F418827

General Info

Members Datasets Scaffolds Average Seq Length
351 190 668 110

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_088171|Ga0590071_088171_326_709
Length 127
Sequence MSPDEIERGGIMTVGLKSVYGLALVFALFFAGPLFAQEKKGGKAKAEKVAGDIGLLDTEKNYMIVVTKDGKLVTIDFDQKTKVTALVPSPAKMSDVGLGSAASVQYTKKGDKNYLTGIEYRAKKGGD

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 99.43
Stem 0
Stem Tuber 0
Unclassified 42.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_088171 3300059421 Unclassified 775
2 MRS1b_contig_1705355 2162886011 Bacteria 890
3 MBSR1b_contig_10787799 2162886012 Bacteria 1182
4 Ga0065704_10029356 3300005289 Bacteria 1135
5 Ga0065704_10678618 3300005289 Unclassified 570
6 Ga0065712_10002435 3300005290 Bacteria 10669
7 Ga0065715_10025835 3300005293 Bacteria 2946
8 Ga0065715_10089132 3300005293 Bacteria 13748
9 Ga0065707_10005002 3300005295 Bacteria 4464
10 Ga0065707_10566962 3300005295 Unclassified 711
11 Ga0070690_100048547 3300005330 Bacteria 2704
12 Ga0070670_100027193 3300005331 Bacteria 4921
13 Ga0068869_100126567 3300005334 Unclassified 1960
14 Ga0070666_10203819 3300005335 Unclassified 1392
15 Ga0070666_10225883 3300005335 Unclassified 1321
16 Ga0070680_100093260 3300005336 Bacteria 2494
17 Ga0070680_100712370 3300005336 Unclassified 864
18 Ga0070660_100101021 3300005339 Unclassified 2285
19 Ga0070660_100330477 3300005339 Bacteria 1253
20 Ga0070691_10022565 3300005341 Bacteria 2921
21 Ga0070661_100420806 3300005344 Unclassified 1059
22 Ga0070668_100240092 3300005347 Unclassified 1501
23 Ga0070668_100304896 3300005347 Unclassified 1337
24 Ga0070669_100019581 3300005353 Bacteria 4834
25 Ga0070669_100372086 3300005353 Unclassified 1164
26 Ga0070671_100348200 3300005355 Unclassified 1264
27 Ga0070671_100997678 3300005355 Unclassified 734
28 Ga0070674_100085441 3300005356 Bacteria 2264
29 Ga0070673_100049702 3300005364 Bacteria 3275
30 Ga0070667_100014223 3300005367 Bacteria 6574
31 Ga0070705_100122107 3300005440 Unclassified 1683
32 Ga0070694_100041571 3300005444 Unclassified 3067
33 Ga0070694_100718529 3300005444 Unclassified 814
34 Ga0070694_101126733 3300005444 Unclassified 655
35 Ga0070663_100119936 3300005455 Unclassified 1986
36 Ga0070663_100863760 3300005455 Unclassified 779
37 Ga0070678_100304023 3300005456 Unclassified 1356
38 Ga0070678_101774158 3300005456 Unclassified 581
39 Ga0070662_100029776 3300005457 Bacteria 3813
40 Ga0070681_10328662 3300005458 Bacteria 1438
41 Ga0070698_100106404 3300005471 Unclassified 2774
42 Ga0070698_101160690 3300005471 Unclassified 721
43 Ga0070679_100012047 3300005530 Bacteria 8254
44 Ga0070679_100027347 3300005530 Bacteria 5613
45 Ga0070684_100350027 3300005535 Bacteria 1359
46 Ga0070697_100141210 3300005536 Bacteria 2026
47 Ga0070697_100436653 3300005536 Unclassified 1139
48 Ga0070672_100298803 3300005543 Unclassified 1364
49 Ga0070686_100177357 3300005544 Bacteria 1511
50 Ga0070695_101043707 3300005545 Unclassified 666
51 Ga0070696_100101321 3300005546 Bacteria 2064
52 Ga0070696_100673201 3300005546 Unclassified 841
53 Ga0070693_100022556 3300005547 Bacteria 3350
54 Ga0070665_100143179 3300005548 Unclassified 2394
55 Ga0068855_100055488 3300005563 Bacteria 4653
56 Ga0070664_100018012 3300005564 Bacteria 5799
57 Ga0070664_100517767 3300005564 Unclassified 1101
58 Ga0068854_100168434 3300005578 Unclassified 1702
59 Ga0068852_100754615 3300005616 Unclassified 985
60 Ga0068859_100182751 3300005617 Bacteria 2180
61 Ga0068859_103163470 3300005617 Unclassified 501
62 Ga0068864_100681443 3300005618 Unclassified 1003
63 Ga0068866_10318293 3300005718 Unclassified 978
64 Ga0068861_100213652 3300005719 Bacteria 1626
65 Ga0068861_100408621 3300005719 Unclassified 1207
66 Ga0068870_10090934 3300005840 Bacteria 1706
67 Ga0068863_101064446 3300005841 Unclassified 813
68 Ga0068863_101381112 3300005841 Unclassified 712
69 Ga0068860_100312881 3300005843 Bacteria 1540
70 Ga0068860_100558939 3300005843 Bacteria 1147
71 Ga0081455_10058289 3300005937 Unclassified 3268
72 Ga0081538_10013860 3300005981 Bacteria 6356
73 Ga0081540_1251231 3300005983 Unclassified 617
74 Ga0070715_10749182 3300006163 Unclassified 588
75 Ga0097621_100198914 3300006237 Unclassified 1739
76 Ga0097621_101523661 3300006237 Unclassified 635
77 Ga0068871_100042333 3300006358 Bacteria 3656
78 Ga0075428_100674807 3300006844 Unclassified 1101
79 Ga0075430_100191113 3300006846 Unclassified 1701
80 Ga0075430_100246761 3300006846 Unclassified 1480
81 Ga0075430_100363072 3300006846 Unclassified 1196
82 Ga0075431_100296761 3300006847 Bacteria 1633
83 Ga0075431_100902578 3300006847 Unclassified 853
84 Ga0075431_101089231 3300006847 Unclassified 764
85 Ga0075433_10011988 3300006852 Bacteria 6990
86 Ga0075433_10070141 3300006852 Bacteria 3080
87 Ga0075433_11532283 3300006852 Unclassified 576
88 Ga0075434_100010269 3300006871 Bacteria 8774
89 Ga0075434_100015763 3300006871 Bacteria 7254
90 Ga0075434_100042939 3300006871 Bacteria 4483
91 Ga0075434_100129050 3300006871 Bacteria 2546
92 Ga0075434_100227870 3300006871 Bacteria 1883
93 Ga0075434_100255279 3300006871 Bacteria 1772
94 Ga0075429_100390262 3300006880 Unclassified 1219
95 Ga0068865_100030401 3300006881 Unclassified 3593
96 Ga0068865_100041646 3300006881 Bacteria 3127
97 Ga0097620_100182755 3300006931 Bacteria 2180
98 Ga0097620_103161030 3300006931 Unclassified 501
99 Ga0075435_100011015 3300007076 Bacteria 6632
100 Ga0075435_100091821 3300007076 Unclassified 2506
101 Ga0075435_100324794 3300007076 Unclassified 1317
102 Ga0105240_10680612 3300009093 Unclassified 1125
103 Ga0111539_10161441 3300009094 Unclassified 2621
104 Ga0111539_10175280 3300009094 Unclassified 2505
105 Ga0111539_10550593 3300009094 Unclassified 1344
106 Ga0111539_11195537 3300009094 Unclassified 883
107 Ga0114129_10018112 3300009147 Bacteria 10033
108 Ga0114129_10149910 3300009147 Bacteria 3192
109 Ga0114129_10252395 3300009147 Bacteria 2367
110 Ga0114129_10258777 3300009147 Bacteria 2334
111 Ga0114129_10918657 3300009147 Bacteria 1108
112 Ga0114129_11383573 3300009147 Unclassified 869
113 Ga0114129_11499234 3300009147 Bacteria 829
114 Ga0105243_10107552 3300009148 Unclassified 2326
115 Ga0105242_12866389 3300009176 Unclassified 533
116 Ga0105249_11210835 3300009553 Bacteria 826
117 Ga0105246_10492757 3300011119 Bacteria 1039
118 Ga0157338_1007563 3300012515 Unclassified 1033
119 Ga0157374_10830825 3300013296 Bacteria 940
120 Ga0157378_10159309 3300013297 Bacteria 2110
121 Ga0157378_10165250 3300013297 Bacteria 2073
122 Ga0163162_10077059 3300013306 Bacteria 3397
123 Ga0163162_10766620 3300013306 Bacteria 1083
124 Ga0163162_11032352 3300013306 Unclassified 930
125 Ga0157380_12305290 3300014326 Unclassified 603
126 Ga0206352_10619027 3300020078 Unclassified 694
127 Ga0206350_11050964 3300020080 Unclassified 935
128 Ga0207697_10017747 3300025315 Bacteria 2924
129 Ga0207682_10129119 3300025893 Unclassified 1127
130 Ga0207680_10166910 3300025903 Unclassified 1480
131 Ga0207647_10231064 3300025904 Bacteria 1064
132 Ga0207645_10007903 3300025907 Bacteria 7476
133 Ga0207707_10122741 3300025912 Bacteria 2271
134 Ga0207707_10148514 3300025912 Bacteria 2049
135 Ga0207671_10438118 3300025914 Unclassified 1040
136 Ga0207660_10393640 3300025917 Bacteria 1115
137 Ga0207657_10003693 3300025919 Bacteria 16278
138 Ga0207657_10298593 3300025919 Bacteria 1276
139 Ga0207649_10012333 3300025920 Bacteria 4739
140 Ga0207681_10626509 3300025923 Unclassified 890
141 Ga0207681_11017437 3300025923 Unclassified 695
142 Ga0207650_10068262 3300025925 Unclassified 2669
143 Ga0207659_10028394 3300025926 Bacteria 3802
144 Ga0207644_10536630 3300025931 Unclassified 967
145 Ga0207644_10696917 3300025931 Unclassified 847
146 Ga0207690_10021821 3300025932 Bacteria 3976
147 Ga0207706_10054498 3300025933 Bacteria 3529
148 Ga0207669_10224064 3300025937 Bacteria 1382
149 Ga0207704_10015631 3300025938 Bacteria 3874
150 Ga0207704_10029318 3300025938 Bacteria 3067
151 Ga0207691_10114484 3300025940 Bacteria 2396
152 Ga0207689_10114942 3300025942 Unclassified 2212
153 Ga0207679_10240690 3300025945 Unclassified 1533
154 Ga0207667_10302803 3300025949 Bacteria 1633
155 Ga0207668_10174855 3300025972 Unclassified 1688
156 Ga0207640_10457449 3300025981 Unclassified 1053
157 Ga0207658_11248089 3300025986 Unclassified 679
158 Ga0207678_10015998 3300026067 Bacteria 6589
159 Ga0207678_10529157 3300026067 Unclassified 1029
160 Ga0207708_10248483 3300026075 Unclassified 1433
161 Ga0207702_11422018 3300026078 Unclassified 687
162 Ga0207641_11194386 3300026088 Unclassified 760
163 Ga0207641_11272188 3300026088 Unclassified 736
164 Ga0207676_11644628 3300026095 Unclassified 640
165 Ga0207675_100542929 3300026118 Unclassified 1161
166 Ga0207698_10588013 3300026142 Unclassified 1096
167 Ga0209973_1049418 3300027252 Unclassified 631
168 Ga0209983_1010963 3300027665 Unclassified 1853
169 Ga0209971_1014374 3300027682 Unclassified 1876
170 Ga0209974_10009713 3300027876 Unclassified 3264
171 Ga0207428_10254185 3300027907 Unclassified 1310
172 Ga0268266_10102320 3300028379 Unclassified 2527
173 Ga0268264_11218201 3300028381 Unclassified 762
174 Ga0307408_100067008 3300031548 Bacteria 2639
175 Ga0307408_100158663 3300031548 Bacteria 1794
176 Ga0307413_10016023 3300031824 Unclassified 3858
177 Ga0307410_10423826 3300031852 Bacteria 1080
178 Ga0307406_10106595 3300031901 Bacteria 1920
179 Ga0307407_11713810 3300031903 Unclassified 501
180 Ga0307412_10098843 3300031911 Bacteria 2059
181 Ga0307412_11369776 3300031911 Unclassified 639
182 Ga0307409_100073559 3300031995 Unclassified 2726
183 Ga0307409_100377862 3300031995 Bacteria 1346
184 Ga0307409_102225780 3300031995 Unclassified 578
185 Ga0307416_100055390 3300032002 Bacteria 3193
186 Ga0307416_100178074 3300032002 Bacteria 1989
187 Ga0307416_101132559 3300032002 Unclassified 887
188 Ga0307414_10010816 3300032004 Bacteria 5323
189 Ga0307411_10265951 3300032005 Bacteria 1357
190 Ga0307415_100066087 3300032126 Bacteria 2522
191 Ga0307415_100232294 3300032126 Unclassified 1486
192 Ga0373929_0049361 3300035085 Bacteria 958
193 Ga0373932_0260526 3300035112 Unclassified 636
194 Ga0373939_0248853 3300035114 Unclassified 691
195 Ga0373956_0026988 3300035119 Unclassified 2490
196 Ga0373931_0037524 3300035691 Bacteria 2530
197 Ga0373925_0533635 3300037068 Bacteria 964
198 Ga0451802_1209464 3300041460 Unclassified 702
199 Ga0439441_137168 3300042001 Unclassified 570
200 Ga0439464_0121400 3300042439 Unclassified 805
201 Ga0451577_0383865 3300042876 Bacteria 1275
202 Ga0453683_0001870 3300044673 Bacteria 17255
203 Ga0453684_0329119 3300044712 Bacteria 1728
204 Ga0453684_1597448 3300044712 Unclassified 669
205 Ga0451576_0067745 3300045051 Bacteria 3715
206 Ga0451576_0800134 3300045051 Bacteria 990
207 Ga0451576_1415378 3300045051 Unclassified 723
208 Ga0451576_2129975 3300045051 Unclassified 576
209 Ga0495635_0813088 3300046663 Unclassified 602
210 Ga0495658_0476833 3300046683 Unclassified 798
211 Ga0495670_0314290 3300046691 Unclassified 841
212 Ga0496109_0968381 3300048912 Unclassified 789
213 Ga0501310_034127 3300049130 Unclassified 686
214 Ga0501305_106910 3300049161 Unclassified 526
215 Ga0501323_054628 3300049539 Bacteria 613
216 Ga0501031_0428879 3300049568 Bacteria 854
217 Ga0501032_0072781 3300049569 Bacteria 2290
218 Ga0501033_0148376 3300049570 Unclassified 1693
219 Ga0501033_0300403 3300049570 Bacteria 1130
220 Ga0501034_0085106 3300049571 Bacteria 3164
221 Ga0501037_0025971 3300049573 Bacteria 4327
222 Ga0501038_0002152 3300049574 Bacteria 18297
223 Ga0501038_0102216 3300049574 Bacteria 2385
224 Ga0501039_0087053 3300049575 Bacteria 2433
225 Ga0501039_0088744 3300049575 Unclassified 2408
226 Ga0501039_0346998 3300049575 Bacteria 1166
227 Ga0501040_0000217 3300049576 Bacteria 33425
228 Ga0501040_0134915 3300049576 Bacteria 1737
229 Ga0501040_0447638 3300049576 Unclassified 930
230 Ga0501040_0825940 3300049576 Unclassified 671
231 Ga0501041_0000081 3300049577 Bacteria 37419
232 Ga0501041_0058684 3300049577 Bacteria 2354
233 Ga0501041_0101358 3300049577 Bacteria 1782
234 Ga0501041_0559613 3300049577 Unclassified 729
235 Ga0501042_0000781 3300049578 Bacteria 17408
236 Ga0501042_0363989 3300049578 Bacteria 1046
237 Ga0501042_0471629 3300049578 Bacteria 910
238 Ga0501043_0015420 3300049579 Bacteria 5984
239 Ga0501043_0279068 3300049579 Bacteria 1281
240 Ga0501043_0293676 3300049579 Bacteria 1243
241 Ga0501046_0007972 3300049580 Bacteria 9265
242 Ga0501046_1023820 3300049580 Unclassified 572
243 Ga0501047_0814460 3300049581 Unclassified 748
244 Ga0501048_0004115 3300049582 Bacteria 11084
245 Ga0501048_0070484 3300049582 Bacteria 2468
246 Ga0501048_0172705 3300049582 Bacteria 1531
247 Ga0501068_0004781 3300049584 Bacteria 7371
248 Ga0501068_0024050 3300049584 Bacteria 3575
249 Ga0501068_0698244 3300049584 Bacteria 663
250 Ga0501069_0735923 3300049585 Bacteria 596
251 Ga0501071_0001382 3300049587 Bacteria 13905
252 Ga0501071_0071189 3300049587 Bacteria 2534
253 Ga0501071_0128135 3300049587 Bacteria 1884
254 Ga0501072_0005678 3300049588 Bacteria 9502
255 Ga0501072_0050380 3300049588 Bacteria 3278
256 Ga0501072_0244440 3300049588 Bacteria 1429
257 Ga0501072_0891562 3300049588 Unclassified 695
258 Ga0501073_0036185 3300049589 Bacteria 3508
259 Ga0501073_0177881 3300049589 Bacteria 1472
260 Ga0501073_0320434 3300049589 Bacteria 1070
261 Ga0501074_0039003 3300049590 Bacteria 3440
262 Ga0501074_0066693 3300049590 Bacteria 2589
263 Ga0501074_0346368 3300049590 Bacteria 1054
264 Ga0501075_0000982 3300049591 Bacteria 18179
265 Ga0501075_0104451 3300049591 Bacteria 2153
266 Ga0501075_0433127 3300049591 Unclassified 1003
267 Ga0501076_0000141 3300049592 Bacteria 41058
268 Ga0501076_0566715 3300049592 Unclassified 937
269 Ga0501076_1023854 3300049592 Unclassified 680
270 Ga0501077_0007796 3300049593 Bacteria 6609
271 Ga0501077_0068977 3300049593 Bacteria 2241
272 Ga0501077_0076231 3300049593 Unclassified 2124
273 Ga0501077_0364060 3300049593 Bacteria 923
274 Ga0501079_0001229 3300049741 Bacteria 17928
275 Ga0501079_0016657 3300049741 Bacteria 5614
276 Ga0501079_0073681 3300049741 Bacteria 2639
277 Ga0501080_0062206 3300049742 Bacteria 3474
278 Ga0501080_0216404 3300049742 Bacteria 1754
279 Ga0501080_0561940 3300049742 Bacteria 1015
280 Ga0501080_1551007 3300049742 Unclassified 562
281 Ga0501081_0000861 3300049743 Bacteria 17949
282 Ga0501081_0064807 3300049743 Bacteria 2538
283 Ga0501081_0420233 3300049743 Unclassified 991
284 Ga0501081_0738293 3300049743 Unclassified 740
285 Ga0501081_1238435 3300049743 Bacteria 565
286 Ga0501081_1407493 3300049743 Bacteria 529
287 Ga0501083_0095792 3300049744 Bacteria 1958
288 Ga0501083_0100596 3300049744 Bacteria 1906
289 Ga0501083_0205579 3300049744 Bacteria 1284
290 Ga0501035_0388394 3300049822 Unclassified 1163
291 Ga0501035_1235168 3300049822 Bacteria 578
292 Ga0501044_0558414 3300049823 Bacteria 1041
293 Ga0501045_0000096 3300049824 Bacteria 42986
294 Ga0501045_0404649 3300049824 Bacteria 1015
295 Ga0501045_1243322 3300049824 Unclassified 543
296 nmdc:mga05p37_1235652_c1 3300050507 Bacteria 768
297 nmdc:mga05p37_1330339_c1 3300050507 Unclassified 730
298 nmdc:mga05p37_137500_c1 3300050507 Bacteria 2995
299 nmdc:mga05p37_401803_c1 3300050507 Bacteria 1600
300 nmdc:mga05p37_447417_c1 3300050507 Bacteria 1496
301 nmdc:mga0qj67_149051_c1 3300050509 Unclassified 1897
302 nmdc:mga06r32_756039_c1 3300050510 Unclassified 935
303 nmdc:mga06r32_849988_c1 3300050510 Unclassified 871
304 nmdc:mga08y16_50068_c1 3300050511 Bacteria 2634
305 nmdc:mga08y16_53251_c1 3300050511 Bacteria 4232
306 nmdc:mga0n895_106930_c1 3300050512 Bacteria 2811
307 nmdc:mga0n895_117859_c1 3300050512 Bacteria 2675
308 nmdc:mga0n895_210349_c1 3300050512 Bacteria 1975
309 nmdc:mga0n895_36015_c1 3300050512 Unclassified 4776
310 nmdc:mga0n895_5142_c1 3300050512 Bacteria 10879
311 nmdc:mga0n895_782069_c1 3300050512 Unclassified 946
312 nmdc:mga0rr50_251550_c1 3300050513 Bacteria 1468
313 nmdc:mga0rr50_71402_c1 3300050513 Bacteria 2093
314 nmdc:mga0rr50_97154_c1 3300050513 Bacteria 2306
315 nmdc:mga08x19_354270_c1 3300050514 Unclassified 1025
316 nmdc:mga08x19_82411_c1 3300050514 Bacteria 2113
317 nmdc:mga0a205_490943_c1 3300050515 Bacteria 1085
318 nmdc:mga0a205_68078_c1 3300050515 Unclassified 3439
319 nmdc:mga0a205_75352_c1 3300050515 Bacteria 3260
320 nmdc:mga0a205_78766_c1 3300050515 Bacteria 3184
321 nmdc:mga0a205_8448_c1 3300050515 Bacteria 9371
322 Ga0501084_0000354 3300054114 Bacteria 34974
323 Ga0501084_0186878 3300054114 Unclassified 1749
324 Ga0501084_0742902 3300054114 Unclassified 827
325 Ga0590071_004953 3300059421 Bacteria 3215
326 Ga0590071_041359 3300059421 Unclassified 1110
327 Ga0590074_042085 3300059423 Unclassified 824
328 Ga0587109_106167 3300059624 Unclassified 651
329 Ga0501082_0000221 3300060353 Bacteria 49677
330 Ga0501082_0478398 3300060353 Bacteria 1088
331 Ga0501082_0650286 3300060353 Bacteria 922
332 Ga0530510_0026673 3300061734 Bacteria 4136
333 Ga0530510_0152197 3300061734 Bacteria 1708
334 Ga0530510_0189014 3300061734 Bacteria 1528
335 Ga0590071_088171
336 MRS1b_contig_1705355
337 MBSR1b_contig_10787799
338 Ga0065704_10029356
339 Ga0065704_10678618
340 Ga0065712_10002435
341 Ga0065715_10025835
342 Ga0065715_10089132
343 Ga0065707_10005002
344 Ga0065707_10566962
345 Ga0070690_100048547
346 Ga0070670_100027193
347 Ga0068869_100126567
348 Ga0070666_10203819
349 Ga0070666_10225883
350 Ga0070680_100093260
351 Ga0070680_100712370
352 Ga0070660_100101021
353 Ga0070660_100330477
354 Ga0070691_10022565
355 Ga0070661_100420806
356 Ga0070668_100240092
357 Ga0070668_100304896
358 Ga0070669_100019581
359 Ga0070669_100372086
360 Ga0070671_100348200
361 Ga0070671_100997678
362 Ga0070674_100085441
363 Ga0070673_100049702
364 Ga0070667_100014223
365 Ga0070705_100122107
366 Ga0070694_100041571
367 Ga0070694_100718529
368 Ga0070694_101126733
369 Ga0070663_100119936
370 Ga0070663_100863760
371 Ga0070678_100304023
372 Ga0070678_101774158
373 Ga0070662_100029776
374 Ga0070681_10328662
375 Ga0070698_100106404
376 Ga0070698_101160690
377 Ga0070679_100012047
378 Ga0070679_100027347
379 Ga0070684_100350027
380 Ga0070697_100141210
381 Ga0070697_100436653
382 Ga0070672_100298803
383 Ga0070686_100177357
384 Ga0070695_101043707
385 Ga0070696_100101321
386 Ga0070696_100673201
387 Ga0070693_100022556
388 Ga0070665_100143179
389 Ga0068855_100055488
390 Ga0070664_100018012
391 Ga0070664_100517767
392 Ga0068854_100168434
393 Ga0068852_100754615
394 Ga0068859_100182751
395 Ga0068859_103163470
396 Ga0068864_100681443
397 Ga0068866_10318293
398 Ga0068861_100213652
399 Ga0068861_100408621
400 Ga0068870_10090934
401 Ga0068863_101064446
402 Ga0068863_101381112
403 Ga0068860_100312881
404 Ga0068860_100558939
405 Ga0081455_10058289
406 Ga0081538_10013860
407 Ga0081540_1251231
408 Ga0070715_10749182
409 Ga0097621_100198914
410 Ga0097621_101523661
411 Ga0068871_100042333
412 Ga0075428_100674807
413 Ga0075430_100191113
414 Ga0075430_100246761
415 Ga0075430_100363072
416 Ga0075431_100296761
417 Ga0075431_100902578
418 Ga0075431_101089231
419 Ga0075433_10011988
420 Ga0075433_10070141
421 Ga0075433_11532283
422 Ga0075434_100010269
423 Ga0075434_100015763
424 Ga0075434_100042939
425 Ga0075434_100129050
426 Ga0075434_100227870
427 Ga0075434_100255279
428 Ga0075429_100390262
429 Ga0068865_100030401
430 Ga0068865_100041646
431 Ga0097620_100182755
432 Ga0097620_103161030
433 Ga0075435_100011015
434 Ga0075435_100091821
435 Ga0075435_100324794
436 Ga0105240_10680612
437 Ga0111539_10161441
438 Ga0111539_10175280
439 Ga0111539_10550593
440 Ga0111539_11195537
441 Ga0114129_10018112
442 Ga0114129_10149910
443 Ga0114129_10252395
444 Ga0114129_10258777
445 Ga0114129_10918657
446 Ga0114129_11383573
447 Ga0114129_11499234
448 Ga0105243_10107552
449 Ga0105242_12866389
450 Ga0105249_11210835
451 Ga0105246_10492757
452 Ga0157338_1007563
453 Ga0157374_10830825
454 Ga0157378_10159309
455 Ga0157378_10165250
456 Ga0163162_10077059
457 Ga0163162_10766620
458 Ga0163162_11032352
459 Ga0157380_12305290
460 Ga0206352_10619027
461 Ga0206350_11050964
462 Ga0207697_10017747
463 Ga0207682_10129119
464 Ga0207680_10166910
465 Ga0207647_10231064
466 Ga0207645_10007903
467 Ga0207707_10122741
468 Ga0207707_10148514
469 Ga0207671_10438118
470 Ga0207660_10393640
471 Ga0207657_10003693
472 Ga0207657_10298593
473 Ga0207649_10012333
474 Ga0207681_10626509
475 Ga0207681_11017437
476 Ga0207650_10068262
477 Ga0207659_10028394
478 Ga0207644_10536630
479 Ga0207644_10696917
480 Ga0207690_10021821
481 Ga0207706_10054498
482 Ga0207669_10224064
483 Ga0207704_10015631
484 Ga0207704_10029318
485 Ga0207691_10114484
486 Ga0207689_10114942
487 Ga0207679_10240690
488 Ga0207667_10302803
489 Ga0207668_10174855
490 Ga0207640_10457449
491 Ga0207658_11248089
492 Ga0207678_10015998
493 Ga0207678_10529157
494 Ga0207708_10248483
495 Ga0207702_11422018
496 Ga0207641_11194386
497 Ga0207641_11272188
498 Ga0207676_11644628
499 Ga0207675_100542929
500 Ga0207698_10588013
501 Ga0209973_1049418
502 Ga0209983_1010963
503 Ga0209971_1014374
504 Ga0209974_10009713
505 Ga0207428_10254185
506 Ga0268266_10102320
507 Ga0268264_11218201
508 Ga0307408_100067008
509 Ga0307408_100158663
510 Ga0307413_10016023
511 Ga0307410_10423826
512 Ga0307406_10106595
513 Ga0307407_11713810
514 Ga0307412_10098843
515 Ga0307412_11369776
516 Ga0307409_100073559
517 Ga0307409_100377862
518 Ga0307409_102225780
519 Ga0307416_100055390
520 Ga0307416_100178074
521 Ga0307416_101132559
522 Ga0307414_10010816
523 Ga0307411_10265951
524 Ga0307415_100066087
525 Ga0307415_100232294
526 Ga0373929_0049361
527 Ga0373932_0260526
528 Ga0373939_0248853
529 Ga0373956_0026988
530 Ga0373931_0037524
531 Ga0373925_0533635
532 Ga0451802_1209464
533 Ga0439441_137168
534 Ga0439464_0121400
535 Ga0451577_0383865
536 Ga0453683_0001870
537 Ga0453684_0329119
538 Ga0453684_1597448
539 Ga0451576_0067745
540 Ga0451576_0800134
541 Ga0451576_1415378
542 Ga0451576_2129975
543 Ga0495635_0813088
544 Ga0495658_0476833
545 Ga0495670_0314290
546 Ga0496109_0968381
547 Ga0501310_034127
548 Ga0501305_106910
549 Ga0501323_054628
550 Ga0501031_0428879
551 Ga0501032_0072781
552 Ga0501033_0148376
553 Ga0501033_0300403
554 Ga0501034_0085106
555 Ga0501037_0025971
556 Ga0501038_0002152
557 Ga0501038_0102216
558 Ga0501039_0087053
559 Ga0501039_0088744
560 Ga0501039_0346998
561 Ga0501040_0000217
562 Ga0501040_0134915
563 Ga0501040_0447638
564 Ga0501040_0825940
565 Ga0501041_0000081
566 Ga0501041_0058684
567 Ga0501041_0101358
568 Ga0501041_0559613
569 Ga0501042_0000781
570 Ga0501042_0363989
571 Ga0501042_0471629
572 Ga0501043_0015420
573 Ga0501043_0279068
574 Ga0501043_0293676
575 Ga0501046_0007972
576 Ga0501046_1023820
577 Ga0501047_0814460
578 Ga0501048_0004115
579 Ga0501048_0070484
580 Ga0501048_0172705
581 Ga0501068_0004781
582 Ga0501068_0024050
583 Ga0501068_0698244
584 Ga0501069_0735923
585 Ga0501071_0001382
586 Ga0501071_0071189
587 Ga0501071_0128135
588 Ga0501072_0005678
589 Ga0501072_0050380
590 Ga0501072_0244440
591 Ga0501072_0891562
592 Ga0501073_0036185
593 Ga0501073_0177881
594 Ga0501073_0320434
595 Ga0501074_0039003
596 Ga0501074_0066693
597 Ga0501074_0346368
598 Ga0501075_0000982
599 Ga0501075_0104451
600 Ga0501075_0433127
601 Ga0501076_0000141
602 Ga0501076_0566715
603 Ga0501076_1023854
604 Ga0501077_0007796
605 Ga0501077_0068977
606 Ga0501077_0076231
607 Ga0501077_0364060
608 Ga0501079_0001229
609 Ga0501079_0016657
610 Ga0501079_0073681
611 Ga0501080_0062206
612 Ga0501080_0216404
613 Ga0501080_0561940
614 Ga0501080_1551007
615 Ga0501081_0000861
616 Ga0501081_0064807
617 Ga0501081_0420233
618 Ga0501081_0738293
619 Ga0501081_1238435
620 Ga0501081_1407493
621 Ga0501083_0095792
622 Ga0501083_0100596
623 Ga0501083_0205579
624 Ga0501035_0388394
625 Ga0501035_1235168
626 Ga0501044_0558414
627 Ga0501045_0000096
628 Ga0501045_0404649
629 Ga0501045_1243322
630 nmdc:mga05p37_1235652_c1
631 nmdc:mga05p37_1330339_c1
632 nmdc:mga05p37_137500_c1
633 nmdc:mga05p37_401803_c1
634 nmdc:mga05p37_447417_c1
635 nmdc:mga0qj67_149051_c1
636 nmdc:mga06r32_756039_c1
637 nmdc:mga06r32_849988_c1
638 nmdc:mga08y16_50068_c1
639 nmdc:mga08y16_53251_c1
640 nmdc:mga0n895_106930_c1
641 nmdc:mga0n895_117859_c1
642 nmdc:mga0n895_210349_c1
643 nmdc:mga0n895_36015_c1
644 nmdc:mga0n895_5142_c1
645 nmdc:mga0n895_782069_c1
646 nmdc:mga0rr50_251550_c1
647 nmdc:mga0rr50_71402_c1
648 nmdc:mga0rr50_97154_c1
649 nmdc:mga08x19_354270_c1
650 nmdc:mga08x19_82411_c1
651 nmdc:mga0a205_490943_c1
652 nmdc:mga0a205_68078_c1
653 nmdc:mga0a205_75352_c1
654 nmdc:mga0a205_78766_c1
655 nmdc:mga0a205_8448_c1
656 Ga0501084_0000354
657 Ga0501084_0186878
658 Ga0501084_0742902
659 Ga0590071_004953
660 Ga0590071_041359
661 Ga0590074_042085
662 Ga0587109_106167
663 Ga0501082_0000221
664 Ga0501082_0478398
665 Ga0501082_0650286
666 Ga0530510_0026673
667 Ga0530510_0152197
668 Ga0530510_0189014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map