F419014

General Info

Members Datasets Scaffolds Average Seq Length
352 205 704 285

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10071432|Ga0105239_100714322
Length 346
Sequence MLHNSDAPRNPQTRTSPPGACIIRAPIPFSAAEFPDIFNGSDLKSRFGTTEKTVLNQGIDPSKGAMKTPSALQPLIDDGVIDEVIRSLKSGKEATVYVVRTGTQLRCAKVYRDMAQRSFQKRAQYQEGRKVRGSRQARAMSKSTRYGRKEQEAAWKNAEVDALYQLVAADVRVPRPYGYFNDVLIMELVTDSEGNPAPRLGEVDLSPETARGYHGFMIQQIVRMLSIGLIHGDLSEFNVLVAPDGPVIIDLPQVVNAAGNNGALAMLERDVNNIRNTLGRSAPELLETEFAREMWSLFEQGELKADSELTGRFARDEAQADADGVLAVIDDAREEALQRELGRQEM

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
195 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
196 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
197 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
198 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
199 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
200 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
201 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
202 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
203 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
204 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
205 3007803356 Pseudomonas sp. CM27 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 5.68
Rhizosphere 82.1
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10071432 3300010375 Bacteria 3813
2 Ga0065707_10082259 3300005295 Bacteria 18112
3 Ga0070683_100040906 3300005329 Bacteria 4262
4 Ga0070683_100223703 3300005329 Bacteria 1788
5 Ga0070683_100582684 3300005329 Bacteria 1070
6 Ga0070670_100127312 3300005331 Bacteria 2199
7 Ga0070677_10002577 3300005333 Bacteria 5802
8 Ga0070666_10009679 3300005335 Bacteria 6019
9 Ga0070680_100238507 3300005336 Bacteria 1537
10 Ga0070660_100050085 3300005339 Bacteria 3213
11 Ga0070675_100370805 3300005354 Bacteria 1273
12 Ga0070674_100042704 3300005356 Bacteria 3081
13 Ga0070673_100050093 3300005364 Bacteria 3264
14 Ga0070673_100053362 3300005364 Bacteria 3175
15 Ga0070667_100002251 3300005367 Bacteria 16983
16 Ga0070667_100447853 3300005367 Bacteria 1180
17 Ga0070713_100174958 3300005436 Bacteria 1925
18 Ga0070713_100418967 3300005436 Bacteria 1253
19 Ga0070710_10155457 3300005437 Bacteria 1414
20 Ga0070711_100021421 3300005439 Bacteria 4180
21 Ga0070700_100172988 3300005441 Bacteria 1497
22 Ga0070694_100047543 3300005444 Bacteria 2884
23 Ga0070678_100014321 3300005456 Bacteria 4999
24 Ga0070678_100019115 3300005456 Bacteria 4458
25 Ga0070681_10001851 3300005458 Bacteria 19099
26 Ga0070681_10003239 3300005458 Bacteria 15179
27 Ga0070681_10170245 3300005458 Bacteria 2100
28 Ga0068867_100066595 3300005459 Bacteria 2683
29 Ga0068867_100187108 3300005459 Bacteria 1650
30 Ga0070699_100029245 3300005518 Bacteria 4751
31 Ga0070679_100021104 3300005530 Bacteria 6356
32 Ga0070679_100073231 3300005530 Bacteria 3418
33 Ga0070679_100088658 3300005530 Bacteria 3080
34 Ga0070684_100146235 3300005535 Bacteria 2139
35 Ga0070684_100242140 3300005535 Bacteria 1648
36 Ga0068853_100627164 3300005539 Bacteria 1022
37 Ga0070672_100017546 3300005543 Bacteria 5155
38 Ga0070695_100006361 3300005545 Bacteria 6979
39 Ga0070695_100168991 3300005545 Bacteria 1541
40 Ga0070665_100002433 3300005548 Bacteria 20523
41 Ga0070665_100015753 3300005548 Bacteria 7596
42 Ga0070665_100018242 3300005548 Bacteria 7039
43 Ga0070665_100036977 3300005548 Bacteria 4910
44 Ga0068855_100000309 3300005563 Bacteria 60596
45 Ga0068855_100015321 3300005563 Bacteria 9232
46 Ga0068857_100238363 3300005577 Bacteria 1665
47 Ga0068856_100042976 3300005614 Bacteria 4446
48 Ga0068856_100159833 3300005614 Bacteria 2263
49 Ga0068859_100010601 3300005617 Bacteria 9276
50 Ga0068859_100016843 3300005617 Bacteria 7338
51 Ga0068861_100203281 3300005719 Bacteria 1664
52 Ga0068861_100238917 3300005719 Bacteria 1544
53 Ga0068870_10008025 3300005840 Bacteria 4729
54 Ga0068863_100000832 3300005841 Bacteria 30953
55 Ga0068863_100003854 3300005841 Bacteria 14834
56 Ga0068863_100034937 3300005841 Bacteria 4788
57 Ga0068863_100154348 3300005841 Bacteria 2198
58 Ga0068863_100218236 3300005841 Bacteria 1837
59 Ga0068858_100248441 3300005842 Bacteria 1689
60 Ga0068860_100000525 3300005843 Bacteria 46751
61 Ga0068860_100023369 3300005843 Bacteria 5974
62 Ga0068860_100421857 3300005843 Bacteria 1323
63 Ga0070717_10380302 3300006028 Bacteria 1266
64 Ga0070715_10122235 3300006163 Bacteria 1242
65 Ga0070712_100046969 3300006175 Bacteria 2986
66 Ga0097621_100008587 3300006237 Bacteria 7364
67 Ga0097621_100096663 3300006237 Bacteria 2478
68 Ga0097621_100141184 3300006237 Bacteria 2058
69 Ga0097621_100190938 3300006237 Bacteria 1774
70 Ga0068871_100023558 3300006358 Bacteria 4764
71 Ga0068871_100069672 3300006358 Bacteria 2889
72 Ga0068871_100097796 3300006358 Bacteria 2454
73 Ga0075430_100236634 3300006846 Bacteria 1513
74 Ga0068865_100051105 3300006881 Bacteria 2859
75 Ga0068865_100083857 3300006881 Bacteria 2295
76 Ga0097620_100010601 3300006931 Bacteria 9276
77 Ga0097620_100016843 3300006931 Bacteria 7338
78 Ga0105240_10053976 3300009093 Bacteria 5040
79 Ga0105240_10236582 3300009093 Bacteria 2119
80 Ga0105240_10295878 3300009093 Bacteria 1853
81 Ga0105240_10353015 3300009093 Bacteria 1668
82 Ga0105240_10542768 3300009093 Bacteria 1287
83 Ga0105240_10630392 3300009093 Bacteria 1177
84 Ga0111539_10010967 3300009094 Bacteria 11408
85 Ga0111539_10073468 3300009094 Bacteria 4032
86 Ga0105241_10015627 3300009174 Bacteria 5562
87 Ga0105242_10061392 3300009176 Bacteria 3091
88 Ga0105242_10078371 3300009176 Bacteria 2758
89 Ga0105248_10350330 3300009177 Bacteria 1662
90 Ga0105237_10048924 3300009545 Bacteria 4250
91 Ga0105237_10050138 3300009545 Bacteria 4195
92 Ga0105237_10115552 3300009545 Bacteria 2677
93 Ga0105237_10130971 3300009545 Bacteria 2503
94 Ga0105237_10178788 3300009545 Bacteria 2122
95 Ga0105237_10208416 3300009545 Bacteria 1955
96 Ga0105237_10301920 3300009545 Bacteria 1604
97 Ga0105238_10016807 3300009551 Bacteria 7418
98 Ga0105238_10090716 3300009551 Bacteria 3043
99 Ga0105238_10124029 3300009551 Bacteria 2562
100 Ga0105238_10126289 3300009551 Bacteria 2536
101 Ga0105238_10372132 3300009551 Bacteria 1419
102 Ga0105249_10049995 3300009553 Bacteria 3812
103 Ga0105249_10089943 3300009553 Bacteria 2869
104 Ga0105239_10015136 3300010375 Bacteria 8550
105 Ga0105239_10065645 3300010375 Bacteria 3986
106 Ga0105239_10079785 3300010375 Bacteria 3601
107 Ga0105239_10109668 3300010375 Bacteria 3059
108 Ga0105239_10556398 3300010375 Bacteria 1307
109 Ga0105246_10099303 3300011119 Bacteria 2116
110 Ga0157370_10043283 3300013104 Bacteria 4334
111 Ga0157370_10157089 3300013104 Bacteria 2116
112 Ga0157369_10009039 3300013105 Bacteria 11406
113 Ga0157369_10018187 3300013105 Bacteria 7883
114 Ga0157369_10356352 3300013105 Bacteria 1519
115 Ga0157374_10561731 3300013296 Bacteria 1149
116 Ga0163162_10046079 3300013306 Bacteria 4371
117 Ga0157372_10007183 3300013307 Bacteria 11854
118 Ga0157372_10044840 3300013307 Bacteria 4901
119 Ga0157372_10105096 3300013307 Bacteria 3230
120 Ga0157375_10001541 3300013308 Bacteria 19842
121 Ga0157375_10005716 3300013308 Bacteria 10818
122 Ga0157375_10101567 3300013308 Bacteria 2959
123 Ga0163163_10017705 3300014325 Bacteria 6651
124 Ga0163163_10269047 3300014325 Bacteria 1755
125 Ga0163163_10326441 3300014325 Bacteria 1589
126 Ga0163163_10551542 3300014325 Bacteria 1215
127 Ga0157380_10128807 3300014326 Bacteria 2156
128 Ga0157379_10017065 3300014968 Bacteria 6392
129 Ga0157379_10023884 3300014968 Bacteria 5427
130 Ga0157379_10039411 3300014968 Bacteria 4215
131 Ga0157379_10160458 3300014968 Bacteria 2029
132 Ga0157376_10192062 3300014969 Bacteria 1873
133 Ga0213874_10041416 3300021377 Bacteria 1379
134 Ga0207682_10002700 3300025893 Bacteria 7887
135 Ga0207682_10005000 3300025893 Bacteria 5437
136 Ga0207642_10089458 3300025899 Bacteria 1517
137 Ga0207699_10106490 3300025906 Bacteria 1789
138 Ga0207645_10067545 3300025907 Bacteria 2285
139 Ga0207645_10078515 3300025907 Bacteria 2115
140 Ga0207643_10003760 3300025908 Bacteria 8154
141 Ga0207643_10011497 3300025908 Bacteria 4781
142 Ga0207654_10099866 3300025911 Bacteria 1786
143 Ga0207707_10000287 3300025912 Bacteria 53641
144 Ga0207707_10007122 3300025912 Bacteria 9744
145 Ga0207707_10039703 3300025912 Bacteria 4114
146 Ga0207707_10096117 3300025912 Bacteria 2589
147 Ga0207707_10117330 3300025912 Bacteria 2327
148 Ga0207695_10108184 3300025913 Bacteria 2765
149 Ga0207695_10162378 3300025913 Bacteria 2165
150 Ga0207695_10193417 3300025913 Bacteria 1951
151 Ga0207695_10453639 3300025913 Bacteria 1165
152 Ga0207671_10127435 3300025914 Bacteria 1951
153 Ga0207671_10196716 3300025914 Bacteria 1573
154 Ga0207693_10006535 3300025915 Bacteria 9649
155 Ga0207649_10151246 3300025920 Bacteria 1599
156 Ga0207652_10007918 3300025921 Bacteria 8530
157 Ga0207652_10044475 3300025921 Bacteria 3783
158 Ga0207652_10128908 3300025921 Bacteria 2255
159 Ga0207681_10105497 3300025923 Bacteria 2040
160 Ga0207694_10014436 3300025924 Bacteria 5955
161 Ga0207694_10028495 3300025924 Bacteria 4258
162 Ga0207694_10210897 3300025924 Bacteria 1582
163 Ga0207650_10191856 3300025925 Bacteria 1633
164 Ga0207659_10034594 3300025926 Bacteria 3485
165 Ga0207687_10033937 3300025927 Bacteria 3463
166 Ga0207687_10075156 3300025927 Bacteria 2424
167 Ga0207700_10067558 3300025928 Bacteria 2737
168 Ga0207700_10185401 3300025928 Bacteria 1745
169 Ga0207700_10186698 3300025928 Bacteria 1739
170 Ga0207664_10007741 3300025929 Bacteria 7456
171 Ga0207664_10257033 3300025929 Archaea 1526
172 Ga0207644_10003439 3300025931 Bacteria 10235
173 Ga0207644_10054828 3300025931 Bacteria 2872
174 Ga0207704_10020407 3300025938 Bacteria 3505
175 Ga0207704_10245634 3300025938 Bacteria 1340
176 Ga0207704_10363614 3300025938 Bacteria 1130
177 Ga0207691_10009941 3300025940 Bacteria 9137
178 Ga0207691_10012517 3300025940 Bacteria 8133
179 Ga0207691_10018626 3300025940 Bacteria 6580
180 Ga0207691_10116457 3300025940 Bacteria 2371
181 Ga0207711_10037004 3300025941 Bacteria 4142
182 Ga0207711_10200980 3300025941 Bacteria 1818
183 Ga0207689_10084041 3300025942 Bacteria 2617
184 Ga0207661_10195775 3300025944 Bacteria 1774
185 Ga0207667_10013957 3300025949 Bacteria 9177
186 Ga0207667_10029322 3300025949 Bacteria 5968
187 Ga0207667_10030120 3300025949 Bacteria 5873
188 Ga0207667_10049675 3300025949 Bacteria 4429
189 Ga0207667_10205783 3300025949 Bacteria 2018
190 Ga0207712_10021667 3300025961 Bacteria 4221
191 Ga0207712_10352526 3300025961 Bacteria 1224
192 Ga0207712_10390617 3300025961 Bacteria 1167
193 Ga0207668_10045678 3300025972 Bacteria 2989
194 Ga0207658_10000078 3300025986 Bacteria 108156
195 Ga0207658_10055082 3300025986 Bacteria 2945
196 Ga0207658_10274439 3300025986 Bacteria 1443
197 Ga0207677_10333330 3300026023 Bacteria 1265
198 Ga0207703_10110078 3300026035 Bacteria 2349
199 Ga0207703_10295858 3300026035 Bacteria 1475
200 Ga0207639_10002962 3300026041 Bacteria 11420
201 Ga0207708_10189048 3300026075 Bacteria 1638
202 Ga0207702_10628925 3300026078 Bacteria 1055
203 Ga0207641_10000078 3300026088 Bacteria 143842
204 Ga0207641_10020499 3300026088 Bacteria 5430
205 Ga0207641_10086021 3300026088 Bacteria 2740
206 Ga0207641_10201582 3300026088 Bacteria 1835
207 Ga0207648_10016728 3300026089 Bacteria 6692
208 Ga0207648_10096050 3300026089 Bacteria 2593
209 Ga0207648_10131391 3300026089 Bacteria 2204
210 Ga0207676_10026713 3300026095 Bacteria 4294
211 Ga0207674_10249934 3300026116 Bacteria 1720
212 Ga0207675_100013474 3300026118 Bacteria 7630
213 Ga0207675_100111766 3300026118 Bacteria 2578
214 Ga0207675_100128668 3300026118 Bacteria 2400
215 Ga0207683_10031215 3300026121 Bacteria 4623
216 Ga0209968_1010091 3300027526 Bacteria 1449
217 Ga0209999_1006107 3300027543 Bacteria 2163
218 Ga0209982_1001366 3300027552 Bacteria 3316
219 Ga0209983_1000981 3300027665 Bacteria 6291
220 Ga0209971_1001108 3300027682 Bacteria 6838
221 Ga0209974_10030315 3300027876 Bacteria 1793
222 Ga0207428_10096599 3300027907 Bacteria 2288
223 Ga0268266_10003285 3300028379 Bacteria 16254
224 Ga0268266_10004643 3300028379 Bacteria 13100
225 Ga0268266_10011642 3300028379 Bacteria 7637
226 Ga0268266_10069973 3300028379 Unclassified 3041
227 Ga0268266_10091509 3300028379 Bacteria 2667
228 Ga0268266_10099378 3300028379 Bacteria 2562
229 Ga0268265_10191862 3300028380 Bacteria 1765
230 Ga0268265_10269631 3300028380 Bacteria 1518
231 Ga0268264_10000142 3300028381 Bacteria 170046
232 Ga0268264_10061224 3300028381 Bacteria 3157
233 Ga0307515_10009068 3300028794 Bacteria 19300
234 Ga0265338_10236192 3300028800 Bacteria 1356
235 Ga0307511_10000659 3300030521 Bacteria 36822
236 Ga0307511_10014605 3300030521 Bacteria 7639
237 Ga0265340_10045367 3300031247 Bacteria 2148
238 Ga0265331_10008268 3300031250 Bacteria 5931
239 Ga0307513_10018390 3300031456 Bacteria 8350
240 Ga0307513_10042994 3300031456 Bacteria 4968
241 Ga0307513_10132589 3300031456 Bacteria 2434
242 Ga0307509_10000036 3300031507 Bacteria 190164
243 Ga0307509_10132825 3300031507 Bacteria 2441
244 Ga0307408_100262894 3300031548 Bacteria 1429
245 Ga0307413_10065522 3300031824 Bacteria 2262
246 Ga0307410_10040663 3300031852 Bacteria 3061
247 Ga0307406_10000332 3300031901 Bacteria 27455
248 Ga0307407_10044325 3300031903 Bacteria 2506
249 Ga0307412_10570626 3300031911 Bacteria 953
250 Ga0307409_100463879 3300031995 Bacteria 1225
251 Ga0307414_10253792 3300032004 Bacteria 1463
252 Ga0307415_100279499 3300032126 Bacteria 1372
253 Ga0307510_10000001 3300033180 Bacteria 1172244
254 Ga0373936_0007485 3300035113 Bacteria 4106
255 Ga0373956_0141022 3300035119 Bacteria 1131
256 Ga0373955_0291503 3300035172 Bacteria 983
257 Ga0373927_0094767 3300035695 Bacteria 1940
258 Ga0373937_0006587 3300036401 Bacteria 10028
259 Ga0373937_0075167 3300036401 Bacteria 3118
260 Ga0373937_0187430 3300036401 Bacteria 1943
261 Ga0373937_0510692 3300036401 Bacteria 1142
262 Ga0373925_0224300 3300037068 Bacteria 1501
263 Ga0373925_0244733 3300037068 Bacteria 1437
264 Ga0436363_1718016 3300039450 Bacteria 2956
265 Ga0451789_1139778 3300041443 Bacteria 1659
266 Ga0451791_0150222 3300041451 Bacteria 5740
267 Ga0451793_1804681 3300041452 Bacteria 1955
268 Ga0451797_0578884 3300041453 Bacteria 3430
269 Ga0451807_1418858 3300041486 Bacteria 4366
270 Ga0451807_1765443 3300041486 Bacteria 1450
271 Ga0451833_0592807 3300041491 Bacteria 2484
272 Ga0451849_1220123 3300041505 Bacteria 3336
273 Ga0451849_1268022 3300041505 Bacteria 1361
274 Ga0451853_0309260 3300041512 Bacteria 1670
275 Ga0451577_0022485 3300042876 Bacteria 5758
276 Ga0451577_0072981 3300042876 Bacteria 3062
277 Ga0451577_0134178 3300042876 Bacteria 2222
278 Ga0466969_0012748 3300044656 Bacteria 4430
279 Ga0453684_0464760 3300044712 Bacteria 1406
280 Ga0466970_0033185 3300044765 Bacteria 2729
281 Ga0466959_0097843 3300045049 Unclassified 2102
282 Ga0451576_0846430 3300045051 Bacteria 960
283 Ga0495638_0014832 3300046460 Bacteria 5254
284 Ga0495638_0034685 3300046460 Bacteria 3222
285 Ga0495651_0064592 3300046462 Bacteria 2797
286 Ga0495653_0274444 3300046463 Bacteria 1109
287 Ga0495580_0002047 3300046472 Bacteria 17696
288 Ga0495580_0004351 3300046472 Bacteria 11895
289 Ga0495580_0036560 3300046472 Bacteria 3525
290 Ga0495580_0099947 3300046472 Bacteria 2018
291 Ga0495616_0086894 3300046513 Bacteria 1487
292 Ga0495630_0201943 3300046517 Bacteria 1517
293 Ga0495632_0027634 3300046519 Bacteria 2970
294 Ga0495632_0044725 3300046519 Bacteria 2209
295 Ga0495587_0056897 3300046536 Bacteria 2300
296 Ga0495625_0026021 3300046660 Bacteria 4426
297 Ga0495625_0139858 3300046660 Bacteria 1634
298 Ga0495647_0130439 3300046681 Bacteria 1065
299 Ga0495669_0080009 3300046684 Bacteria 1499
300 Ga0495649_0004956 3300046694 Bacteria 8579
301 Ga0495604_0182371 3300047317 Bacteria 1467
302 Ga0495602_0130509 3300048088 Bacteria 2005
303 Ga0496100_0192949 3300048903 Bacteria 1480
304 Ga0496101_0476271 3300048904 Bacteria 986
305 Ga0496102_0005846 3300048905 Bacteria 10467
306 Ga0496102_0024452 3300048905 Bacteria 5371
307 Ga0496103_0011573 3300048906 Bacteria 5231
308 Ga0496104_0111203 3300048907 Bacteria 2626
309 Ga0496105_0035582 3300048908 Bacteria 4098
310 Ga0496107_0107586 3300048910 Bacteria 2048
311 Ga0496111_0015304 3300048914 Bacteria 5264
312 Ga0496112_0094009 3300048915 Bacteria 2969
313 Ga0496112_0343870 3300048915 Bacteria 1435
314 Ga0496114_0121399 3300048917 Bacteria 2247
315 Ga0496115_0138043 3300048918 Bacteria 2010
316 Ga0496115_0351004 3300048918 Bacteria 1203
317 Ga0496117_0000012 3300048920 Bacteria 608530
318 Ga0496118_0000003 3300048921 Bacteria 773148
319 Ga0496118_0033977 3300048921 Bacteria 4172
320 Ga0496119_0001412 3300048922 Bacteria 29074
321 Ga0496119_0004826 3300048922 Bacteria 13210
322 Ga0496120_0000061 3300048923 Bacteria 172817
323 Ga0496120_0090676 3300048923 Bacteria 1633
324 Ga0496125_0000205 3300048928 Bacteria 124391
325 Ga0496125_0001935 3300048928 Bacteria 28302
326 Ga0496126_0000680 3300048929 Bacteria 62501
327 Ga0496126_0032906 3300048929 Bacteria 4879
328 Ga0496126_0157013 3300048929 Bacteria 1946
329 Ga0501046_0259737 3300049580 Bacteria 1276
330 nmdc:mga09592_89773_c1 3300050508 Bacteria 2625
331 nmdc:mga0qj67_233982_c1 3300050509 Bacteria 1491
332 nmdc:mga08y16_110132_c1 3300050511 Bacteria 2867
333 Ga0500617_072756 3300053124 Bacteria 1503
334 Ga0500568_0013314 3300053139 Unclassified 3752
335 Ga0500568_0053645 3300053139 Bacteria 1579
336 Ga0500568_0122141 3300053139 Bacteria 970
337 Ga0500588_0001129 3300053146 Bacteria 4890
338 Ga0500604_0011007 3300053151 Bacteria 2425
339 Ga0500622_0004217 3300053156 Bacteria 9161
340 Ga0500634_0191925 3300053161 Bacteria 907
341 Ga0500637_0135009 3300053178 Bacteria 1429
342 Ga0500661_023058 3300055283 Bacteria 1102
343 2510292929 2510065055 Bacteria 5037935
344 2510313402 2510065058 Bacteria 5005894
345 2687583476 2687453130 Bacteria 4227172
346 2774132552 2773857672 Bacteria 4993178
347 2894415235 2894414249 Bacteria 4405451
348 2917832871 2917832318 Bacteria 5346010
349 2919128571 2919125081 Bacteria 5385106
350 2974298898 2974298342 Bacteria 4840922
351 2984501195 2984499530 Bacteria 5020881
352 3007806789 3007803356 Bacteria 5931491
353 Ga0105239_10071432
354 Ga0065707_10082259
355 Ga0070683_100040906
356 Ga0070683_100223703
357 Ga0070683_100582684
358 Ga0070670_100127312
359 Ga0070677_10002577
360 Ga0070666_10009679
361 Ga0070680_100238507
362 Ga0070660_100050085
363 Ga0070675_100370805
364 Ga0070674_100042704
365 Ga0070673_100050093
366 Ga0070673_100053362
367 Ga0070667_100002251
368 Ga0070667_100447853
369 Ga0070713_100174958
370 Ga0070713_100418967
371 Ga0070710_10155457
372 Ga0070711_100021421
373 Ga0070700_100172988
374 Ga0070694_100047543
375 Ga0070678_100014321
376 Ga0070678_100019115
377 Ga0070681_10001851
378 Ga0070681_10003239
379 Ga0070681_10170245
380 Ga0068867_100066595
381 Ga0068867_100187108
382 Ga0070699_100029245
383 Ga0070679_100021104
384 Ga0070679_100073231
385 Ga0070679_100088658
386 Ga0070684_100146235
387 Ga0070684_100242140
388 Ga0068853_100627164
389 Ga0070672_100017546
390 Ga0070695_100006361
391 Ga0070695_100168991
392 Ga0070665_100002433
393 Ga0070665_100015753
394 Ga0070665_100018242
395 Ga0070665_100036977
396 Ga0068855_100000309
397 Ga0068855_100015321
398 Ga0068857_100238363
399 Ga0068856_100042976
400 Ga0068856_100159833
401 Ga0068859_100010601
402 Ga0068859_100016843
403 Ga0068861_100203281
404 Ga0068861_100238917
405 Ga0068870_10008025
406 Ga0068863_100000832
407 Ga0068863_100003854
408 Ga0068863_100034937
409 Ga0068863_100154348
410 Ga0068863_100218236
411 Ga0068858_100248441
412 Ga0068860_100000525
413 Ga0068860_100023369
414 Ga0068860_100421857
415 Ga0070717_10380302
416 Ga0070715_10122235
417 Ga0070712_100046969
418 Ga0097621_100008587
419 Ga0097621_100096663
420 Ga0097621_100141184
421 Ga0097621_100190938
422 Ga0068871_100023558
423 Ga0068871_100069672
424 Ga0068871_100097796
425 Ga0075430_100236634
426 Ga0068865_100051105
427 Ga0068865_100083857
428 Ga0097620_100010601
429 Ga0097620_100016843
430 Ga0105240_10053976
431 Ga0105240_10236582
432 Ga0105240_10295878
433 Ga0105240_10353015
434 Ga0105240_10542768
435 Ga0105240_10630392
436 Ga0111539_10010967
437 Ga0111539_10073468
438 Ga0105241_10015627
439 Ga0105242_10061392
440 Ga0105242_10078371
441 Ga0105248_10350330
442 Ga0105237_10048924
443 Ga0105237_10050138
444 Ga0105237_10115552
445 Ga0105237_10130971
446 Ga0105237_10178788
447 Ga0105237_10208416
448 Ga0105237_10301920
449 Ga0105238_10016807
450 Ga0105238_10090716
451 Ga0105238_10124029
452 Ga0105238_10126289
453 Ga0105238_10372132
454 Ga0105249_10049995
455 Ga0105249_10089943
456 Ga0105239_10015136
457 Ga0105239_10065645
458 Ga0105239_10079785
459 Ga0105239_10109668
460 Ga0105239_10556398
461 Ga0105246_10099303
462 Ga0157370_10043283
463 Ga0157370_10157089
464 Ga0157369_10009039
465 Ga0157369_10018187
466 Ga0157369_10356352
467 Ga0157374_10561731
468 Ga0163162_10046079
469 Ga0157372_10007183
470 Ga0157372_10044840
471 Ga0157372_10105096
472 Ga0157375_10001541
473 Ga0157375_10005716
474 Ga0157375_10101567
475 Ga0163163_10017705
476 Ga0163163_10269047
477 Ga0163163_10326441
478 Ga0163163_10551542
479 Ga0157380_10128807
480 Ga0157379_10017065
481 Ga0157379_10023884
482 Ga0157379_10039411
483 Ga0157379_10160458
484 Ga0157376_10192062
485 Ga0213874_10041416
486 Ga0207682_10002700
487 Ga0207682_10005000
488 Ga0207642_10089458
489 Ga0207699_10106490
490 Ga0207645_10067545
491 Ga0207645_10078515
492 Ga0207643_10003760
493 Ga0207643_10011497
494 Ga0207654_10099866
495 Ga0207707_10000287
496 Ga0207707_10007122
497 Ga0207707_10039703
498 Ga0207707_10096117
499 Ga0207707_10117330
500 Ga0207695_10108184
501 Ga0207695_10162378
502 Ga0207695_10193417
503 Ga0207695_10453639
504 Ga0207671_10127435
505 Ga0207671_10196716
506 Ga0207693_10006535
507 Ga0207649_10151246
508 Ga0207652_10007918
509 Ga0207652_10044475
510 Ga0207652_10128908
511 Ga0207681_10105497
512 Ga0207694_10014436
513 Ga0207694_10028495
514 Ga0207694_10210897
515 Ga0207650_10191856
516 Ga0207659_10034594
517 Ga0207687_10033937
518 Ga0207687_10075156
519 Ga0207700_10067558
520 Ga0207700_10185401
521 Ga0207700_10186698
522 Ga0207664_10007741
523 Ga0207664_10257033
524 Ga0207644_10003439
525 Ga0207644_10054828
526 Ga0207704_10020407
527 Ga0207704_10245634
528 Ga0207704_10363614
529 Ga0207691_10009941
530 Ga0207691_10012517
531 Ga0207691_10018626
532 Ga0207691_10116457
533 Ga0207711_10037004
534 Ga0207711_10200980
535 Ga0207689_10084041
536 Ga0207661_10195775
537 Ga0207667_10013957
538 Ga0207667_10029322
539 Ga0207667_10030120
540 Ga0207667_10049675
541 Ga0207667_10205783
542 Ga0207712_10021667
543 Ga0207712_10352526
544 Ga0207712_10390617
545 Ga0207668_10045678
546 Ga0207658_10000078
547 Ga0207658_10055082
548 Ga0207658_10274439
549 Ga0207677_10333330
550 Ga0207703_10110078
551 Ga0207703_10295858
552 Ga0207639_10002962
553 Ga0207708_10189048
554 Ga0207702_10628925
555 Ga0207641_10000078
556 Ga0207641_10020499
557 Ga0207641_10086021
558 Ga0207641_10201582
559 Ga0207648_10016728
560 Ga0207648_10096050
561 Ga0207648_10131391
562 Ga0207676_10026713
563 Ga0207674_10249934
564 Ga0207675_100013474
565 Ga0207675_100111766
566 Ga0207675_100128668
567 Ga0207683_10031215
568 Ga0209968_1010091
569 Ga0209999_1006107
570 Ga0209982_1001366
571 Ga0209983_1000981
572 Ga0209971_1001108
573 Ga0209974_10030315
574 Ga0207428_10096599
575 Ga0268266_10003285
576 Ga0268266_10004643
577 Ga0268266_10011642
578 Ga0268266_10069973
579 Ga0268266_10091509
580 Ga0268266_10099378
581 Ga0268265_10191862
582 Ga0268265_10269631
583 Ga0268264_10000142
584 Ga0268264_10061224
585 Ga0307515_10009068
586 Ga0265338_10236192
587 Ga0307511_10000659
588 Ga0307511_10014605
589 Ga0265340_10045367
590 Ga0265331_10008268
591 Ga0307513_10018390
592 Ga0307513_10042994
593 Ga0307513_10132589
594 Ga0307509_10000036
595 Ga0307509_10132825
596 Ga0307408_100262894
597 Ga0307413_10065522
598 Ga0307410_10040663
599 Ga0307406_10000332
600 Ga0307407_10044325
601 Ga0307412_10570626
602 Ga0307409_100463879
603 Ga0307414_10253792
604 Ga0307415_100279499
605 Ga0307510_10000001
606 Ga0373936_0007485
607 Ga0373956_0141022
608 Ga0373955_0291503
609 Ga0373927_0094767
610 Ga0373937_0006587
611 Ga0373937_0075167
612 Ga0373937_0187430
613 Ga0373937_0510692
614 Ga0373925_0224300
615 Ga0373925_0244733
616 Ga0436363_1718016
617 Ga0451789_1139778
618 Ga0451791_0150222
619 Ga0451793_1804681
620 Ga0451797_0578884
621 Ga0451807_1418858
622 Ga0451807_1765443
623 Ga0451833_0592807
624 Ga0451849_1220123
625 Ga0451849_1268022
626 Ga0451853_0309260
627 Ga0451577_0022485
628 Ga0451577_0072981
629 Ga0451577_0134178
630 Ga0466969_0012748
631 Ga0453684_0464760
632 Ga0466970_0033185
633 Ga0466959_0097843
634 Ga0451576_0846430
635 Ga0495638_0014832
636 Ga0495638_0034685
637 Ga0495651_0064592
638 Ga0495653_0274444
639 Ga0495580_0002047
640 Ga0495580_0004351
641 Ga0495580_0036560
642 Ga0495580_0099947
643 Ga0495616_0086894
644 Ga0495630_0201943
645 Ga0495632_0027634
646 Ga0495632_0044725
647 Ga0495587_0056897
648 Ga0495625_0026021
649 Ga0495625_0139858
650 Ga0495647_0130439
651 Ga0495669_0080009
652 Ga0495649_0004956
653 Ga0495604_0182371
654 Ga0495602_0130509
655 Ga0496100_0192949
656 Ga0496101_0476271
657 Ga0496102_0005846
658 Ga0496102_0024452
659 Ga0496103_0011573
660 Ga0496104_0111203
661 Ga0496105_0035582
662 Ga0496107_0107586
663 Ga0496111_0015304
664 Ga0496112_0094009
665 Ga0496112_0343870
666 Ga0496114_0121399
667 Ga0496115_0138043
668 Ga0496115_0351004
669 Ga0496117_0000012
670 Ga0496118_0000003
671 Ga0496118_0033977
672 Ga0496119_0001412
673 Ga0496119_0004826
674 Ga0496120_0000061
675 Ga0496120_0090676
676 Ga0496125_0000205
677 Ga0496125_0001935
678 Ga0496126_0000680
679 Ga0496126_0032906
680 Ga0496126_0157013
681 Ga0501046_0259737
682 nmdc:mga09592_89773_c1
683 nmdc:mga0qj67_233982_c1
684 nmdc:mga08y16_110132_c1
685 Ga0500617_072756
686 Ga0500568_0013314
687 Ga0500568_0053645
688 Ga0500568_0122141
689 Ga0500588_0001129
690 Ga0500604_0011007
691 Ga0500622_0004217
692 Ga0500634_0191925
693 Ga0500637_0135009
694 Ga0500661_023058
695 2510292929
696 2510313402
697 2687583476
698 2774132552
699 2894415235
700 2917832871
701 2919128571
702 2974298898
703 2984501195
704 3007806789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01163

RIO1

RIO1 family

95

291

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fdn-assembly1.cif.gz_B rio2 structure 0.8119 7 218
1zar-assembly1.cif.gz_A crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions 0.81 6 232
1zth-assembly3.cif.gz_C crystal structure of a.fulgidus rio1 serine protein kinase bound to adp and manganese ion 0.8087 7 235
6sg4-assembly1.cif.gz_C structure of cdk2/cyclin a m246q, s247en 0.802 94 187
6hk6-assembly5.cif.gz_H human riok2 bound to inhibitor 0.8015 7 218
ID Description Score Start End Superfamily
af_Q7YTF7_1_119_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9386 19 46 3.30.200.20
af_Q9SI22_93_306_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9213 140 186 1.10.510.10
af_Q9QZ05_779_1013_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9174 142 186 1.10.510.10
af_Q5A396_227_380_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8998 133 218 1.10.510.10
af_B9ZSH8_367_629_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.898 143 191 1.10.510.10
ID Description Score Start End GO Terms
AF-T1C4G9-F1-model_v4 RIO1/ZK632.3/MJ0444 family protein 0.9885 121 218 GO:0004674
GO:0005524
GO:0046872
AF-A0A2V2L136-F1-model_v4 deleted 0.9771 140 224
AF-A0A5S3YMU7-F1-model_v4 Serine protein kinase RIO 0.9732 151 238 GO:0004672
GO:0005829
GO:0030490
GO:0030688
GO:0046872
AF-T1C4G9-F1-model_v4 RIO1/ZK632.3/MJ0444 family protein 0.9689 121 218 GO:0004674
GO:0005524
GO:0046872
AF-A0A2V2L136-F1-model_v4 deleted 0.9551 140 224

Map