F419017

General Info

Members Datasets Scaffolds Average Seq Length
352 233 311 218

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10005323|Ga0157370_1000532310
Length 233
Sequence MMGTVPKDALMFPRLPTVTKALLIANIVLFLLQQPFLLGNGTFEPFMLQPLRDGFDPFSPGGNFQPWQLLTYGFLHGGFGHLFFNMLALFMFGAPLEQTWGEKRFLTYYLVCIVGAGLCQLLVGMMMADPATVLGASGGVFGLLLAYGMLFPNQRVMLLFPPIPMKARTFVIVFGAMELMLGATGWQPGVAHFAHLGGMLFGWLLIRYWRGQPPFNKRPPGGDPRKNHLRSVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221612 Lysobacter sp. Root76 Isolate Unclassified
7 2643221695 Lysobacter sp. Root494 Isolate Unclassified
8 2643221727 Lysobacter sp. Root96 Isolate Unclassified
9 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
12 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
13 2818991457 Xanthomonas translucens 569 Isolate Unclassified
14 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
15 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
16 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
17 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
18 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
19 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
20 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
21 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
22 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
23 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
24 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
25 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
26 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
27 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
28 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
29 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
30 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
31 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
32 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
33 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
34 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
35 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
36 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
37 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
38 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
39 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
40 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
79 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
125 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
126 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
155 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
232 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
233 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 0
Isolates 11.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 14.49
Nodule 0.28
Rhizoplane 5.11
Rhizosphere 57.1
Stem 0
Stem Tuber 0
Unclassified 22.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1455210 2162886007 Bacteria 2981
2 SwRhRL2b_contig_3895547 2162886007 Bacteria 4226
3 JGI25152J39213_1000023 3300002773 Bacteria 105170
4 JGI25150J39212_1000646 3300002774 Bacteria 13032
5 JGI25151J46595_10000100 3300003187 Bacteria 116522
6 JGI25153J46596_10000071 3300003215 Bacteria 116950
7 Ga0055526_1000486 3300003771 Bacteria 31535
8 Ga0055537_1000261 3300003773 Bacteria 38387
9 Ga0055524_1021027 3300003775 Bacteria 2176
10 Ga0055536_1003939 3300003781 Bacteria 7783
11 Ga0055536_1005773 3300003781 Bacteria 5963
12 Ga0055534_1000034 3300003784 Bacteria 114684
13 Ga0055528_1000845 3300003790 Bacteria 20761
14 Ga0055530_10003023 3300003791 Bacteria 10060
15 Ga0055530_10004740 3300003791 Bacteria 6854
16 Ga0055531_10007461 3300003794 Bacteria 5963
17 Ga0058692_1000011 3300003856 Bacteria 321321
18 Ga0065704_10070324 3300005289 Bacteria 32729
19 Ga0065704_10070640 3300005289 Bacteria 18572
20 Ga0065715_10392350 3300005293 Bacteria 892
21 Ga0070670_100006830 3300005331 Bacteria 9669
22 Ga0070670_100031806 3300005331 Bacteria 4544
23 Ga0070666_10800356 3300005335 Bacteria 694
24 Ga0070668_100012341 3300005347 Bacteria 6363
25 Ga0070671_100225843 3300005355 Bacteria 1589
26 Ga0070667_100441242 3300005367 Bacteria 1189
27 Ga0070667_100669324 3300005367 Bacteria 959
28 Ga0070714_100036197 3300005435 Bacteria 4139
29 Ga0070662_100363952 3300005457 Bacteria 1187
30 Ga0068867_100168012 3300005459 Bacteria 1735
31 Ga0070672_100138049 3300005543 Bacteria 2009
32 Ga0070695_100129536 3300005545 Bacteria 1738
33 Ga0070696_100004341 3300005546 Bacteria 9453
34 Ga0070665_100231303 3300005548 Bacteria 1848
35 Ga0070665_100453663 3300005548 Bacteria 1292
36 Ga0075365_10011772 3300006038 Bacteria 5160
37 Ga0075365_10415379 3300006038 Bacteria 950
38 Ga0075365_10619494 3300006038 Bacteria 765
39 Ga0075364_10000031 3300006051 Bacteria 49341
40 Ga0075364_10024894 3300006051 Bacteria 3805
41 Ga0075364_10026484 3300006051 Bacteria 3699
42 Ga0075364_10081596 3300006051 Bacteria 2138
43 Ga0075367_10133535 3300006178 Bacteria 1535
44 Ga0075431_100814696 3300006847 Bacteria 906
45 Ga0105251_10002110 3300009011 Bacteria 16006
46 Ga0105244_10163390 3300009036 Bacteria 1062
47 Ga0105244_10190680 3300009036 Bacteria 969
48 Ga0105240_10002038 3300009093 Bacteria 33273
49 Ga0105245_10046692 3300009098 Bacteria 3870
50 Ga0105243_10176514 3300009148 Bacteria 1854
51 Ga0105248_10445602 3300009177 Bacteria 1459
52 Ga0105246_10479421 3300011119 Bacteria 1052
53 Ga0157314_1001314 3300012500 Bacteria 1803
54 Ga0157327_1003895 3300012512 Bacteria 1127
55 Ga0157371_10000154 3300013102 Bacteria 100237
56 Ga0157370_10005323 3300013104 Bacteria 14452
57 Ga0157370_10034606 3300013104 Bacteria 4917
58 Ga0157369_10755338 3300013105 Bacteria 1000
59 Ga0157374_10015319 3300013296 Bacteria 6724
60 Ga0157375_10067257 3300013308 Bacteria 3580
61 Ga0157375_10387205 3300013308 Bacteria 1565
62 Ga0182008_10000045 3300014497 Bacteria 114620
63 Ga0182008_10023080 3300014497 Bacteria 3181
64 Ga0182006_1011851 3300015261 Bacteria 3820
65 Ga0182006_1029077 3300015261 Bacteria 2242
66 Ga0182007_10000175 3300015262 Bacteria 43873
67 Ga0182005_1000733 3300015265 Bacteria 15014
68 Ga0182005_1028335 3300015265 Bacteria 1527
69 Ga0163161_10000692 3300017792 Bacteria 26954
70 Ga0163161_10010740 3300017792 Bacteria 6343
71 Ga0163161_10101252 3300017792 Bacteria 2145
72 Ga0163161_10177473 3300017792 Bacteria 1631
73 Ga0163161_10306836 3300017792 Bacteria 1251
74 Ga0207425_1000030 3300025245 Bacteria 268200
75 Ga0209129_1000063 3300025258 Bacteria 240205
76 Ga0209565_1000022 3300025263 Bacteria 390888
77 Ga0209673_1000104 3300025273 Bacteria 186569
78 Ga0209675_1000048 3300025291 Bacteria 221457
79 Ga0209676_1000091 3300025292 Bacteria 251328
80 Ga0209676_1000117 3300025292 Bacteria 203251
81 Ga0209676_1001162 3300025292 Bacteria 28648
82 Ga0209676_1006850 3300025292 Bacteria 5521
83 Ga0209025_1000013 3300025294 Bacteria 871757
84 Ga0209025_1006302 3300025294 Bacteria 9270
85 Ga0209564_1000213 3300025295 Bacteria 132985
86 Ga0209758_1000014 3300025297 Bacteria 871757
87 Ga0209050_1000175 3300025298 Bacteria 146845
88 Ga0209050_1000206 3300025298 Bacteria 131913
89 Ga0209050_1063334 3300025298 Bacteria 863
90 Ga0209256_1004404 3300025299 Bacteria 8871
91 Ga0209256_1007920 3300025299 Bacteria 5075
92 Ga0209051_1001733 3300025303 Bacteria 17374
93 Ga0209257_1000062 3300025304 Bacteria 362413
94 Ga0209257_1000148 3300025304 Bacteria 193131
95 Ga0209257_1000711 3300025304 Bacteria 51490
96 Ga0209257_1001502 3300025304 Bacteria 27388
97 Ga0209257_1005535 3300025304 Bacteria 8803
98 Ga0207655_1091835 3300025728 Bacteria 1066
99 Ga0207713_1000514 3300025735 Bacteria 39386
100 Ga0207713_1008456 3300025735 Bacteria 5925
101 Ga0207695_10011748 3300025913 Bacteria 10577
102 Ga0207681_10550252 3300025923 Bacteria 950
103 Ga0207650_10018327 3300025925 Bacteria 4912
104 Ga0207650_10098500 3300025925 Bacteria 2246
105 Ga0207644_10447115 3300025931 Bacteria 1061
106 Ga0207706_10280620 3300025933 Bacteria 1453
107 Ga0207709_10005875 3300025935 Bacteria 6931
108 Ga0207709_10049897 3300025935 Bacteria 2557
109 Ga0207691_10006445 3300025940 Bacteria 11335
110 Ga0207641_10282542 3300026088 Bacteria 1562
111 Ga0207675_100260980 3300026118 Bacteria 1679
112 Ga0209371_1000007 3300027312 Bacteria 1050654
113 Ga0209371_1000016 3300027312 Bacteria 646301
114 Ga0209969_1017244 3300027360 Bacteria 1062
115 Ga0209999_1000100 3300027543 Bacteria 10325
116 Ga0209982_1002542 3300027552 Bacteria 2566
117 Ga0209970_1004955 3300027614 Bacteria 2202
118 Ga0209983_1001909 3300027665 Bacteria 4623
119 Ga0209971_1000857 3300027682 Bacteria 7832
120 Ga0209974_10001531 3300027876 Bacteria 8389
121 Ga0268266_10262370 3300028379 Bacteria 1601
122 Ga0268266_10403814 3300028379 Bacteria 1292
123 Ga0268256_1000008 3300030500 Bacteria 1050654
124 Ga0268256_1000015 3300030500 Bacteria 646300
125 Ga0316177_1077226 3300030731 Bacteria 5163
126 Ga0316176_1096536 3300030732 Bacteria 732
127 Ga0314311_1150566 3300030733 Bacteria 6620
128 Ga0314311_1252374 3300030733 Bacteria 1642
129 Ga0316178_1136278 3300030735 Bacteria 2989
130 Ga0316183_1088245 3300030742 Bacteria 2731
131 Ga0307513_10002570 3300031456 Bacteria 25077
132 Ga0307413_10028276 3300031824 Bacteria 3120
133 Ga0307413_10181230 3300031824 Bacteria 1502
134 Ga0307410_10202042 3300031852 Bacteria 1518
135 Ga0307407_10318407 3300031903 Bacteria 1091
136 Ga0307412_10001664 3300031911 Bacteria 12275
137 Ga0307412_10144009 3300031911 Bacteria 1749
138 Ga0307412_10151270 3300031911 Bacteria 1713
139 Ga0307412_10170752 3300031911 Bacteria 1626
140 Ga0307412_10401380 3300031911 Bacteria 1116
141 Ga0307414_10002558 3300032004 Bacteria 9569
142 Ga0307414_10005590 3300032004 Bacteria 6933
143 Ga0307414_10098430 3300032004 Bacteria 2194
144 Ga0307414_10160821 3300032004 Bacteria 1783
145 Ga0307414_10268376 3300032004 Bacteria 1428
146 Ga0307414_10320308 3300032004 Bacteria 1319
147 Ga0307414_10347974 3300032004 Bacteria 1271
148 Ga0307414_10469383 3300032004 Bacteria 1107
149 Ga0307411_10129272 3300032005 Bacteria 1843
150 Ga0307411_10254500 3300032005 Bacteria 1383
151 Ga0307411_10455067 3300032005 Bacteria 1072
152 Ga0373935_0689960 3300035692 Bacteria 751
153 Ga0395900_0168906 3300037418 Bacteria 2228
154 Ga0395901_0283198 3300038443 Bacteria 1722
155 Ga0439436_0092426 3300041404 Bacteria 843
156 Ga0439465_0003734 3300041413 Bacteria 4962
157 Ga0439465_0004272 3300041413 Bacteria 4646
158 Ga0451791_0399408 3300041451 Bacteria 2037
159 Ga0451797_0453175 3300041453 Bacteria 2360
160 Ga0451802_0028384 3300041460 Bacteria 1728
161 Ga0451806_403891 3300041462 Bacteria 5740
162 Ga0451804_0067688 3300041463 Bacteria 1766
163 Ga0451807_0376030 3300041486 Bacteria 2492
164 Ga0451807_0383160 3300041486 Bacteria 2537
165 Ga0451837_0705007 3300041494 Bacteria 1256
166 Ga0451837_0755288 3300041494 Bacteria 1176
167 Ga0451837_0784760 3300041494 Bacteria 1071
168 Ga0451839_1150760 3300041496 Bacteria 630
169 Ga0451843_1320003 3300041509 Bacteria 1978
170 Ga0451843_1438775 3300041509 Bacteria 1194
171 Ga0439445_0005232 3300042004 Bacteria 2952
172 Ga0439432_008836 3300042006 Bacteria 3523
173 Ga0439432_009256 3300042006 Bacteria 3440
174 Ga0439449_0002049 3300042007 Bacteria 7934
175 Ga0439449_0007316 3300042007 Bacteria 4195
176 Ga0439449_0015984 3300042007 Bacteria 2821
177 Ga0439449_0017445 3300042007 Bacteria 2696
178 Ga0439462_0082569 3300042015 Bacteria 878
179 Ga0450905_004226 3300042142 Bacteria 1897
180 Ga0450901_002990 3300042533 Bacteria 1784
181 Ga0451577_0002646 3300042876 Bacteria 20977
182 Ga0453684_0931392 3300044712 Bacteria 928
183 Ga0495627_006539 3300046453 Bacteria 4559
184 Ga0495627_022075 3300046453 Bacteria 2099
185 Ga0495591_029813 3300046458 Bacteria 1653
186 Ga0495638_0003940 3300046460 Bacteria 11446
187 Ga0495638_0170097 3300046460 Bacteria 1251
188 Ga0495610_0002939 3300046512 Bacteria 13764
189 Ga0495631_0001021 3300046518 Bacteria 17380
190 Ga0495643_0000616 3300046522 Bacteria 42480
191 Ga0495643_0032377 3300046522 Bacteria 2903
192 Ga0495663_0002249 3300046525 Bacteria 5867
193 Ga0495663_0029969 3300046525 Bacteria 1609
194 Ga0495663_0095350 3300046525 Bacteria 974
195 Ga0495654_0023355 3300046530 Bacteria 3203
196 Ga0495621_0010005 3300046539 Bacteria 2894
197 Ga0495621_0081141 3300046539 Bacteria 1209
198 Ga0495633_0010465 3300046558 Bacteria 5058
199 Ga0495656_0075542 3300046615 Bacteria 1508
200 Ga0495656_0089445 3300046615 Bacteria 1405
201 Ga0495625_0060752 3300046660 Bacteria 2676
202 Ga0495625_0158452 3300046660 Bacteria 1518
203 Ga0495659_0034609 3300046664 Bacteria 1777
204 Ga0495670_0095100 3300046691 Bacteria 1528
205 Ga0495671_0093761 3300046692 Bacteria 1469
206 Ga0495636_0011624 3300047318 Bacteria 3485
207 Ga0495636_0212812 3300047318 Bacteria 885
208 Ga0495672_0000073 3300047320 Bacteria 179398
209 Ga0495677_0148802 3300047445 Bacteria 901
210 Ga0495686_0002815 3300047472 Bacteria 15772
211 Ga0495686_0102710 3300047472 Bacteria 1722
212 Ga0496104_0186520 3300048907 Bacteria 1985
213 Ga0496105_0598500 3300048908 Bacteria 856
214 Ga0496107_0468346 3300048910 Bacteria 935
215 Ga0496108_0055444 3300048911 Bacteria 3328
216 Ga0496108_0235470 3300048911 Bacteria 1592
217 Ga0496110_0261377 3300048913 Bacteria 1575
218 Ga0496111_0142624 3300048914 Bacteria 1775
219 Ga0496112_0368628 3300048915 Bacteria 1378
220 Ga0496113_0007018 3300048916 Bacteria 7204
221 Ga0496113_0365159 3300048916 Bacteria 1158
222 Ga0496115_0345094 3300048918 Bacteria 1215
223 Ga0496116_0006018 3300048919 Bacteria 11109
224 Ga0496116_0019663 3300048919 Bacteria 5162
225 Ga0496117_0002887 3300048920 Bacteria 20835
226 Ga0496117_0003123 3300048920 Bacteria 19780
227 Ga0496117_0003338 3300048920 Bacteria 18746
228 Ga0496117_0004414 3300048920 Bacteria 15542
229 Ga0496117_0012677 3300048920 Bacteria 7406
230 Ga0496118_0000344 3300048921 Bacteria 78989
231 Ga0496118_0004829 3300048921 Bacteria 15717
232 Ga0496118_0007415 3300048921 Bacteria 11636
233 Ga0496118_0014013 3300048921 Bacteria 7530
234 Ga0496118_0035937 3300048921 Bacteria 4014
235 Ga0496118_0036765 3300048921 Bacteria 3952
236 Ga0496118_0156366 3300048921 Bacteria 1417
237 Ga0496118_0262904 3300048921 Bacteria 972
238 Ga0496119_0000799 3300048922 Bacteria 42139
239 Ga0496119_0001529 3300048922 Bacteria 27644
240 Ga0496120_0000188 3300048923 Bacteria 105545
241 Ga0496120_0000562 3300048923 Bacteria 56572
242 Ga0496121_0015836 3300048924 Bacteria 7844
243 Ga0496121_0025525 3300048924 Bacteria 5602
244 Ga0496122_0000196 3300048925 Bacteria 136499
245 Ga0496122_0002270 3300048925 Bacteria 27809
246 Ga0496122_0041505 3300048925 Bacteria 3636
247 Ga0496122_0048431 3300048925 Bacteria 3267
248 Ga0496122_0064611 3300048925 Bacteria 2661
249 Ga0496123_0000106 3300048926 Bacteria 167799
250 Ga0496123_0000128 3300048926 Bacteria 154836
251 Ga0496123_0033462 3300048926 Bacteria 3698
252 Ga0496123_0036076 3300048926 Bacteria 3512
253 Ga0496123_0073000 3300048926 Bacteria 2131
254 Ga0496123_0076185 3300048926 Bacteria 2066
255 Ga0496124_0000281 3300048927 Bacteria 97214
256 Ga0496124_0000608 3300048927 Bacteria 60173
257 Ga0496124_0002637 3300048927 Bacteria 23065
258 Ga0496124_0008883 3300048927 Bacteria 10427
259 Ga0496124_0013195 3300048927 Bacteria 8080
260 Ga0496124_0015252 3300048927 Bacteria 7374
261 Ga0496124_0056810 3300048927 Bacteria 3299
262 Ga0496124_0103310 3300048927 Bacteria 2305
263 Ga0496124_0238109 3300048927 Bacteria 1355
264 Ga0496125_0001648 3300048928 Bacteria 31454
265 Ga0496125_0002960 3300048928 Bacteria 21344
266 Ga0496125_0006956 3300048928 Bacteria 12114
267 Ga0496125_0071853 3300048928 Bacteria 2700
268 Ga0496125_0088413 3300048928 Bacteria 2335
269 Ga0496125_0233319 3300048928 Bacteria 1174
270 Ga0496126_0001169 3300048929 Bacteria 43238
271 Ga0496126_0042122 3300048929 Bacteria 4219
272 Ga0496126_0104430 3300048929 Bacteria 2475
273 Ga0496126_0211339 3300048929 Bacteria 1633
274 Ga0501300_005719 3300049523 Bacteria 1832
275 Ga0501032_0088169 3300049569 Bacteria 2060
276 Ga0501033_0017677 3300049570 Bacteria 5385
277 Ga0501034_0066942 3300049571 Bacteria 3605
278 Ga0501036_0339056 3300049572 Bacteria 1255
279 Ga0501037_0064335 3300049573 Bacteria 2673
280 Ga0501038_0003207 3300049574 Bacteria 15264
281 Ga0501039_0000469 3300049575 Bacteria 29348
282 Ga0501040_0003160 3300049576 Bacteria 10670
283 Ga0501041_0003332 3300049577 Bacteria 9243
284 Ga0501042_0007838 3300049578 Bacteria 7021
285 Ga0501046_0005501 3300049580 Bacteria 11314
286 Ga0501048_0002327 3300049582 Bacteria 14497
287 Ga0501068_0289233 3300049584 Bacteria 1048
288 Ga0501069_0284279 3300049585 Bacteria 968
289 Ga0501070_0024115 3300049586 Bacteria 5102
290 Ga0501071_0129951 3300049587 Bacteria 1870
291 Ga0501071_0711443 3300049587 Bacteria 773
292 Ga0501074_0014032 3300049590 Bacteria 5824
293 Ga0501075_0001199 3300049591 Bacteria 16768
294 Ga0501076_0001310 3300049592 Bacteria 16602
295 Ga0501077_0012891 3300049593 Bacteria 5236
296 Ga0501217_099710 3300049661 Bacteria 824
297 Ga0501225_0002316 3300049705 Bacteria 5881
298 Ga0501079_0005501 3300049741 Bacteria 9440
299 Ga0501081_0001930 3300049743 Bacteria 12876
300 Ga0501045_0000880 3300049824 Bacteria 19510
301 nmdc:mga00v17_37678_c1 3300050491 Bacteria 2888
302 nmdc:mga00v17_48433_c1 3300050491 Bacteria 2576
303 nmdc:mga00v17_882_c1 3300050491 Bacteria 16231
304 nmdc:mga0yw44_10905_c1 3300050492 Bacteria 4659
305 nmdc:mga05p37_260268_c1 3300050507 Bacteria 2076
306 nmdc:mga06r32_897344_c1 3300050510 Bacteria 843
307 Ga0500634_0000227 3300053161 Bacteria 18188
308 Ga0501084_0038721 3300054114 Bacteria 3986
309 Ga0501084_0268403 3300054114 Bacteria 1441
310 Ga0501082_0005064 3300060353 Bacteria 11488
311 Ga0530510_0002460 3300061734 Bacteria 12754

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1150760 Ga0451839_1150760_73_597 167
2 3300049569 Ga0501032_0088169 Ga0501032_0088169_1343_1933 176
3 3300049570 Ga0501033_0017677 Ga0501033_0017677_4595_5185 176
4 3300049572 Ga0501036_0339056 Ga0501036_0339056_36_626 176
5 3300049573 Ga0501037_0064335 Ga0501037_0064335_1387_1977 176
6 3300049574 Ga0501038_0003207 Ga0501038_0003207_7311_7901 176
7 3300049575 Ga0501039_0000469 Ga0501039_0000469_22543_23133 176
8 3300049576 Ga0501040_0003160 Ga0501040_0003160_7312_7902 176
9 3300049577 Ga0501041_0003332 Ga0501041_0003332_895_1485 176
10 3300049578 Ga0501042_0007838 Ga0501042_0007838_780_1370 176
11 3300049580 Ga0501046_0005501 Ga0501046_0005501_5877_6467 176
12 3300049582 Ga0501048_0002327 Ga0501048_0002327_4216_4806 176
13 3300049584 Ga0501068_0289233 Ga0501068_0289233_172_762 176
14 3300049586 Ga0501070_0024115 Ga0501070_0024115_234_824 176
15 3300049587 Ga0501071_0129951 Ga0501071_0129951_1237_1827 176
16 3300049590 Ga0501074_0014032 Ga0501074_0014032_327_917 176
17 3300049591 Ga0501075_0001199 Ga0501075_0001199_8548_9138 176
18 3300049592 Ga0501076_0001310 Ga0501076_0001310_6095_6685 176
19 3300049593 Ga0501077_0012891 Ga0501077_0012891_312_902 176
20 3300049741 Ga0501079_0005501 Ga0501079_0005501_8127_8717 176
21 3300049743 Ga0501081_0001930 Ga0501081_0001930_1696_2286 176
22 3300049824 Ga0501045_0000880 Ga0501045_0000880_9145_9735 176
23 3300054114 Ga0501084_0038721 Ga0501084_0038721_2729_3319 176
24 3300060353 Ga0501082_0005064 Ga0501082_0005064_8130_8720 176
25 3300061734 Ga0530510_0002460 Ga0530510_0002460_1483_2073 176
26 3300005545 Ga0070695_100129536 Ga0070695_1001295362 186
27 3300005546 Ga0070696_100004341 Ga0070696_1000043413 186
28 3300006847 Ga0075431_100814696 Ga0075431_1008146962 186
29 3300050510 nmdc:mga06r32_897344_c1 nmdc:mga06r32_897344_c1_47_637 186
30 3300032005 Ga0307411_10129272 Ga0307411_101292722 187
31 3300049585 Ga0501069_0284279 Ga0501069_0284279_305_898 187
32 3300049587 Ga0501071_0711443 Ga0501071_0711443_21_614 187
33 3300050507 nmdc:mga05p37_260268_c1 nmdc:mga05p37_260268_c1_1299_1895 188
34 3300042876 Ga0451577_0002646 Ga0451577_0002646_2943_3608 189
35 3300044712 Ga0453684_0931392 Ga0453684_0931392_111_776 189
36 3300035692 Ga0373935_0689960 Ga0373935_0689960_43_642 190
37 3300054114 Ga0501084_0268403 Ga0501084_0268403_189_800 191
38 3300046512 Ga0495610_0002939 Ga0495610_0002939_8170_8841 194
39 3300046518 Ga0495631_0001021 Ga0495631_0001021_2034_2705 194
40 iso_pu_bacteria 2987605356 2987607408 195
41 3300005367 Ga0070667_100669324 Ga0070667_1006693242 197
42 3300013296 Ga0157374_10015319 Ga0157374_100153193 197
43 3300041509 Ga0451843_1320003 Ga0451843_1320003_759_1388 197
44 3300032005 Ga0307411_10455067 Ga0307411_104550671 198
45 3300042006 Ga0439432_008836 Ga0439432_008836_728_1354 198
46 3300042015 Ga0439462_0082569 Ga0439462_0082569_12_638 198
47 3300042533 Ga0450901_002990 Ga0450901_002990_618_1319 198
48 iso_pu_bacteria 2576861471 2578457554 198
49 iso_pu_bacteria 2747842501 2748018327 198
50 iso_pu_bacteria 2816332141 2816519021 198
51 iso_pu_bacteria 2842757796 2842760555 198
52 iso_pu_bacteria 2857442823 2857444751 198
53 iso_pu_bacteria 2939589442 2939591152 198
54 iso_pu_bacteria 2939622612 2939624649 198
55 iso_pu_bacteria 2974307012 2974308182 198
56 iso_pu_bacteria 2977247770 2977248934 198
57 iso_pu_bacteria 2984514374 2984516609 198
58 3300032004 Ga0307414_10268376 Ga0307414_102683762 199
59 3300041462 Ga0451806_403891 Ga0451806_403891_397_1035 199
60 3300041463 Ga0451804_0067688 Ga0451804_0067688_89_727 199
61 3300041486 Ga0451807_0383160 Ga0451807_0383160_1579_2217 199
62 3300046525 Ga0495663_0002249 Ga0495663_0002249_885_1529 199
63 3300048925 Ga0496122_0000196 Ga0496122_0000196_133192_133872 199
64 3300048926 Ga0496123_0000128 Ga0496123_0000128_133188_133868 199
65 3300048928 Ga0496125_0088413 Ga0496125_0088413_1567_2211 199
66 3300049571 Ga0501034_0066942 Ga0501034_0066942_1496_2182 199
67 iso_pu_bacteria 2547132130 2547503202 199
68 iso_pu_bacteria 2747842428 2747949962 199
69 iso_pu_bacteria 2765235840 2765579929 199
70 iso_pu_bacteria 2842391507 2842394886 199
71 iso_pu_bacteria 2852649853 2852649978 199
72 iso_pu_bacteria 2874220319 2874222615 199
73 iso_pu_bacteria 2919089067 2919090557 199
74 iso_pu_bacteria 2919134579 2919137518 199
75 iso_pu_bacteria 2928496128 2928498391 199
76 iso_pu_bacteria 2931380184 2931383926 199
77 iso_pu_bacteria 2937610967 2937614511 199
78 iso_pu_bacteria 2939626828 2939628265 199
79 iso_pu_bacteria 2941475908 2941476677 199
80 iso_pu_bacteria 2961047084 2961049380 199
81 iso_pu_bacteria 2961064222 2961065936 199
82 3300006051 Ga0075364_10000031 Ga0075364_1000003135 200
83 3300009093 Ga0105240_10002038 Ga0105240_1000203818 200
84 3300009098 Ga0105245_10046692 Ga0105245_100466922 200
85 3300025913 Ga0207695_10011748 Ga0207695_100117484 200
86 3300042142 Ga0450905_004226 Ga0450905_004226_475_1347 200
87 3300049523 Ga0501300_005719 Ga0501300_005719_234_911 200
88 3300050491 nmdc:mga00v17_882_c1 nmdc:mga00v17_882_c1_4330_5169 200
89 3300003775 Ga0055524_1021027 Ga0055524_10210272 201
90 3300003781 Ga0055536_1003939 Ga0055536_10039396 201
91 3300003781 Ga0055536_1005773 Ga0055536_10057736 201
92 3300003791 Ga0055530_10004740 Ga0055530_100047402 201
93 3300003794 Ga0055531_10007461 Ga0055531_100074616 201
94 3300009011 Ga0105251_10002110 Ga0105251_1000211011 201
95 3300025292 Ga0209676_1000091 Ga0209676_1000091144 201
96 3300025292 Ga0209676_1001162 Ga0209676_100116211 201
97 3300025298 Ga0209050_1000206 Ga0209050_10002062 201
98 3300025298 Ga0209050_1063334 Ga0209050_10633341 201
99 3300025299 Ga0209256_1004404 Ga0209256_10044048 201
100 3300025303 Ga0209051_1001733 Ga0209051_100173311 201
101 3300025304 Ga0209257_1000062 Ga0209257_100006262 201
102 3300025304 Ga0209257_1000711 Ga0209257_100071113 201
103 3300025304 Ga0209257_1001502 Ga0209257_10015029 201
104 3300025735 Ga0207713_1008456 Ga0207713_10084564 201
105 3300048927 Ga0496124_0000281 Ga0496124_0000281_78553_79221 201
106 3300003771 Ga0055526_1000486 Ga0055526_10004864 202
107 3300003773 Ga0055537_1000261 Ga0055537_100026125 202
108 3300003784 Ga0055534_1000034 Ga0055534_100003434 202
109 3300003790 Ga0055528_1000845 Ga0055528_100084516 202
110 3300003791 Ga0055530_10003023 Ga0055530_100030236 202
111 3300005548 Ga0070665_100231303 Ga0070665_1002313032 202
112 3300006038 Ga0075365_10011772 Ga0075365_100117725 202
113 3300006038 Ga0075365_10415379 Ga0075365_104153791 202
114 3300006178 Ga0075367_10133535 Ga0075367_101335353 202
115 3300013104 Ga0157370_10005323 Ga0157370_1000532310 202
116 3300013308 Ga0157375_10387205 Ga0157375_103872052 202
117 3300014497 Ga0182008_10000045 Ga0182008_10000045107 202
118 3300014497 Ga0182008_10023080 Ga0182008_100230803 202
119 3300017792 Ga0163161_10000692 Ga0163161_100006923 202
120 3300017792 Ga0163161_10177473 Ga0163161_101774732 202
121 3300025263 Ga0209565_1000022 Ga0209565_1000022342 202
122 3300025273 Ga0209673_1000104 Ga0209673_100010489 202
123 3300025291 Ga0209675_1000048 Ga0209675_1000048155 202
124 3300025295 Ga0209564_1000213 Ga0209564_100021331 202
125 3300025298 Ga0209050_1000175 Ga0209050_1000175129 202
126 3300025304 Ga0209257_1005535 Ga0209257_10055356 202
127 3300027614 Ga0209970_1004955 Ga0209970_10049551 202
128 3300028379 Ga0268266_10262370 Ga0268266_102623702 202
129 3300030732 Ga0316176_1096536 Ga0316176_10965361 202
130 3300030742 Ga0316183_1088245 Ga0316183_10882452 202
131 3300032005 Ga0307411_10254500 Ga0307411_102545003 202
132 3300042006 Ga0439432_009256 Ga0439432_009256_1171_1842 202
133 3300046453 Ga0495627_006539 Ga0495627_006539_549_1247 202
134 3300046458 Ga0495591_029813 Ga0495591_029813_358_1029 202
135 3300046460 Ga0495638_0003940 Ga0495638_0003940_6491_7192 202
136 3300046522 Ga0495643_0000616 Ga0495643_0000616_12733_13434 202
137 3300046660 Ga0495625_0060752 Ga0495625_0060752_1678_2379 202
138 3300047320 Ga0495672_0000073 Ga0495672_0000073_126899_127600 202
139 3300047472 Ga0495686_0002815 Ga0495686_0002815_14371_15072 202
140 3300048916 Ga0496113_0007018 Ga0496113_0007018_2067_2768 202
141 3300048920 Ga0496117_0003123 Ga0496117_0003123_4813_5514 202
142 3300048920 Ga0496117_0003338 Ga0496117_0003338_2139_2807 202
143 3300048920 Ga0496117_0004414 Ga0496117_0004414_1258_1959 202
144 3300048920 Ga0496117_0012677 Ga0496117_0012677_4399_5070 202
145 3300048921 Ga0496118_0000344 Ga0496118_0000344_47432_48100 202
146 3300048921 Ga0496118_0004829 Ga0496118_0004829_769_1470 202
147 3300048921 Ga0496118_0007415 Ga0496118_0007415_2376_3047 202
148 3300048921 Ga0496118_0036765 Ga0496118_0036765_3098_3769 202
149 3300048924 Ga0496121_0015836 Ga0496121_0015836_4697_5398 202
150 3300048925 Ga0496122_0041505 Ga0496122_0041505_2342_3043 202
151 3300048925 Ga0496122_0048431 Ga0496122_0048431_596_1297 202
152 3300048925 Ga0496122_0064611 Ga0496122_0064611_1321_2022 202
153 3300048926 Ga0496123_0033462 Ga0496123_0033462_1995_2696 202
154 3300048926 Ga0496123_0036076 Ga0496123_0036076_817_1518 202
155 3300048927 Ga0496124_0008883 Ga0496124_0008883_3864_4565 202
156 3300048927 Ga0496124_0013195 Ga0496124_0013195_7022_7693 202
157 3300048927 Ga0496124_0015252 Ga0496124_0015252_5971_6672 202
158 3300048927 Ga0496124_0056810 Ga0496124_0056810_1992_2663 202
159 3300048928 Ga0496125_0006956 Ga0496125_0006956_4927_5628 202
160 3300048928 Ga0496125_0071853 Ga0496125_0071853_1322_1993 202
161 3300048929 Ga0496126_0042122 Ga0496126_0042122_2535_3206 202
162 3300050491 nmdc:mga00v17_37678_c1 nmdc:mga00v17_37678_c1_1693_2394 202
163 3300050492 nmdc:mga0yw44_10905_c1 nmdc:mga0yw44_10905_c1_1577_2278 202
164 iso_pu_bacteria 2818991457 2819660114 202
165 iso_pu_bacteria 2852684882 2852685070 202
166 iso_pu_bacteria 2895498888 2895500827 202
167 iso_pu_bacteria 2895511927 2895516303 202
168 iso_pu_bacteria 2895522137 2895523779 202
169 iso_pu_bacteria 2895525241 2895526639 202
170 iso_pu_bacteria 2929195423 2929198386 202
171 iso_pu_bacteria 8021622325 8021626355 202
172 iso_pu_bacteria 8021626552 8021627659 202
173 iso_pu_bacteria 8021648035 8021650778 202
174 3300003856 Ga0058692_1000011 Ga0058692_100001140 203
175 3300005548 Ga0070665_100453663 Ga0070665_1004536632 203
176 3300006051 Ga0075364_10081596 Ga0075364_100815963 203
177 3300009036 Ga0105244_10163390 Ga0105244_101633902 203
178 3300009036 Ga0105244_10190680 Ga0105244_101906801 203
179 3300009148 Ga0105243_10176514 Ga0105243_101765141 203
180 3300013102 Ga0157371_10000154 Ga0157371_1000015459 203
181 3300013104 Ga0157370_10034606 Ga0157370_100346061 203
182 3300013105 Ga0157369_10755338 Ga0157369_107553381 203
183 3300015261 Ga0182006_1011851 Ga0182006_10118512 203
184 3300015261 Ga0182006_1029077 Ga0182006_10290772 203
185 3300015262 Ga0182007_10000175 Ga0182007_100001753 203
186 3300015265 Ga0182005_1000733 Ga0182005_10007333 203
187 3300017792 Ga0163161_10010740 Ga0163161_100107405 203
188 3300025292 Ga0209676_1000117 Ga0209676_1000117120 203
189 3300025728 Ga0207655_1091835 Ga0207655_10918352 203
190 3300025935 Ga0207709_10049897 Ga0207709_100498971 203
191 3300027312 Ga0209371_1000007 Ga0209371_1000007435 203
192 3300028379 Ga0268266_10403814 Ga0268266_104038142 203
193 3300030500 Ga0268256_1000008 Ga0268256_1000008515 203
194 3300031911 Ga0307412_10001664 Ga0307412_100016646 203
195 3300032004 Ga0307414_10005590 Ga0307414_100055904 203
196 3300048907 Ga0496104_0186520 Ga0496104_0186520_1045_1719 203
197 3300048919 Ga0496116_0006018 Ga0496116_0006018_5548_6222 203
198 3300048919 Ga0496116_0019663 Ga0496116_0019663_3914_4588 203
199 3300048921 Ga0496118_0035937 Ga0496118_0035937_2668_3342 203
200 3300048921 Ga0496118_0262904 Ga0496118_0262904_231_905 203
201 3300048922 Ga0496119_0000799 Ga0496119_0000799_39964_40638 203
202 3300048923 Ga0496120_0000188 Ga0496120_0000188_103223_103897 203
203 3300048924 Ga0496121_0025525 Ga0496121_0025525_4789_5463 203
204 3300048926 Ga0496123_0073000 Ga0496123_0073000_1039_1713 203
205 3300048926 Ga0496123_0076185 Ga0496123_0076185_1149_1784 203
206 3300048927 Ga0496124_0002637 Ga0496124_0002637_6122_6796 203
207 3300048927 Ga0496124_0103310 Ga0496124_0103310_1037_1711 203
208 3300048927 Ga0496124_0238109 Ga0496124_0238109_412_1086 203
209 3300048928 Ga0496125_0001648 Ga0496125_0001648_29362_30036 203
210 3300048928 Ga0496125_0002960 Ga0496125_0002960_12317_12991 203
211 3300048929 Ga0496126_0001169 Ga0496126_0001169_40901_41575 203
212 3300048929 Ga0496126_0211339 Ga0496126_0211339_230_865 203
213 3300006038 Ga0075365_10619494 Ga0075365_106194941 204
214 3300041494 Ga0451837_0755288 Ga0451837_0755288_274_927 204
215 3300041509 Ga0451843_1438775 Ga0451843_1438775_407_1060 204
216 3300046453 Ga0495627_022075 Ga0495627_022075_913_1566 204
217 3300046558 Ga0495633_0010465 Ga0495633_0010465_3493_4146 204
218 3300053161 Ga0500634_0000227 Ga0500634_0000227_13656_14309 204
219 iso_pu_bacteria 2643221559 2643816264 204
220 iso_pu_bacteria 2643221586 2643939051 204
221 iso_pu_bacteria 2643221612 2644077208 204
222 iso_pu_bacteria 2643221727 2644694565 204
223 3300006051 Ga0075364_10024894 Ga0075364_100248942 205
224 3300006051 Ga0075364_10026484 Ga0075364_100264842 205
225 3300050491 nmdc:mga00v17_48433_c1 nmdc:mga00v17_48433_c1_1586_2236 205
226 iso_pu_bacteria 2643221695 2644528680 205
227 2162886007 SwRhRL2b_contig_3895547 SwRhRL2b_0038.00000640 206
228 3300005289 Ga0065704_10070324 Ga0065704_100703245 206
229 3300005331 Ga0070670_100006830 Ga0070670_10000683010 206
230 3300011119 Ga0105246_10479421 Ga0105246_104794211 206
231 3300015265 Ga0182005_1028335 Ga0182005_10283353 206
232 3300025735 Ga0207713_1000514 Ga0207713_10005149 206
233 3300025925 Ga0207650_10018327 Ga0207650_100183273 206
234 3300025935 Ga0207709_10005875 Ga0207709_100058751 206
235 3300027312 Ga0209371_1000016 Ga0209371_1000016417 206
236 3300030500 Ga0268256_1000015 Ga0268256_1000015153 206
237 3300031824 Ga0307413_10181230 Ga0307413_101812302 206
238 3300041494 Ga0451837_0705007 Ga0451837_0705007_355_1008 206
239 3300048920 Ga0496117_0002887 Ga0496117_0002887_17059_17721 206
240 3300048921 Ga0496118_0014013 Ga0496118_0014013_4816_5472 206
241 3300048921 Ga0496118_0156366 Ga0496118_0156366_253_915 206
242 3300048922 Ga0496119_0001529 Ga0496119_0001529_9924_10586 206
243 3300048923 Ga0496120_0000562 Ga0496120_0000562_19683_20345 206
244 3300048925 Ga0496122_0002270 Ga0496122_0002270_17097_17759 206
245 3300048926 Ga0496123_0000106 Ga0496123_0000106_17097_17759 206
246 3300048927 Ga0496124_0000608 Ga0496124_0000608_15852_16514 206
247 3300048929 Ga0496126_0104430 Ga0496126_0104430_919_1575 206
248 3300025923 Ga0207681_10550252 Ga0207681_105502521 207
249 3300025933 Ga0207706_10280620 Ga0207706_102806202 207
250 3300032004 Ga0307414_10098430 Ga0307414_100984304 207
251 3300032004 Ga0307414_10469383 Ga0307414_104693831 207
252 3300041451 Ga0451791_0399408 Ga0451791_0399408_912_1562 207
253 3300041453 Ga0451797_0453175 Ga0451797_0453175_1619_2269 207
254 3300041460 Ga0451802_0028384 Ga0451802_0028384_469_1119 207
255 3300041486 Ga0451807_0376030 Ga0451807_0376030_1374_2024 207
256 3300041494 Ga0451837_0784760 Ga0451837_0784760_214_864 207
257 3300005331 Ga0070670_100031806 Ga0070670_1000318066 208
258 3300005335 Ga0070666_10800356 Ga0070666_108003561 208
259 3300005347 Ga0070668_100012341 Ga0070668_1000123414 208
260 3300005355 Ga0070671_100225843 Ga0070671_1002258432 208
261 3300005367 Ga0070667_100441242 Ga0070667_1004412422 208
262 3300005435 Ga0070714_100036197 Ga0070714_1000361972 208
263 3300005457 Ga0070662_100363952 Ga0070662_1003639522 208
264 3300005459 Ga0068867_100168012 Ga0068867_1001680121 208
265 3300005543 Ga0070672_100138049 Ga0070672_1001380492 208
266 3300009177 Ga0105248_10445602 Ga0105248_104456022 208
267 3300012500 Ga0157314_1001314 Ga0157314_10013142 208
268 3300012512 Ga0157327_1003895 Ga0157327_10038952 208
269 3300013308 Ga0157375_10067257 Ga0157375_100672572 208
270 3300017792 Ga0163161_10101252 Ga0163161_101012523 208
271 3300017792 Ga0163161_10306836 Ga0163161_103068362 208
272 3300025304 Ga0209257_1000148 Ga0209257_10001485 208
273 3300025925 Ga0207650_10098500 Ga0207650_100985004 208
274 3300025931 Ga0207644_10447115 Ga0207644_104471151 208
275 3300025940 Ga0207691_10006445 Ga0207691_100064455 208
276 3300026088 Ga0207641_10282542 Ga0207641_102825422 208
277 3300026118 Ga0207675_100260980 Ga0207675_1002609802 208
278 3300027360 Ga0209969_1017244 Ga0209969_10172441 208
279 3300027543 Ga0209999_1000100 Ga0209999_10001001 208
280 3300027552 Ga0209982_1002542 Ga0209982_10025425 208
281 3300027665 Ga0209983_1001909 Ga0209983_10019092 208
282 3300027682 Ga0209971_1000857 Ga0209971_10008575 208
283 3300027876 Ga0209974_10001531 Ga0209974_100015315 208
284 3300031456 Ga0307513_10002570 Ga0307513_1000257010 208
285 3300031824 Ga0307413_10028276 Ga0307413_100282762 208
286 3300031911 Ga0307412_10151270 Ga0307412_101512702 208
287 3300032004 Ga0307414_10002558 Ga0307414_100025583 208
288 3300032004 Ga0307414_10160821 Ga0307414_101608212 208
289 3300037418 Ga0395900_0168906 Ga0395900_0168906_613_1272 208
290 3300038443 Ga0395901_0283198 Ga0395901_0283198_171_830 208
291 3300041413 Ga0439465_0003734 Ga0439465_0003734_952_1614 208
292 3300042007 Ga0439449_0015984 Ga0439449_0015984_537_1193 208
293 3300042007 Ga0439449_0017445 Ga0439449_0017445_38_700 208
294 3300046460 Ga0495638_0170097 Ga0495638_0170097_540_1202 208
295 3300046522 Ga0495643_0032377 Ga0495643_0032377_734_1396 208
296 3300046525 Ga0495663_0029969 Ga0495663_0029969_314_976 208
297 3300046525 Ga0495663_0095350 Ga0495663_0095350_257_922 208
298 3300046530 Ga0495654_0023355 Ga0495654_0023355_1454_2116 208
299 3300046615 Ga0495656_0075542 Ga0495656_0075542_146_811 208
300 3300046615 Ga0495656_0089445 Ga0495656_0089445_472_1134 208
301 3300046660 Ga0495625_0158452 Ga0495625_0158452_270_932 208
302 3300046692 Ga0495671_0093761 Ga0495671_0093761_763_1425 208
303 3300047318 Ga0495636_0011624 Ga0495636_0011624_2126_2791 208
304 3300047445 Ga0495677_0148802 Ga0495677_0148802_50_715 208
305 3300048908 Ga0496105_0598500 Ga0496105_0598500_151_816 208
306 3300048910 Ga0496107_0468346 Ga0496107_0468346_120_785 208
307 3300048911 Ga0496108_0055444 Ga0496108_0055444_1974_2630 208
308 3300048911 Ga0496108_0235470 Ga0496108_0235470_666_1331 208
309 3300048913 Ga0496110_0261377 Ga0496110_0261377_398_1063 208
310 3300048914 Ga0496111_0142624 Ga0496111_0142624_839_1504 208
311 3300048915 Ga0496112_0368628 Ga0496112_0368628_557_1222 208
312 3300048916 Ga0496113_0365159 Ga0496113_0365159_274_939 208
313 3300048918 Ga0496115_0345094 Ga0496115_0345094_41_706 208
314 3300048928 Ga0496125_0233319 Ga0496125_0233319_243_965 208
315 3300002773 JGI25152J39213_1000023 JGI25152J39213_100002363 209
316 3300002774 JGI25150J39212_1000646 JGI25150J39212_10006462 209
317 3300003187 JGI25151J46595_10000100 JGI25151J46595_1000010034 209
318 3300003215 JGI25153J46596_10000071 JGI25153J46596_1000007134 209
319 3300025245 Ga0207425_1000030 Ga0207425_1000030150 209
320 3300025258 Ga0209129_1000063 Ga0209129_100006372 209
321 3300025294 Ga0209025_1000013 Ga0209025_1000013644 209
322 3300025294 Ga0209025_1006302 Ga0209025_10063024 209
323 3300025297 Ga0209758_1000014 Ga0209758_1000014644 209
324 3300025299 Ga0209256_1007920 Ga0209256_10079204 209
325 3300031852 Ga0307410_10202042 Ga0307410_102020423 209
326 3300031903 Ga0307407_10318407 Ga0307407_103184072 209
327 3300031911 Ga0307412_10144009 Ga0307412_101440091 209
328 3300031911 Ga0307412_10170752 Ga0307412_101707522 209
329 3300031911 Ga0307412_10401380 Ga0307412_104013802 209
330 3300032004 Ga0307414_10347974 Ga0307414_103479742 209
331 3300042007 Ga0439449_0007316 Ga0439449_0007316_1888_2568 209
332 3300046539 Ga0495621_0010005 Ga0495621_0010005_53_712 209
333 3300046691 Ga0495670_0095100 Ga0495670_0095100_358_1041 209
334 3300047472 Ga0495686_0102710 Ga0495686_0102710_406_1071 209
335 3300049661 Ga0501217_099710 Ga0501217_099710_96_755 209
336 3300005293 Ga0065715_10392350 Ga0065715_103923501 210
337 3300030731 Ga0316177_1077226 Ga0316177_10772263 210
338 3300030733 Ga0314311_1150566 Ga0314311_11505662 210
339 3300030733 Ga0314311_1252374 Ga0314311_12523743 210
340 3300030735 Ga0316178_1136278 Ga0316178_11362782 210
341 3300041404 Ga0439436_0092426 Ga0439436_0092426_159_812 210
342 3300041413 Ga0439465_0004272 Ga0439465_0004272_2481_3146 210
343 3300042004 Ga0439445_0005232 Ga0439445_0005232_2138_2833 210
344 3300042007 Ga0439449_0002049 Ga0439449_0002049_3128_3793 210
345 3300046539 Ga0495621_0081141 Ga0495621_0081141_453_1124 210
346 3300046664 Ga0495659_0034609 Ga0495659_0034609_919_1590 210
347 3300047318 Ga0495636_0212812 Ga0495636_0212812_41_712 210
348 3300049705 Ga0501225_0002316 Ga0501225_0002316_2738_3433 210
349 3300025292 Ga0209676_1006850 Ga0209676_10068503 211
350 2162886007 SwRhRL2b_contig_1455210 SwRhRL2b_0455.00005770 214
351 3300005289 Ga0065704_10070640 Ga0065704_100706404 214
352 3300032004 Ga0307414_10320308 Ga0307414_103203082 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

63

212

0.94

PF08551

DUF1751

Eukaryotic integral membrane protein (DUF1751)

60

147

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7897 5 190
5f5k-assembly1.cif.gz_A e.coli glpg y205f mutant complexed with aldehyde inhibitor in dmpc/chapso bicelle 0.7887 5 190
6pja-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7837 7 190
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7836 5 190
6pj9-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7832 5 190
ID Description Score Start End Superfamily
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8981 8 190 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8973 8 195 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8705 8 195 1.20.1540.10
af_Q54D88_171_373_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.865 8 190 1.20.1540.10
af_Q8I3V7_262_478_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8513 7 190 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A1J5RZX3-F1-model_v4 Rhomboid protease GluP (EC 3.4.21.105) 0.9577 9 195 GO:0004252
GO:0006508
GO:0016020
AF-A0A4Z0FEC8-F1-model_v4 Rhomboid family intramembrane serine protease 0.9539 9 202 GO:0004252
GO:0006508
GO:0016020
AF-A0A2E6EAT9-F1-model_v4 Peptidase S54 rhomboid domain-containing protein 0.953 44 195 GO:0004252
GO:0006508
GO:0016020
AF-A0A562E3E1-F1-model_v4 Membrane associated rhomboid family serine protease 0.9525 1 180 GO:0004252
GO:0006508
GO:0016020
AF-A0A350BXA7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9511 7 195 GO:0004252
GO:0006508
GO:0016020

Feature Viewer

pLDDT pTM Quality
86.43 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map