754 3300009098 Bacteria 4535
92 Ga0105245_10245977 3300009098 Bacteria 1736
93 Ga0105247_10000038 3300009101 Bacteria 164083
94 Ga0114129_10001802 3300009147 Bacteria 29182
95 Ga0114129_10008380 3300009147 Bacteria 14730
96 Ga0114129_10023311 3300009147 Bacteria 8780
97 Ga0105243_10031535 3300009148 Bacteria 4087
98 Ga0105241_10192048 3300009174 Bacteria 1700
99 Ga0105242_10079903 3300009176 Bacteria 2732
100 Ga0105248_10004144 3300009177 Bacteria 16032
101 Ga0105249_10355417 3300009553 Bacteria 1485
102 Ga0105249_10519273 3300009553 Bacteria 1238
103 Ga0105239_10068957 3300010375 Bacteria 3886
104 Ga0105239_10147503 3300010375 Bacteria 2625
105 Ga0157375_10798217 3300013308 Bacteria 1093
106 Ga0163163_10291518 3300014325 Bacteria 1684
107 Ga0157377_10044264 3300014745 Bacteria 2481
108 Ga0157379_10182401 3300014968 Bacteria 1896
109 Ga0157376_10341139 3300014969 Bacteria 1431
110 Ga0207653_10026693 3300025885 Bacteria 1852
111 Ga0207642_10091860 3300025899 Bacteria 1501
112 Ga0207710_10000017 3300025900 Bacteria 370962
113 Ga0207688_10057296 3300025901 Bacteria 2190
114 Ga0207685_10162503 3300025905 Bacteria 1021
115 Ga0207643_10220340 3300025908 Bacteria 1161
116 Ga0207684_10048413 3300025910 Bacteria 3605
117 Ga0207707_10036823 3300025912 Bacteria 4276
118 Ga0207693_10001803 3300025915 Bacteria 18783
119 Ga0207693_10006560 3300025915 Bacteria 9628
120 Ga0207693_10007581 3300025915 Bacteria 8915
121 Ga0207663_10080952 3300025916 Bacteria 2125
122 Ga0207646_10015685 3300025922 Bacteria 7141
123 Ga0207681_10135130 3300025923 Bacteria 1829
124 Ga0207659_10408419 3300025926 Bacteria 1137
125 Ga0207687_10574690 3300025927 Bacteria 948
126 Ga0207700_10000004 3300025928 Bacteria 443409
127 Ga0207664_10177440 3300025929 Bacteria 1827
128 Ga0207706_10109232 3300025933 Bacteria 2434
129 Ga0207709_10291391 3300025935 Bacteria 1210
130 Ga0207704_10116218 3300025938 Bacteria 1820
131 Ga0207665_10005597 3300025939 Bacteria 8375
132 Ga0207665_10006182 3300025939 Bacteria 7951
133 Ga0207665_10109911 3300025939 Bacteria 1936
134 Ga0207689_10069087 3300025942 Bacteria 2903
135 Ga0207689_10197375 3300025942 Bacteria 1661
136 Ga0207689_10372290 3300025942 Bacteria 1189
137 Ga0207661_10241834 3300025944 Bacteria 1602
138 Ga0207668_10000443 3300025972 Bacteria 26168
139 Ga0207668_10077406 3300025972 Bacteria 2398
140 Ga0207658_10080448 3300025986 Bacteria 2496
141 Ga0207677_10184334 3300026023 Bacteria 1645
142 Ga0207703_10014769 3300026035 Bacteria 6095
143 Ga0207678_10586871 3300026067 Bacteria 976
144 Ga0207708_10280326 3300026075 Bacteria 1350
145 Ga0207648_10215584 3300026089 Unclassified 1705
146 Ga0207676_10462047 3300026095 Bacteria 1199
147 Ga0207676_10488723 3300026095 Unclassified 1167
148 Ga0207675_100050861 3300026118 Bacteria 3867
149 Ga0207675_100122411 3300026118 Bacteria 2462
150 Ga0207675_100177884 3300026118 Bacteria 2036
151 Ga0207675_100511565 3300026118 Bacteria 1196
152 Ga0207675_100584447 3300026118 Bacteria 1119
153 Ga0207683_10014840 3300026121 Bacteria 6633
154 Ga0207428_10018545 3300027907 Bacteria 5940
155 Ga0207428_10082473 3300027907 Bacteria 2509
156 Ga0268265_10078856 3300028380 Bacteria 2592
157 Ga0268265_10130427 3300028380 Bacteria 2088
158 Ga0268264_10070059 3300028381 Bacteria 2968
159 Ga0268264_10557885 3300028381 Bacteria 1124
160 Ga0265334_10005355 3300028573 Bacteria 5604
161 Ga0265338_10004064 3300028800 Bacteria 20061
162 Ga0265338_10094040 3300028800 Bacteria 2467
163 Ga0265324_10034588 3300029957 Bacteria 1760
164 Ga0307512_10006039 3300030522 Bacteria 12406
165 Ga0265327_10000637 3300031251 Bacteria 57211
166 Ga0265327_10002315 3300031251 Bacteria 20368
167 Ga0307513_10001552 3300031456 Bacteria 32935
168 Ga0307513_10014820 3300031456 Bacteria 9484
169 Ga0307508_10003366 3300031616 Bacteria 16209
170 Ga0307508_10023970 3300031616 Bacteria 5538
171 Ga0307508_10373508 3300031616 Bacteria 1017
172 Ga0307413_10037787 3300031824 Bacteria 2792
173 Ga0307407_10476607 3300031903 Bacteria 911
174 Ga0373948_0060594 3300034817 Bacteria 830
175 Ga0373938_0003454 3300034957 Bacteria 2590
176 Ga0373940_0035809 3300035088 Bacteria 1345
177 Ga0373932_0001493 3300035112 Bacteria 6527
178 Ga0373939_0002643 3300035114 Bacteria 4205
179 Ga0373941_0005295 3300035115 Bacteria 3028
180 Ga0373945_0035592 3300035116 Bacteria 1780
181 Ga0373960_0002787 3300035121 Bacteria 3958
182 Ga0373943_0035230 3300035170 Bacteria 2390
183 Ga0373942_0002622 3300035207 Bacteria 4326
184 Ga0373942_0004391 3300035207 Bacteria 3277
185 Ga0373961_0008691 3300035241 Bacteria 2473
186 Ga0373962_0003762 3300035242 Bacteria 3650
187 Ga0373931_0005804 3300035691 Bacteria 5740
188 Ga0373935_0270070 3300035692 Bacteria 1195
189 Ga0373947_0009102 3300035725 Bacteria 5707
190 Ga0395899_0091990 3300037312 Unclassified 2197
191 Ga0395899_0291247 3300037312 Bacteria 1107
192 Ga0395900_0002751 3300037418 Bacteria 19208
193 Ga0395900_0023282 3300037418 Bacteria 6339
194 Ga0395900_0175978 3300037418 Bacteria 2176
195 Ga0395898_0001343 3300037466 Bacteria 35534
196 Ga0395898_0012673 3300037466 Bacteria 8712
197 Ga0395898_0036841 3300037466 Bacteria 4854
198 Ga0395898_0052411 3300037466 Bacteria 3986
199 Ga0395898_0689219 3300037466 Bacteria 964
200 Ga0395905_0004352 3300037471 Bacteria 14746
201 Ga0395905_0008531 3300037471 Bacteria 10104
202 Ga0395905_0048013 3300037471 Bacteria 4001
203 Ga0395905_0263086 3300037471 Bacteria 1610
204 Ga0395901_0006548 3300038443 Bacteria 11779
205 Ga0395901_0052981 3300038443 Bacteria 4216
206 Ga0395901_0062679 3300038443 Bacteria 3869
207 Ga0395901_0650056 3300038443 Unclassified 1058
208 Ga0395901_0685843 3300038443 Bacteria 1024
209 Ga0242420_027933 3300038996 Bacteria 1036
210 Ga0436360_0797762 3300039438 Bacteria 3947
211 Ga0436362_0361558 3300039453 Bacteria 1728
212 Ga0451789_0541482 3300041443 Bacteria 1623
213 Ga0451795_1166197 3300041456 Bacteria 1126
214 Ga0451800_1124199 3300041459 Bacteria 1305
215 Ga0451800_1152697 3300041459 Bacteria 971
216 Ga0451853_2215025 3300041512 Bacteria 10300
217 Ga0466963_0003473 3300044694 Bacteria 9039
218 Ga0466964_0007777 3300044706 Bacteria 4013
219 Ga0466960_0317922 3300044901 Bacteria 881
220 Ga0466959_0000126 3300045049 Bacteria 49337
221 Ga0466958_0017699 3300045836 Bacteria 4126
222 Ga0466958_0086627 3300045836 Bacteria 1933
223 Ga0466967_0091690 3300045976 Bacteria 2762
224 Ga0466967_0110547 3300045976 Bacteria 2524
225 Ga0466967_0759651 3300045976 Unclassified 962
226 Ga0495629_0228422 3300046459 Bacteria 1283
227 Ga0495653_0046951 3300046463 Bacteria 3342
228 Ga0495580_0050343 3300046472 Bacteria 2946
229 Ga0495582_0035114 3300046473 Bacteria 2757
230 Ga0495639_0288061 3300046475 Unclassified 817
231 Ga0495584_0177209 3300046491 Bacteria 1084
232 Ga0495630_0408641 3300046517 Bacteria 1040
233 Ga0495642_0021033 3300046528 Bacteria 2565
234 Ga0495652_0005339 3300046529 Bacteria 12111
235 Ga0495586_0023039 3300046535 Bacteria 3325
236 Ga0495645_0175420 3300046543 Bacteria 1472
237 Ga0495634_0134913 3300046642 Bacteria 1571
238 Ga0495635_0063366 3300046663 Bacteria 2539
239 Ga0495635_0190999 3300046663 Bacteria 1390
240 Ga0495623_0033929 3300046679 Bacteria 3274
241 Ga0495646_0005585 3300046680 Bacteria 7955
242 Ga0495600_0037527 3300046809 Bacteria 3150
243 Ga0495604_0255581 3300047317 Bacteria 1193
244 Ga0495674_0497947 3300047319 Bacteria 975
245 Ga0495676_0067916 3300047321 Bacteria 2756
246 Ga0495593_0357904 3300047673 Bacteria 729
247 Ga0495614_0251547 3300048089 Unclassified 808
248 Ga0496100_0388361 3300048903 Bacteria 1061
249 Ga0496101_0066759 3300048904 Bacteria 2625
250 Ga0496101_0284384 3300048904 Bacteria 1293
251 Ga0496102_0101877 3300048905 Bacteria 2668
252 Ga0496102_0181905 3300048905 Bacteria 1981
253 Ga0496102_0920518 3300048905 Unclassified 796
254 Ga0496103_0019708 3300048906 Bacteria 4048
255 Ga0496104_0127905 3300048907 Bacteria 2439
256 Ga0496104_0447382 3300048907 Bacteria 1204
257 Ga0496105_0025183 3300048908 Bacteria 4840
258 Ga0496107_0403912 3300048910 Bacteria 1016
259 Ga0496108_0019963 3300048911 Bacteria 5504
260 Ga0496108_0032282 3300048911 Bacteria 4349
261 Ga0496108_0096500 3300048911 Bacteria 2518
262 Ga0496108_0336334 3300048911 Bacteria 1317
263 Ga0496108_0907116 3300048911 Bacteria 756
264 Ga0496109_0012892 3300048912 Bacteria 7227
265 Ga0496109_0016199 3300048912 Bacteria 6514
266 Ga0496109_0079955 3300048912 Bacteria 3012
267 Ga0496109_0106659 3300048912 Bacteria 2602
268 Ga0496109_0330196 3300048912 Bacteria 1440
269 Ga0496110_0019101 3300048913 Bacteria 5761
270 Ga0496110_0167224 3300048913 Bacteria 1994
271 Ga0496110_0233013 3300048913 Bacteria 1675
272 Ga0496110_0347613 3300048913 Bacteria 1351
273 Ga0496111_0011935 3300048914 Bacteria 5871
274 Ga0496111_0044937 3300048914 Bacteria 3176
275 Ga0496111_0086142 3300048914 Bacteria 2298
276 Ga0496112_0005177 3300048915 Bacteria 11213
277 Ga0496112_0026500 3300048915 Bacteria 5578
278 Ga0496112_0061319 3300048915 Bacteria 3707
279 Ga0496112_0315080 3300048915 Bacteria 1509
280 Ga0496113_0104303 3300048916 Bacteria 2200
281 Ga0496113_0129153 3300048916 Bacteria 1981
282 Ga0496113_0294509 3300048916 Bacteria 1299
283 Ga0496114_0002962 3300048917 Bacteria 13019
284 Ga0496114_0049683 3300048917 Bacteria 3490
285 Ga0496114_0294824 3300048917 Bacteria 1431
286 Ga0496115_0074671 3300048918 Bacteria 2753
287 Ga0496115_0081668 3300048918 Bacteria 2633
288 Ga0496119_0004025 3300048922 Bacteria 14857
289 Ga0496120_0000353 3300048923 Bacteria 75672
290 Ga0496122_0006062 3300048925 Bacteria 14087
291 Ga0496126_0211748 3300048929 Bacteria 1631
292 Ga0501034_0132655 3300049571 Bacteria 2474
293 Ga0501037_0013920 3300049573 Bacteria 5928
294 Ga0501043_0056376 3300049579 Bacteria 3086
295 Ga0501047_0024682 3300049581 Bacteria 5772
296 Ga0501047_0096556 3300049581 Bacteria 2834
297 Ga0501047_0384816 3300049581 Bacteria 1237
298 Ga0501067_0009866 3300049583 Bacteria 5287
299 Ga0501067_0230287 3300049583 Bacteria 1031
300 Ga0501069_0023041 3300049585 Bacteria 3392
301 Ga0501069_0028749 3300049585 Bacteria 3049
302 Ga0501070_0005958 3300049586 Bacteria 10391
303 Ga0501070_0132318 3300049586 Bacteria 2060
304 Ga0501070_0210531 3300049586 Bacteria 1596
305 Ga0501072_0392632 3300049588 Bacteria 1101
306 Ga0501073_0297275 3300049589 Bacteria 1114
307 Ga0501044_0002014 3300049823 Bacteria 23423
308 nmdc:mga05p37_1737_c1 3300050507 Bacteria 22321
309 nmdc:mga05p37_46852_c1 3300050507 Bacteria 5316
310 nmdc:mga05p37_930503_c1 3300050507 Bacteria 933
311 nmdc:mga09592_11440_c1 3300050508 Bacteria 7217
312 nmdc:mga06r32_203105_c1 3300050510 Bacteria 1969
313 nmdc:mga06r32_225972_c1 3300050510 Bacteria 1860
314 nmdc:mga06r32_26477_c1 3300050510 Bacteria 5407
315 nmdc:mga08y16_45438_c1 3300050511 Bacteria 4602
316 nmdc:mga0n895_13344_c1 3300050512 Bacteria 7408
317 nmdc:mga0rr50_13857_c1 3300050513 Bacteria 5268
318 nmdc:mga0rr50_60294_c1 3300050513 Bacteria 2854
319 nmdc:mga0rr50_9216_c1 3300050513 Bacteria 6191
320 nmdc:mga08x19_14087_c1 3300050514 Bacteria 4846
321 nmdc:mga08x19_201114_c1 3300050514 Bacteria 1366
322 nmdc:mga0a205_34109_c1 3300050515 Bacteria 4883
323 nmdc:mga0a205_55246_c1 3300050515 Bacteria 3836
324 nmdc:mga0a205_92977_c1 3300050515 Bacteria 2914
325 Ga0495595_0036798 3300053084 Bacteria 2223
326 Ga0500644_0017479 3300053088 Bacteria 2083
327 Ga0500644_0071385 3300053088 Bacteria 1252
328 Ga0500651_0276428 3300053093 Bacteria 970
329 Ga0500652_095968 3300053131 Bacteria 1238
330 Ga0500577_0025126 3300053142 Bacteria 2011
331 Ga0500616_0000078 3300053153 Bacteria 202009
332 Ga0500616_0004201 3300053153 Bacteria 10379
333 Ga0500616_0005139 3300053153 Bacteria 9000
334 Ga0500633_0137128 3300053160 Bacteria 915
335 Ga0500645_019167 3300053730 Bacteria 2131
336 Ga0466962_0001741 3300061719 Bacteria 10230
337 Ga0530510_0065727 3300061734 Bacteria 2628
338 Ga0530510_0590062 3300061734 Unclassified 845
339 2676474993 2675903058 Bacteria 6822861
340 2515856928 2515154155 Bacteria 7985436
341 2643768765 2643221549 Bacteria 4042819
342 2643876597 2643221572 Bacteria 3614809
343 2644112211 2643221619 Bacteria 4158469
344 2644383652 2643221669 Bacteria 3611286
345 2689992264 2687453743 Bacteria 8361025
346 2723643313 2721755702 Bacteria 4373124
347 2753265852 2751185782 Bacteria 11227053
348 2795794155 2795385472 Bacteria 6627535
349 2827630838 2827628540 Bacteria 6858585
350 2868093532 2868088558 Bacteria 7609351
351 2895660804 2895660088 Bacteria 3782833
352 2935411942 2935409751 Bacteria 4179611
353 JGI25406J46586_10002089
354 rootH1_10073941
355 Ga0070658_10160164
356 Ga0068869_100107633
357 Ga0070682_100110919
358 Ga0068868_100031981
359 Ga0070668_100000331
360 Ga0070668_100095866
361 Ga0070669_100310769
362 Ga0070659_100247754
363 Ga0070703_10070787
364 Ga0070714_100138731
365 Ga0070714_100694497
366 Ga0070713_100110848
367 Ga0070713_100776289
368 Ga0070710_10234291
369 Ga0070701_10069920
370 Ga0070711_100039140
371 Ga0070711_100052418
372 Ga0070711_100089746
373 Ga0070705_100089346
374 Ga0070700_100439405
375 Ga0070694_100008809
376 Ga0070694_100499250
377 Ga0070708_100108735
378 Ga0070663_100573062
379 Ga0070662_100080137
380 Ga0070662_100114092
381 Ga0070681_10065167
382 Ga0068867_100316282
383 Ga0070706_100014981
384 Ga0070706_100057838
385 Ga0070706_100109939
386 Ga0070707_100001638
387 Ga0070707_100269280
388 Ga0070698_100033814
389 Ga0070698_100053900
390 Ga0070698_100310097
391 Ga0070699_100254838
392 Ga0070699_100388087
393 Ga0070697_100123993
394 Ga0070697_100412772
395 Ga0068853_100219967
396 Ga0068853_100772730
397 Ga0070695_100040959
398 Ga0070696_100013453
399 Ga0070696_100165225
400 Ga0068855_100032157
401 Ga0070702_100001351
402 Ga0068859_100612055
403 Ga0068864_100258490
404 Ga0068866_10039514
405 Ga0068861_100031621
406 Ga0068861_100062390
407 Ga0068858_100294114
408 Ga0068860_100171422
409 Ga0081539_10000911
410 Ga0081539_10009979
411 Ga0075432_10001367
412 Ga0070715_10022508
413 Ga0070715_10033932
414 Ga0070715_10133750
415 Ga0070716_100121276
416 Ga0070712_100004384
417 Ga0070712_100008489
418 Ga0097621_100450489
419 Ga0075428_100002591
420 Ga0075428_100027893
421 Ga0075428_100521563
422 Ga0075431_100011223
423 Ga0075431_100031273
424 Ga0075431_100045161
425 Ga0075431_100302538
426 Ga0075433_10019533
427 Ga0075433_10068273
428 Ga0075433_10334176
429 Ga0075434_100014395
430 Ga0075434_100089095
431 Ga0075429_100027396
432 Ga0075429_100703485
433 Ga0075436_100036063
434 Ga0075436_100067254
435 Ga0075436_100098377
436 Ga0097620_100611984
437 Ga0075435_100006699
438 Ga0075435_100023883
439 Ga0111539_10031788
440 Ga0111539_10295001
441 Ga0111539_10501517
442 Ga0105245_10005748
443 Ga0105245_10033754
444 Ga0105245_10245977
445 Ga0105247_10000038
446 Ga0114129_10001802
447 Ga0114129_10008380
448 Ga0114129_10023311
449 Ga0105243_10031535
450 Ga0105241_10192048
451 Ga0105242_10079903
452 Ga0105248_10004144
453 Ga0105249_10355417
454 Ga0105249_10519273
455 Ga0105239_10068957
456 Ga0105239_10147503
457 Ga0157375_10798217
458 Ga0163163_10291518
459 Ga0157377_10044264
460 Ga0157379_10182401
461 Ga0157376_10341139
462 Ga0207653_10026693
463 Ga0207642_10091860
464 Ga0207710_10000017
465 Ga0207688_10057296
466 Ga0207685_10162503
467 Ga0207643_10220340
468 Ga0207684_10048413
469 Ga0207707_10036823
470 Ga0207693_10001803
471 Ga0207693_10006560
472 Ga0207693_10007581
473 Ga0207663_10080952
474 Ga0207646_10015685
475 Ga0207681_10135130
476 Ga0207659_10408419
477 Ga0207687_10574690
478 Ga0207700_10000004
479 Ga0207664_10177440
480 Ga0207706_10109232
481 Ga0207709_10291391
482 Ga0207704_10116218
483 Ga0207665_10005597
484 Ga0207665_10006182
485 Ga0207665_10109911
486 Ga0207689_10069087
487 Ga0207689_10197375
488 Ga0207689_10372290
489 Ga0207661_10241834
490 Ga0207668_10000443
491 Ga0207668_10077406
492 Ga0207658_10080448
493 Ga0207677_10184334
494 Ga0207703_10014769
495 Ga0207678_10586871
496 Ga0207708_10280326
497 Ga0207648_10215584
498 Ga0207676_10462047
499 Ga0207676_10488723
500 Ga0207675_100050861
501 Ga0207675_100122411
502 Ga0207675_100177884
503 Ga0207675_100511565
504 Ga0207675_100584447
505 Ga0207683_10014840
506 Ga0207428_10018545
507 Ga0207428_10082473
508 Ga0268265_10078856
509 Ga0268265_10130427
510 Ga0268264_10070059
511 Ga0268264_10557885
512 Ga0265334_10005355
513 Ga0265338_10004064
514 Ga0265338_10094040
515 Ga0265324_10034588
516 Ga0307512_10006039
517 Ga0265327_10000637
518 Ga0265327_10002315
519 Ga0307513_10001552
520 Ga0307513_10014820
521 Ga0307508_10003366
522 Ga0307508_10023970
523 Ga0307508_10373508
524 Ga0307413_10037787
525 Ga0307407_10476607
526 Ga0373948_0060594
527 Ga0373938_0003454
528 Ga0373940_0035809
529 Ga0373932_0001493
530 Ga0373939_0002643
531 Ga0373941_0005295
532 Ga0373945_0035592
533 Ga0373960_0002787
534 Ga0373943_0035230
535 Ga0373942_0002622
536 Ga0373942_0004391
537 Ga0373961_0008691
538 Ga0373962_0003762
539 Ga0373931_0005804
540 Ga0373935_0270070
541 Ga0373947_0009102
542 Ga0395899_0091990
543 Ga0395899_0291247
544 Ga0395900_0002751
545 Ga0395900_0023282
546 Ga0395900_0175978
547 Ga0395898_0001343
548 Ga0395898_0012673
549 Ga0395898_0036841
550 Ga0395898_0052411
551 Ga0395898_0689219
552 Ga0395905_0004352
553 Ga0395905_0008531
554 Ga0395905_0048013
555 Ga0395905_0263086
556 Ga0395901_0006548
557 Ga0395901_0052981
558 Ga0395901_0062679
559 Ga0395901_0650056
560 Ga0395901_0685843
561 Ga0242420_027933
562 Ga0436360_0797762
563 Ga0436362_0361558
564 Ga0451789_0541482
565 Ga0451795_1166197
566 Ga0451800_1124199
567 Ga0451800_1152697
568 Ga0451853_2215025
569 Ga0466963_0003473
570 Ga0466964_0007777
571 Ga0466960_0317922
572 Ga0466959_0000126
573 Ga0466958_0017699
574 Ga0466958_0086627
575 Ga0466967_0091690
576 Ga0466967_0110547
577 Ga0466967_0759651
578 Ga0495629_0228422
579 Ga0495653_0046951
580 Ga0495580_0050343
581 Ga0495582_0035114
582 Ga0495639_0288061
583 Ga0495584_0177209
584 Ga0495630_0408641
585 Ga0495642_0021033
586 Ga0495652_0005339
587 Ga0495586_0023039
588 Ga0495645_0175420
589 Ga0495634_0134913
590 Ga0495635_0063366
591 Ga0495635_0190999
592 Ga0495623_0033929
593 Ga0495646_0005585
594 Ga0495600_0037527
595 Ga0495604_0255581
596 Ga0495674_0497947
597 Ga0495676_0067916
598 Ga0495593_0357904
599 Ga0495614_0251547
600 Ga0496100_0388361
601 Ga0496101_0066759
602 Ga0496101_0284384
603 Ga0496102_0101877
604 Ga0496102_0181905
605 Ga0496102_0920518
606 Ga0496103_0019708
607 Ga0496104_0127905
608 Ga0496104_0447382
609 Ga0496105_0025183
610 Ga0496107_0403912
611 Ga0496108_0019963
612 Ga0496108_0032282
613 Ga0496108_0096500
614 Ga0496108_0336334
615 Ga0496108_0907116
616 Ga0496109_0012892
617 Ga0496109_0016199
618 Ga0496109_0079955
619 Ga0496109_0106659
620 Ga0496109_0330196
621 Ga0496110_0019101
622 Ga0496110_0167224
623 Ga0496110_0233013
624 Ga0496110_0347613
625 Ga0496111_0011935
626 Ga0496111_0044937
627 Ga0496111_0086142
628 Ga0496112_0005177
629 Ga0496112_0026500
630 Ga0496112_0061319
631 Ga0496112_0315080
632 Ga0496113_0104303
633 Ga0496113_0129153
634 Ga0496113_0294509
635 Ga0496114_0002962
636 Ga0496114_0049683
637 Ga0496114_0294824
638 Ga0496115_0074671
639 Ga0496115_0081668
640 Ga0496119_0004025
641 Ga0496120_0000353
642 Ga0496122_0006062
643 Ga0496126_0211748
644 Ga0501034_0132655
645 Ga0501037_0013920
646 Ga0501043_0056376
647 Ga0501047_0024682
648 Ga0501047_0096556
649 Ga0501047_0384816
650 Ga0501067_0009866
651 Ga0501067_0230287
652 Ga0501069_0023041
653 Ga0501069_0028749
654 Ga0501070_0005958
655 Ga0501070_0132318
656 Ga0501070_0210531
657 Ga0501072_0392632
658 Ga0501073_0297275
659 Ga0501044_0002014
660 nmdc:mga05p37_1737_c1
661 nmdc:mga05p37_46852_c1
662 nmdc:mga05p37_930503_c1
663 nmdc:mga09592_11440_c1
664 nmdc:mga06r32_203105_c1
665 nmdc:mga06r32_225972_c1
666 nmdc:mga06r32_26477_c1
667 nmdc:mga08y16_45438_c1
668 nmdc:mga0n895_13344_c1
669 nmdc:mga0rr50_13857_c1
670 nmdc:mga0rr50_60294_c1
671 nmdc:mga0rr50_9216_c1
672 nmdc:mga08x19_14087_c1
673 nmdc:mga08x19_201114_c1
674 nmdc:mga0a205_34109_c1
675 nmdc:mga0a205_55246_c1
676 nmdc:mga0a205_92977_c1
677 Ga0495595_0036798
678 Ga0500644_0017479
679 Ga0500644_0071385
680 Ga0500651_0276428
681 Ga0500652_095968
682 Ga0500577_0025126
683 Ga0500616_0000078
684 Ga0500616_0004201
685 Ga0500616_0005139
686 Ga0500633_0137128
687 Ga0500645_019167
688 Ga0466962_0001741
689 Ga0530510_0065727
690 Ga0530510_0590062
691 2676474993
692 2515856928
693 2643768765
694 2643876597
695 2644112211
696 2644383652
697 2689992264
698 2723643313
699 2753265852
700 2795794155
701 2827630838
702 2868093532
703 2895660804
704 2935411942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

31

243

0.92

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

69

272

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.753 60 252
7p03-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation without nucleotides 0.7251 4 247
7tby-assembly1.cif.gz_A the structure of human abca1 in nanodisc 0.7125 60 254
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.7056 1 258
5nj3-assembly1.cif.gz_A structure of an abc transporter: complete structure 0.7056 1 258
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8657 54 250 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8393 54 251 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7836 40 248 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6733 54 250 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6583 54 251 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A3N5TP52-F1-model_v4 Transport permease protein 0.9791 1 258 GO:0043190
GO:0140359
AF-A0A2W4MFB6-F1-model_v4 Transport permease protein 0.979 1 258 GO:0043190
GO:0140359
AF-A0A7Y5WY05-F1-model_v4 Transport permease protein 0.9771 4 258 GO:0043190
GO:0140359
AF-A0A6G9Y828-F1-model_v4 ABC transporter permease 0.9764 59 258 GO:0016020
GO:0140359
AF-A0A3E0HEM5-F1-model_v4 Transport permease protein 0.9762 4 258 GO:0043190
GO:0140359

Map