F418751

General Info

Members Datasets Scaffolds Average Seq Length
351 242 346 277

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0165694|Ga0495603_0165694_28_981
Length 317
Sequence MKAWMISSVILVTGLAHPAASWLATRFPGDGHGWHCGLMKRSLAVVDVFGAEAGSGNPVAVVLDGEGLDTAQMQQFARWMNLSETTFVLPPSGAGADYRVRIFTPAAELPFAGHPTLGTCHAWLTAGGATREPGVAIQECGAGLVPVRQTERPDGSLAFAAPPVLRDGPVEDGLLDRIAGMLAVSRADIVDAEWADNGPGWVAVLLKDADAVLAARPTGVDIDLGLAGLYPPGSETAVEVRAFFPVNGTGVEDPVTGSLNASLAAWLLRTGRLTAPYVASQGTVIGRRGRVQISADAAGAIWVGGRTATLITGDAEL

Samples

Sample ID Description Type Environment
1 2511231011 Pseudomonas sp. GM30 Isolate Nodule
2 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
3 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
4 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0.57
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0.57
Rhizoplane 9.4
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002187 3300001915 Bacteria 5191
2 rootH1_10007122 3300003316 Bacteria 10368
3 rootH2_10084167 3300003320 Bacteria 1609
4 Ga0065165_1000547 3300005262 Bacteria 56675
5 Ga0065707_10144246 3300005295 Unclassified 1733
6 Ga0070658_10384623 3300005327 Bacteria 1204
7 Ga0070676_10056564 3300005328 Bacteria 2318
8 Ga0070683_100345725 3300005329 Bacteria 1416
9 Ga0070680_100012734 3300005336 Bacteria 6539
10 Ga0070660_100383037 3300005339 Bacteria 1161
11 Ga0070691_10000595 3300005341 Bacteria 13871
12 Ga0070661_100033178 3300005344 Bacteria 3739
13 Ga0070661_100163551 3300005344 Bacteria 1686
14 Ga0070692_10003790 3300005345 Bacteria 6216
15 Ga0070669_100087858 3300005353 Bacteria 2325
16 Ga0070663_100235466 3300005455 Bacteria 1443
17 Ga0070662_100021852 3300005457 Bacteria 4373
18 Ga0070681_10001719 3300005458 Bacteria 19589
19 Ga0070679_100001729 3300005530 Bacteria 19684
20 Ga0070679_100028107 3300005530 Bacteria 5542
21 Ga0070684_100029902 3300005535 Bacteria 4623
22 Ga0070684_100354548 3300005535 Bacteria 1350
23 Ga0070695_100465556 3300005545 Bacteria 971
24 Ga0070665_100003466 3300005548 Bacteria 16810
25 Ga0068855_100080605 3300005563 Bacteria 3774
26 Ga0068857_100547506 3300005577 Bacteria 1090
27 Ga0068852_100146322 3300005616 Bacteria 2192
28 Ga0068852_100284768 3300005616 Bacteria 1594
29 Ga0068864_100108021 3300005618 Bacteria 2476
30 Ga0068866_10025541 3300005718 Unclassified 2778
31 Ga0068858_100000039 3300005842 Bacteria 136946
32 Ga0068858_100188341 3300005842 Bacteria 1950
33 Ga0081455_10003454 3300005937 Bacteria 18168
34 Ga0081538_10013869 3300005981 Bacteria 6352
35 Ga0075363_100093843 3300006048 Bacteria 1654
36 Ga0075432_10041507 3300006058 Bacteria 1607
37 Ga0070716_100126858 3300006173 Bacteria 1606
38 Ga0075370_10001988 3300006353 Bacteria 9265
39 Ga0068871_100031694 3300006358 Bacteria 4170
40 Ga0075428_100045366 3300006844 Bacteria 4829
41 Ga0075428_100046240 3300006844 Bacteria 4781
42 Ga0075428_100078526 3300006844 Bacteria 3603
43 Ga0075428_100202620 3300006844 Bacteria 2145
44 Ga0075430_100101426 3300006846 Bacteria 2403
45 Ga0075430_100532559 3300006846 Bacteria 969
46 Ga0075431_100046686 3300006847 Bacteria 4466
47 Ga0075431_100279504 3300006847 Bacteria 1690
48 Ga0075431_100384795 3300006847 Bacteria 1406
49 Ga0075433_10025436 3300006852 Bacteria 5004
50 Ga0075434_100017817 3300006871 Bacteria 6851
51 Ga0075434_100036665 3300006871 Bacteria 4851
52 Ga0075434_100293231 3300006871 Bacteria 1647
53 Ga0075434_100550231 3300006871 Bacteria 1174
54 Ga0075429_100035591 3300006880 Bacteria 4330
55 Ga0075429_100068727 3300006880 Bacteria 3083
56 Ga0075429_100359257 3300006880 Bacteria 1275
57 Ga0068865_100037455 3300006881 Bacteria 3275
58 Ga0075436_100006614 3300006914 Bacteria 7943
59 Ga0075436_100119787 3300006914 Bacteria 1841
60 Ga0099826_10000063 3300006948 Bacteria 61637
61 Ga0075435_100012459 3300007076 Bacteria 6299
62 Ga0075435_100031227 3300007076 Bacteria 4194
63 Ga0075435_100264831 3300007076 Unclassified 1465
64 Ga0075435_100340794 3300007076 Bacteria 1284
65 Ga0099794_10008156 3300007265 Bacteria 4340
66 Ga0105240_10368993 3300009093 Bacteria 1624
67 Ga0111539_10022605 3300009094 Bacteria 7726
68 Ga0105245_10023692 3300009098 Bacteria 5389
69 Ga0105247_10004559 3300009101 Bacteria 8834
70 Ga0105247_10411590 3300009101 Bacteria 966
71 Ga0114129_10042514 3300009147 Bacteria 6399
72 Ga0114129_10117087 3300009147 Bacteria 3671
73 Ga0114129_10160394 3300009147 Bacteria 3072
74 Ga0105248_10325443 3300009177 Bacteria 1731
75 Ga0105238_10320242 3300009551 Bacteria 1536
76 Ga0105239_10258167 3300010375 Bacteria 1958
77 Ga0157373_10002414 3300013100 Bacteria 14207
78 Ga0157370_10021640 3300013104 Bacteria 6407
79 Ga0157370_10091193 3300013104 Bacteria 2861
80 Ga0157370_10184108 3300013104 Bacteria 1940
81 Ga0157370_10237141 3300013104 Bacteria 1688
82 Ga0157369_10158269 3300013105 Bacteria 2392
83 Ga0157369_10361206 3300013105 Bacteria 1508
84 Ga0171462_1036 3300013250 Bacteria 79177
85 Ga0157374_10235685 3300013296 Bacteria 1798
86 Ga0157378_10209669 3300013297 Unclassified 1847
87 Ga0157378_10547286 3300013297 Bacteria 1162
88 Ga0163162_10300162 3300013306 Bacteria 1738
89 Ga0163162_10805058 3300013306 Unclassified 1057
90 Ga0157372_10181061 3300013307 Bacteria 2439
91 Ga0157372_10637991 3300013307 Bacteria 1241
92 Ga0157375_10170192 3300013308 Bacteria 2325
93 Ga0157375_11028409 3300013308 Bacteria 962
94 Ga0163163_10188476 3300014325 Bacteria 2111
95 Ga0182008_10000164 3300014497 Bacteria 51668
96 Ga0157379_10000288 3300014968 Bacteria 39832
97 Ga0157379_10013875 3300014968 Bacteria 7064
98 Ga0157376_10053403 3300014969 Bacteria 3364
99 Ga0182005_1019151 3300015265 Bacteria 1888
100 Ga0206354_10589031 3300020081 Bacteria 2052
101 Ga0206353_10706753 3300020082 Bacteria 1409
102 Ga0213872_10030183 3300021361 Bacteria 2485
103 Ga0213872_10055207 3300021361 Bacteria 1801
104 Ga0213875_10118449 3300021388 Bacteria 1237
105 Ga0209563_100445 3300025230 Bacteria 14323
106 Ga0207426_1007965 3300025302 Bacteria 4358
107 Ga0207710_10000127 3300025900 Bacteria 92787
108 Ga0207647_10029100 3300025904 Bacteria 3579
109 Ga0207645_10007034 3300025907 Bacteria 8011
110 Ga0207643_10028869 3300025908 Bacteria 3083
111 Ga0207705_10007964 3300025909 Bacteria 7773
112 Ga0207684_10103016 3300025910 Bacteria 2440
113 Ga0207707_10001385 3300025912 Bacteria 22524
114 Ga0207695_10004841 3300025913 Bacteria 18173
115 Ga0207660_10000181 3300025917 Bacteria 40287
116 Ga0207660_10013894 3300025917 Bacteria 5283
117 Ga0207660_10096463 3300025917 Bacteria 2201
118 Ga0207657_10011299 3300025919 Bacteria 8867
119 Ga0207649_10018236 3300025920 Bacteria 3987
120 Ga0207652_10000213 3300025921 Bacteria 61477
121 Ga0207652_10021866 3300025921 Bacteria 5283
122 Ga0207652_10043879 3300025921 Bacteria 3808
123 Ga0207664_10223193 3300025929 Bacteria 1635
124 Ga0207690_10058266 3300025932 Bacteria 2612
125 Ga0207706_10006032 3300025933 Bacteria 11272
126 Ga0207665_10052059 3300025939 Bacteria 2758
127 Ga0207689_10016095 3300025942 Bacteria 6330
128 Ga0207661_10081146 3300025944 Bacteria 2678
129 Ga0207661_10158339 3300025944 Bacteria 1963
130 Ga0207667_10005041 3300025949 Bacteria 16131
131 Ga0207667_10371384 3300025949 Bacteria 1458
132 Ga0207640_10020291 3300025981 Bacteria 3944
133 Ga0207703_10000039 3300026035 Bacteria 170322
134 Ga0207678_10008351 3300026067 Bacteria 9130
135 Ga0207702_10199115 3300026078 Bacteria 1855
136 Ga0207674_10057608 3300026116 Bacteria 3938
137 Ga0209588_1007225 3300027671 Bacteria 3258
138 Ga0209974_10000203 3300027876 Bacteria 19088
139 Ga0268265_10065350 3300028380 Bacteria 2807
140 Ga0268264_10178921 3300028381 Bacteria 1924
141 Ga0307515_10000037 3300028794 Bacteria 331970
142 Ga0265328_10035440 3300031239 Bacteria 1845
143 Ga0307408_100469520 3300031548 Bacteria 1095
144 Ga0307408_100616700 3300031548 Bacteria 966
145 Ga0316579_10006447 3300031691 Bacteria 4790
146 Ga0316576_10051518 3300031727 Bacteria 2996
147 Ga0316576_10064020 3300031727 Bacteria 2700
148 Ga0316578_10118339 3300031728 Bacteria 1592
149 Ga0307405_10337276 3300031731 Bacteria 1158
150 Ga0307406_10376482 3300031901 Bacteria 1118
151 Ga0307407_10374785 3300031903 Bacteria 1014
152 Ga0307412_10087133 3300031911 Bacteria 2175
153 Ga0307412_10130715 3300031911 Bacteria 1823
154 Ga0307409_100025973 3300031995 Bacteria 4121
155 Ga0307416_100116401 3300032002 Bacteria 2370
156 Ga0307416_100239560 3300032002 Bacteria 1757
157 Ga0307416_100272546 3300032002 Bacteria 1663
158 Ga0307411_10169739 3300032005 Bacteria 1643
159 Ga0307415_100014921 3300032126 Bacteria 4585
160 Ga0307415_100045335 3300032126 Bacteria 2947
161 Ga0307415_100348083 3300032126 Bacteria 1246
162 Ga0373926_0069030 3300035083 Bacteria 1296
163 Ga0373928_0095273 3300035084 Unclassified 769
164 Ga0373939_0003011 3300035114 Bacteria 3957
165 Ga0373953_0066148 3300035117 Bacteria 1485
166 Ga0373946_0160769 3300035171 Bacteria 1054
167 Ga0373942_0009817 3300035207 Bacteria 2242
168 Ga0316574_0002343 3300035398 Bacteria 9468
169 Ga0316574_0126697 3300035398 Bacteria 1642
170 Ga0373924_0047152 3300035410 Bacteria 1777
171 Ga0373931_0051001 3300035691 Unclassified 2202
172 Ga0373931_0059992 3300035691 Bacteria 2047
173 Ga0373947_0055736 3300035725 Bacteria 2388
174 Ga0316582_0027140 3300036647 Bacteria 3455
175 Ga0395899_0168696 3300037312 Bacteria 1542
176 Ga0395900_0027401 3300037418 Bacteria 5835
177 Ga0436364_0183138 3300037853 Bacteria 1291
178 Ga0395901_0039739 3300038443 Bacteria 4869
179 Ga0436361_0442355 3300039447 Bacteria 3071
180 Ga0436363_1360969 3300039450 Bacteria 1815
181 Ga0439461_0008254 3300041410 Bacteria 1862
182 Ga0439431_0025590 3300041997 Bacteria 1442
183 Ga0439433_0009461 3300041999 Bacteria 2123
184 Ga0439462_0011256 3300042015 Bacteria 2276
185 Ga0450920_004606 3300042122 Bacteria 2429
186 Ga0439446_0040361 3300042156 Bacteria 1373
187 Ga0439434_0000637 3300042435 Bacteria 10048
188 Ga0439435_0002977 3300042436 Bacteria 3451
189 Ga0466969_0046506 3300044656 Bacteria 2152
190 Ga0466966_0005163 3300044684 Bacteria 8581
191 Ga0466971_0036579 3300044719 Bacteria 2202
192 Ga0466957_0004539 3300044842 Bacteria 7749
193 Ga0466960_0007126 3300044901 Bacteria 4523
194 Ga0466959_0164215 3300045049 Bacteria 1560
195 Ga0451576_0130989 3300045051 Bacteria 2614
196 Ga0495592_0011320 3300046454 Bacteria 6747
197 Ga0495603_0165694 3300046455 Bacteria 1281
198 Ga0495591_019151 3300046458 Bacteria 2298
199 Ga0495629_0213775 3300046459 Bacteria 1331
200 Ga0495641_0060000 3300046461 Bacteria 1719
201 Ga0495651_0001242 3300046462 Bacteria 19733
202 Ga0495651_0187912 3300046462 Bacteria 1456
203 Ga0495653_0000097 3300046463 Bacteria 72749
204 Ga0495653_0002411 3300046463 Bacteria 14881
205 Ga0495580_0063064 3300046472 Bacteria 2600
206 Ga0495582_0056867 3300046473 Bacteria 2156
207 Ga0495664_0088519 3300046477 Bacteria 1861
208 Ga0495664_0121252 3300046477 Bacteria 1581
209 Ga0495585_0000582 3300046492 Bacteria 34375
210 Ga0495585_0077942 3300046492 Bacteria 1798
211 Ga0495607_0065322 3300046501 Bacteria 2052
212 Ga0495606_0000162 3300046507 Bacteria 117378
213 Ga0495608_0021837 3300046511 Bacteria 4390
214 Ga0495608_0323047 3300046511 Bacteria 953
215 Ga0495618_0010471 3300046514 Bacteria 5610
216 Ga0495618_0031775 3300046514 Bacteria 3305
217 Ga0495628_0012200 3300046516 Bacteria 7243
218 Ga0495628_0051289 3300046516 Bacteria 3262
219 Ga0495632_0069059 3300046519 Bacteria 1702
220 Ga0495648_0003607 3300046524 Bacteria 13546
221 Ga0495666_0075800 3300046526 Bacteria 1594
222 Ga0495652_0003372 3300046529 Bacteria 15807
223 Ga0495652_0118853 3300046529 Bacteria 2112
224 Ga0495640_0015101 3300046533 Bacteria 5817
225 Ga0495640_0184741 3300046533 Bacteria 1327
226 Ga0495598_0083456 3300046537 Bacteria 1030
227 Ga0495645_0032519 3300046543 Bacteria 3805
228 Ga0495667_0026680 3300046559 Bacteria 3893
229 Ga0495634_0064068 3300046642 Bacteria 2438
230 Ga0495635_0054926 3300046663 Bacteria 2743
231 Ga0495661_0000045 3300046665 Bacteria 148664
232 Ga0495657_0021891 3300046675 Bacteria 4584
233 Ga0495599_0013972 3300046678 Bacteria 4970
234 Ga0495599_0095344 3300046678 Bacteria 1856
235 Ga0495646_0007547 3300046680 Bacteria 6911
236 Ga0495646_0104336 3300046680 Bacteria 1621
237 Ga0495613_0041618 3300046689 Bacteria 3402
238 Ga0495600_0059975 3300046809 Bacteria 2484
239 Ga0495581_0079331 3300047315 Bacteria 1900
240 Ga0495604_0003040 3300047317 Bacteria 13412
241 Ga0495674_0062676 3300047319 Bacteria 3236
242 Ga0495672_0001454 3300047320 Bacteria 23234
243 Ga0495680_0004191 3300047322 Bacteria 13847
244 Ga0495680_0025644 3300047322 Bacteria 4875
245 Ga0495675_0014949 3300047444 Bacteria 4907
246 Ga0495593_0134944 3300047673 Bacteria 1251
247 Ga0495602_0198454 3300048088 Bacteria 1533
248 Ga0496100_0045686 3300048903 Bacteria 2812
249 Ga0496101_0012477 3300048904 Bacteria 5671
250 Ga0496101_0087844 3300048904 Bacteria 2308
251 Ga0496102_0009531 3300048905 Bacteria 8349
252 Ga0496102_0160806 3300048905 Bacteria 2113
253 Ga0496103_0043477 3300048906 Bacteria 2766
254 Ga0496104_0028025 3300048907 Bacteria 5218
255 Ga0496104_0037836 3300048907 Bacteria 4511
256 Ga0496104_0078049 3300048907 Bacteria 3155
257 Ga0496104_0342619 3300048907 Bacteria 1408
258 Ga0496104_0550448 3300048907 Bacteria 1065
259 Ga0496105_0011342 3300048908 Bacteria 7039
260 Ga0496106_0164384 3300048909 Bacteria 1756
261 Ga0496107_0027772 3300048910 Bacteria 4020
262 Ga0496108_0151430 3300048911 Bacteria 2002
263 Ga0496108_0176625 3300048911 Bacteria 1849
264 Ga0496108_0343659 3300048911 Bacteria 1302
265 Ga0496108_0536222 3300048911 Bacteria 1021
266 Ga0496109_0019043 3300048912 Bacteria 6046
267 Ga0496109_0023377 3300048912 Bacteria 5487
268 Ga0496109_0067214 3300048912 Bacteria 3283
269 Ga0496109_0082157 3300048912 Bacteria 2969
270 Ga0496109_0397851 3300048912 Bacteria 1301
271 Ga0496110_0000235 3300048913 Bacteria 35772
272 Ga0496110_0173499 3300048913 Bacteria 1957
273 Ga0496111_0000011 3300048914 Bacteria 88409
274 Ga0496111_0276040 3300048914 Bacteria 1247
275 Ga0496113_0061363 3300048916 Bacteria 2837
276 Ga0496114_0015527 3300048917 Bacteria 6123
277 Ga0496114_0015827 3300048917 Bacteria 6070
278 Ga0496114_0091796 3300048917 Bacteria 2579
279 Ga0496115_0021436 3300048918 Bacteria 4992
280 Ga0496115_0034816 3300048918 Bacteria 3980
281 Ga0496117_0034968 3300048920 Bacteria 3779
282 Ga0496119_0019532 3300048922 Bacteria 4985
283 Ga0496119_0054652 3300048922 Bacteria 2430
284 Ga0496120_0067256 3300048923 Bacteria 1980
285 Ga0501031_0094071 3300049568 Bacteria 1956
286 Ga0501034_0222242 3300049571 Bacteria 1841
287 Ga0501034_0346354 3300049571 Bacteria 1415
288 Ga0501037_0097857 3300049573 Bacteria 2120
289 Ga0501038_0098144 3300049574 Bacteria 2443
290 Ga0501042_0312124 3300049578 Bacteria 1136
291 Ga0501043_0370073 3300049579 Bacteria 1086
292 Ga0501047_0056122 3300049581 Bacteria 3808
293 Ga0501047_0083628 3300049581 Bacteria 3067
294 Ga0501069_0056248 3300049585 Bacteria 2191
295 Ga0501069_0083285 3300049585 Bacteria 1803
296 Ga0501070_0021196 3300049586 Bacteria 5454
297 Ga0501070_0031021 3300049586 Bacteria 4477
298 Ga0501070_0107525 3300049586 Bacteria 2305
299 Ga0501070_0254149 3300049586 Bacteria 1437
300 Ga0501070_0360574 3300049586 Bacteria 1179
301 Ga0501071_0001798 3300049587 Bacteria 12670
302 Ga0501071_0471320 3300049587 Bacteria 962
303 Ga0501072_0209548 3300049588 Bacteria 1553
304 Ga0501073_0008246 3300049589 Bacteria 7727
305 Ga0501073_0064245 3300049589 Bacteria 2559
306 Ga0501074_0007340 3300049590 Bacteria 7967
307 Ga0501074_0074216 3300049590 Bacteria 2442
308 Ga0501075_0051037 3300049591 Bacteria 3110
309 Ga0501076_0540658 3300049592 Bacteria 961
310 Ga0501077_0081477 3300049593 Bacteria 2050
311 Ga0501079_0424014 3300049741 Bacteria 1044
312 Ga0501080_0007632 3300049742 Bacteria 9780
313 Ga0501080_0267885 3300049742 Bacteria 1555
314 Ga0501080_0471721 3300049742 Bacteria 1123
315 Ga0501035_0000839 3300049822 Bacteria 32838
316 Ga0501035_0167205 3300049822 Bacteria 1901
317 Ga0501044_0007834 3300049823 Bacteria 11743
318 Ga0501044_0024812 3300049823 Bacteria 6361
319 nmdc:mga05p37_124451_c1 3300050507 Bacteria 3167
320 nmdc:mga05p37_17404_c1 3300050507 Bacteria 8674
321 nmdc:mga05p37_228889_c1 3300050507 Bacteria 2241
322 nmdc:mga05p37_33584_c1 3300050507 Bacteria 6284
323 nmdc:mga05p37_98347_c1 3300050507 Bacteria 3604
324 nmdc:mga09592_24067_c1 3300050508 Bacteria 5034
325 nmdc:mga09592_586675_c1 3300050508 Bacteria 956
326 nmdc:mga09592_71997_c1 3300050508 Bacteria 2935
327 nmdc:mga09592_72381_c1 3300050508 Bacteria 2927
328 nmdc:mga0qj67_244875_c1 3300050509 Bacteria 1455
329 nmdc:mga0qj67_347295_c1 3300050509 Bacteria 1200
330 nmdc:mga0qj67_68289_c1 3300050509 Bacteria 2833
331 nmdc:mga06r32_14499_c1 3300050510 Bacteria 7154
332 nmdc:mga06r32_221630_c1 3300050510 Bacteria 1880
333 nmdc:mga06r32_377474_c1 3300050510 Bacteria 1401
334 nmdc:mga06r32_727630_c1 3300050510 Bacteria 957
335 nmdc:mga0n895_174796_c1 3300050512 Bacteria 2179
336 nmdc:mga0rr50_212951_c1 3300050513 Bacteria 1593
337 nmdc:mga0rr50_27975_c1 3300050513 Bacteria 3957
338 nmdc:mga0rr50_99465_c1 3300050513 Bacteria 2282
339 nmdc:mga08x19_7305_c1 3300050514 Bacteria 6560
340 nmdc:mga0a205_114238_c1 3300050515 Bacteria 2599
341 Ga0495601_0018778 3300053077 Bacteria 4210
342 Ga0495595_0030937 3300053084 Bacteria 2403
343 Ga0495619_0019965 3300053085 Bacteria 4263
344 Ga0495619_0096824 3300053085 Bacteria 2004
345 Ga0495619_0102409 3300053085 Bacteria 1950
346 Ga0500641_0009115 3300053096 Bacteria 3559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0061363 Ga0496113_0061363_2093_2821 239
2 3300046519 Ga0495632_0069059 Ga0495632_0069059_951_1679 241
3 3300006846 Ga0075430_100532559 Ga0075430_1005325592 242
4 3300035084 Ga0373928_0095273 Ga0373928_0095273_15_743 242
5 3300041997 Ga0439431_0025590 Ga0439431_0025590_25_753 242
6 3300042156 Ga0439446_0040361 Ga0439446_0040361_600_1328 242
7 3300049592 Ga0501076_0540658 Ga0501076_0540658_28_756 242
8 3300046537 Ga0495598_0083456 Ga0495598_0083456_255_1019 254
9 3300005339 Ga0070660_100383037 Ga0070660_1003830372 257
10 3300021388 Ga0213875_10118449 Ga0213875_101184491 263
11 3300049568 Ga0501031_0094071 Ga0501031_0094071_772_1617 267
12 3300049578 Ga0501042_0312124 Ga0501042_0312124_161_1006 267
13 3300049588 Ga0501072_0209548 Ga0501072_0209548_681_1526 267
14 3300049591 Ga0501075_0051037 Ga0501075_0051037_407_1252 267
15 3300041999 Ga0439433_0009461 Ga0439433_0009461_1118_1930 269
16 3300042015 Ga0439462_0011256 Ga0439462_0011256_459_1271 269
17 3300048907 Ga0496104_0550448 Ga0496104_0550448_201_1028 270
18 3300048922 Ga0496119_0019532 Ga0496119_0019532_3834_4661 270
19 3300048923 Ga0496120_0067256 Ga0496120_0067256_498_1325 270
20 iso_pu_bacteria 2946024296 2946026086 270
21 3300005327 Ga0070658_10384623 Ga0070658_103846232 271
22 3300005530 Ga0070679_100028107 Ga0070679_1000281074 271
23 3300006048 Ga0075363_100093843 Ga0075363_1000938432 271
24 3300006881 Ga0068865_100037455 Ga0068865_1000374551 271
25 3300009098 Ga0105245_10023692 Ga0105245_100236927 271
26 3300013297 Ga0157378_10209669 Ga0157378_102096692 271
27 3300013306 Ga0163162_10805058 Ga0163162_108050581 271
28 3300025921 Ga0207652_10043879 Ga0207652_100438793 271
29 3300025942 Ga0207689_10016095 Ga0207689_100160953 271
30 3300031727 Ga0316576_10051518 Ga0316576_100515182 271
31 3300031727 Ga0316576_10064020 Ga0316576_100640202 271
32 3300035398 Ga0316574_0126697 Ga0316574_0126697_770_1609 271
33 3300037853 Ga0436364_0183138 Ga0436364_0183138_326_1168 271
34 3300046678 Ga0495599_0095344 Ga0495599_0095344_347_1174 271
35 3300047320 Ga0495672_0001454 Ga0495672_0001454_736_1563 271
36 3300005329 Ga0070683_100345725 Ga0070683_1003457252 272
37 3300005535 Ga0070684_100354548 Ga0070684_1003545482 272
38 3300005563 Ga0068855_100080605 Ga0068855_1000806051 272
39 3300005616 Ga0068852_100146322 Ga0068852_1001463221 272
40 3300005618 Ga0068864_100108021 Ga0068864_1001080213 272
41 3300005842 Ga0068858_100188341 Ga0068858_1001883412 272
42 3300006173 Ga0070716_100126858 Ga0070716_1001268582 272
43 3300006358 Ga0068871_100031694 Ga0068871_1000316944 272
44 3300006914 Ga0075436_100119787 Ga0075436_1001197872 272
45 3300009101 Ga0105247_10411590 Ga0105247_104115901 272
46 3300009177 Ga0105248_10325443 Ga0105248_103254432 272
47 3300009551 Ga0105238_10320242 Ga0105238_103202421 272
48 3300010375 Ga0105239_10258167 Ga0105239_102581672 272
49 3300013104 Ga0157370_10021640 Ga0157370_100216406 272
50 3300013104 Ga0157370_10184108 Ga0157370_101841082 272
51 3300013105 Ga0157369_10361206 Ga0157369_103612062 272
52 3300013296 Ga0157374_10235685 Ga0157374_102356852 272
53 3300013306 Ga0163162_10300162 Ga0163162_103001622 272
54 3300013307 Ga0157372_10637991 Ga0157372_106379911 272
55 3300013308 Ga0157375_10170192 Ga0157375_101701923 272
56 3300014325 Ga0163163_10188476 Ga0163163_101884763 272
57 3300014968 Ga0157379_10013875 Ga0157379_100138754 272
58 3300014969 Ga0157376_10053403 Ga0157376_100534032 272
59 3300025929 Ga0207664_10223193 Ga0207664_102231932 272
60 3300025939 Ga0207665_10052059 Ga0207665_100520593 272
61 3300025944 Ga0207661_10158339 Ga0207661_101583391 272
62 3300025949 Ga0207667_10371384 Ga0207667_103713842 272
63 3300026116 Ga0207674_10057608 Ga0207674_100576082 272
64 3300028381 Ga0268264_10178921 Ga0268264_101789211 272
65 3300031239 Ga0265328_10035440 Ga0265328_100354403 272
66 3300031995 Ga0307409_100025973 Ga0307409_1000259732 272
67 3300032002 Ga0307416_100116401 Ga0307416_1001164013 272
68 3300032126 Ga0307415_100014921 Ga0307415_1000149212 272
69 3300032126 Ga0307415_100045335 Ga0307415_1000453353 272
70 3300032126 Ga0307415_100348083 Ga0307415_1003480832 272
71 3300035083 Ga0373926_0069030 Ga0373926_0069030_282_1121 272
72 3300035117 Ga0373953_0066148 Ga0373953_0066148_302_1141 272
73 3300035171 Ga0373946_0160769 Ga0373946_0160769_133_972 272
74 3300035410 Ga0373924_0047152 Ga0373924_0047152_626_1465 272
75 3300035691 Ga0373931_0059992 Ga0373931_0059992_418_1248 272
76 3300039450 Ga0436363_1360969 Ga0436363_1360969_24_854 272
77 3300044842 Ga0466957_0004539 Ga0466957_0004539_5580_6410 272
78 3300044901 Ga0466960_0007126 Ga0466960_0007126_2270_3100 272
79 3300046454 Ga0495592_0011320 Ga0495592_0011320_139_978 272
80 3300046455 Ga0495603_0165694 Ga0495603_0165694_28_981 272
81 3300046459 Ga0495629_0213775 Ga0495629_0213775_426_1265 272
82 3300046461 Ga0495641_0060000 Ga0495641_0060000_314_1144 272
83 3300046462 Ga0495651_0001242 Ga0495651_0001242_16544_17383 272
84 3300046462 Ga0495651_0187912 Ga0495651_0187912_478_1308 272
85 3300046463 Ga0495653_0002411 Ga0495653_0002411_4563_5402 272
86 3300046472 Ga0495580_0063064 Ga0495580_0063064_1653_2492 272
87 3300046473 Ga0495582_0056867 Ga0495582_0056867_569_1408 272
88 3300046477 Ga0495664_0088519 Ga0495664_0088519_484_1314 272
89 3300046477 Ga0495664_0121252 Ga0495664_0121252_517_1356 272
90 3300046511 Ga0495608_0021837 Ga0495608_0021837_2675_3505 272
91 3300046514 Ga0495618_0010471 Ga0495618_0010471_4507_5337 272
92 3300046514 Ga0495618_0031775 Ga0495618_0031775_1210_2049 272
93 3300046516 Ga0495628_0012200 Ga0495628_0012200_5201_6040 272
94 3300046516 Ga0495628_0051289 Ga0495628_0051289_2314_3144 272
95 3300046526 Ga0495666_0075800 Ga0495666_0075800_316_1155 272
96 3300046529 Ga0495652_0003372 Ga0495652_0003372_5450_6289 272
97 3300046529 Ga0495652_0118853 Ga0495652_0118853_1159_1989 272
98 3300046533 Ga0495640_0015101 Ga0495640_0015101_2058_2888 272
99 3300046533 Ga0495640_0184741 Ga0495640_0184741_22_861 272
100 3300046543 Ga0495645_0032519 Ga0495645_0032519_2570_3409 272
101 3300046559 Ga0495667_0026680 Ga0495667_0026680_247_1077 272
102 3300046642 Ga0495634_0064068 Ga0495634_0064068_1380_2210 272
103 3300046663 Ga0495635_0054926 Ga0495635_0054926_1106_1945 272
104 3300046675 Ga0495657_0021891 Ga0495657_0021891_3061_3900 272
105 3300046678 Ga0495599_0013972 Ga0495599_0013972_2692_3531 272
106 3300046680 Ga0495646_0007547 Ga0495646_0007547_837_1676 272
107 3300046680 Ga0495646_0104336 Ga0495646_0104336_485_1315 272
108 3300046689 Ga0495613_0041618 Ga0495613_0041618_1407_2237 272
109 3300046809 Ga0495600_0059975 Ga0495600_0059975_933_1772 272
110 3300047315 Ga0495581_0079331 Ga0495581_0079331_415_1254 272
111 3300047317 Ga0495604_0003040 Ga0495604_0003040_2911_3750 272
112 3300047319 Ga0495674_0062676 Ga0495674_0062676_662_1501 272
113 3300047322 Ga0495680_0004191 Ga0495680_0004191_12766_13596 272
114 3300047322 Ga0495680_0025644 Ga0495680_0025644_3089_3928 272
115 3300047444 Ga0495675_0014949 Ga0495675_0014949_3119_3958 272
116 3300047673 Ga0495593_0134944 Ga0495593_0134944_339_1178 272
117 3300048088 Ga0495602_0198454 Ga0495602_0198454_683_1513 272
118 3300048907 Ga0496104_0078049 Ga0496104_0078049_182_1021 272
119 3300048911 Ga0496108_0536222 Ga0496108_0536222_167_1006 272
120 3300048912 Ga0496109_0082157 Ga0496109_0082157_1982_2821 272
121 3300048913 Ga0496110_0000235 Ga0496110_0000235_33015_33848 272
122 3300048914 Ga0496111_0000011 Ga0496111_0000011_38622_39455 272
123 3300053077 Ga0495601_0018778 Ga0495601_0018778_2699_3538 272
124 3300053084 Ga0495595_0030937 Ga0495595_0030937_172_1011 272
125 3300053085 Ga0495619_0096824 Ga0495619_0096824_11_841 272
126 3300053085 Ga0495619_0102409 Ga0495619_0102409_486_1325 272
127 iso_pu_bacteria 2511231011 2511297218 272
128 iso_pu_bacteria 2818991456 2819656897 272
129 iso_pu_bacteria 2880230671 2880233081 272
130 iso_pu_bacteria 8056569372 8056573746 272
131 3300013308 Ga0157375_11028409 Ga0157375_110284092 273
132 3300046501 Ga0495607_0065322 Ga0495607_0065322_1013_1837 273
133 3300046511 Ga0495608_0323047 Ga0495608_0323047_23_853 273
134 3300048903 Ga0496100_0045686 Ga0496100_0045686_1857_2681 273
135 3300048904 Ga0496101_0012477 Ga0496101_0012477_3644_4468 273
136 3300048904 Ga0496101_0087844 Ga0496101_0087844_1179_2003 273
137 3300048905 Ga0496102_0009531 Ga0496102_0009531_2635_3459 273
138 3300048905 Ga0496102_0160806 Ga0496102_0160806_846_1670 273
139 3300048906 Ga0496103_0043477 Ga0496103_0043477_1424_2248 273
140 3300048907 Ga0496104_0037836 Ga0496104_0037836_2071_2895 273
141 3300048907 Ga0496104_0342619 Ga0496104_0342619_490_1314 273
142 3300048908 Ga0496105_0011342 Ga0496105_0011342_5973_6797 273
143 3300048909 Ga0496106_0164384 Ga0496106_0164384_751_1575 273
144 3300048910 Ga0496107_0027772 Ga0496107_0027772_1147_1971 273
145 3300048911 Ga0496108_0151430 Ga0496108_0151430_739_1563 273
146 3300048911 Ga0496108_0176625 Ga0496108_0176625_340_1164 273
147 3300048911 Ga0496108_0343659 Ga0496108_0343659_201_1025 273
148 3300048912 Ga0496109_0019043 Ga0496109_0019043_3028_3852 273
149 3300048912 Ga0496109_0023377 Ga0496109_0023377_408_1232 273
150 3300048912 Ga0496109_0067214 Ga0496109_0067214_150_974 273
151 3300048912 Ga0496109_0397851 Ga0496109_0397851_392_1216 273
152 3300048913 Ga0496110_0173499 Ga0496110_0173499_607_1431 273
153 3300048914 Ga0496111_0276040 Ga0496111_0276040_268_1092 273
154 3300048917 Ga0496114_0015527 Ga0496114_0015527_1558_2382 273
155 3300048917 Ga0496114_0015827 Ga0496114_0015827_73_897 273
156 3300048917 Ga0496114_0091796 Ga0496114_0091796_992_1816 273
157 3300048918 Ga0496115_0021436 Ga0496115_0021436_3952_4776 273
158 3300048918 Ga0496115_0034816 Ga0496115_0034816_507_1331 273
159 3300049586 Ga0501070_0254149 Ga0501070_0254149_325_1155 273
160 3300053085 Ga0495619_0019965 Ga0495619_0019965_2418_3248 273
161 3300003320 rootH2_10084167 rootH2_100841672 274
162 3300005262 Ga0065165_1000547 Ga0065165_100054748 274
163 3300005842 Ga0068858_100000039 Ga0068858_10000003969 274
164 3300006353 Ga0075370_10001988 Ga0075370_100019889 274
165 3300009101 Ga0105247_10004559 Ga0105247_100045594 274
166 3300014968 Ga0157379_10000288 Ga0157379_1000028812 274
167 3300025302 Ga0207426_1007965 Ga0207426_10079652 274
168 3300025900 Ga0207710_10000127 Ga0207710_1000012765 274
169 3300026035 Ga0207703_10000039 Ga0207703_1000003992 274
170 3300035398 Ga0316574_0002343 Ga0316574_0002343_2924_3757 274
171 3300048907 Ga0496104_0028025 Ga0496104_0028025_3860_4759 274
172 3300048922 Ga0496119_0054652 Ga0496119_0054652_1118_2017 274
173 3300005328 Ga0070676_10056564 Ga0070676_100565643 275
174 3300005353 Ga0070669_100087858 Ga0070669_1000878581 275
175 3300005457 Ga0070662_100021852 Ga0070662_1000218526 275
176 3300005548 Ga0070665_100003466 Ga0070665_10000346611 275
177 3300005718 Ga0068866_10025541 Ga0068866_100255412 275
178 3300005937 Ga0081455_10003454 Ga0081455_1000345412 275
179 3300006058 Ga0075432_10041507 Ga0075432_100415072 275
180 3300006844 Ga0075428_100045366 Ga0075428_1000453663 275
181 3300006844 Ga0075428_100046240 Ga0075428_1000462404 275
182 3300006844 Ga0075428_100078526 Ga0075428_1000785264 275
183 3300006844 Ga0075428_100202620 Ga0075428_1002026202 275
184 3300006846 Ga0075430_100101426 Ga0075430_1001014262 275
185 3300006847 Ga0075431_100046686 Ga0075431_1000466867 275
186 3300006847 Ga0075431_100279504 Ga0075431_1002795041 275
187 3300006847 Ga0075431_100384795 Ga0075431_1003847952 275
188 3300006871 Ga0075434_100017817 Ga0075434_1000178175 275
189 3300006880 Ga0075429_100035591 Ga0075429_1000355912 275
190 3300006880 Ga0075429_100068727 Ga0075429_1000687272 275
191 3300006880 Ga0075429_100359257 Ga0075429_1003592572 275
192 3300006914 Ga0075436_100006614 Ga0075436_1000066147 275
193 3300006948 Ga0099826_10000063 Ga0099826_1000006353 275
194 3300007076 Ga0075435_100031227 Ga0075435_1000312274 275
195 3300009094 Ga0111539_10022605 Ga0111539_1002260511 275
196 3300009147 Ga0114129_10160394 Ga0114129_101603942 275
197 3300013100 Ga0157373_10002414 Ga0157373_100024145 275
198 3300013105 Ga0157369_10158269 Ga0157369_101582693 275
199 3300013250 Ga0171462_1036 Ga0171462_10367 275
200 3300014497 Ga0182008_10000164 Ga0182008_1000016418 275
201 3300015265 Ga0182005_1019151 Ga0182005_10191511 275
202 3300021361 Ga0213872_10055207 Ga0213872_100552071 275
203 3300025230 Ga0209563_100445 Ga0209563_10044518 275
204 3300025907 Ga0207645_10007034 Ga0207645_1000703411 275
205 3300025908 Ga0207643_10028869 Ga0207643_100288696 275
206 3300025910 Ga0207684_10103016 Ga0207684_101030162 275
207 3300025917 Ga0207660_10096463 Ga0207660_100964633 275
208 3300025933 Ga0207706_10006032 Ga0207706_1000603212 275
209 3300027876 Ga0209974_10000203 Ga0209974_100002038 275
210 3300028380 Ga0268265_10065350 Ga0268265_100653502 275
211 3300028794 Ga0307515_10000037 Ga0307515_10000037213 275
212 3300031548 Ga0307408_100616700 Ga0307408_1006167001 275
213 3300032002 Ga0307416_100272546 Ga0307416_1002725461 275
214 3300035725 Ga0373947_0055736 Ga0373947_0055736_1043_1873 275
215 3300039447 Ga0436361_0442355 Ga0436361_0442355_1024_1875 275
216 3300044719 Ga0466971_0036579 Ga0466971_0036579_195_1049 275
217 3300046458 Ga0495591_019151 Ga0495591_019151_1354_2190 275
218 3300046463 Ga0495653_0000097 Ga0495653_0000097_2351_3187 275
219 3300046492 Ga0495585_0000582 Ga0495585_0000582_2314_3204 275
220 3300046492 Ga0495585_0077942 Ga0495585_0077942_549_1385 275
221 3300046507 Ga0495606_0000162 Ga0495606_0000162_2730_3566 275
222 3300046524 Ga0495648_0003607 Ga0495648_0003607_3290_4126 275
223 3300046665 Ga0495661_0000045 Ga0495661_0000045_2340_3230 275
224 3300048920 Ga0496117_0034968 Ga0496117_0034968_1442_2287 275
225 3300050507 nmdc:mga05p37_17404_c1 nmdc:mga05p37_17404_c1_2497_3327 275
226 3300050507 nmdc:mga05p37_98347_c1 nmdc:mga05p37_98347_c1_2061_2894 275
227 3300050508 nmdc:mga09592_24067_c1 nmdc:mga09592_24067_c1_599_1429 275
228 3300050508 nmdc:mga09592_586675_c1 nmdc:mga09592_586675_c1_91_921 275
229 3300050508 nmdc:mga09592_71997_c1 nmdc:mga09592_71997_c1_65_895 275
230 3300050508 nmdc:mga09592_72381_c1 nmdc:mga09592_72381_c1_112_942 275
231 3300050509 nmdc:mga0qj67_244875_c1 nmdc:mga0qj67_244875_c1_241_1071 275
232 3300050509 nmdc:mga0qj67_347295_c1 nmdc:mga0qj67_347295_c1_296_1126 275
233 3300050509 nmdc:mga0qj67_68289_c1 nmdc:mga0qj67_68289_c1_955_1806 275
234 3300050510 nmdc:mga06r32_14499_c1 nmdc:mga06r32_14499_c1_2274_3104 275
235 3300050510 nmdc:mga06r32_221630_c1 nmdc:mga06r32_221630_c1_243_1073 275
236 3300050510 nmdc:mga06r32_377474_c1 nmdc:mga06r32_377474_c1_108_938 275
237 3300050510 nmdc:mga06r32_727630_c1 nmdc:mga06r32_727630_c1_112_942 275
238 3300050513 nmdc:mga0rr50_27975_c1 nmdc:mga0rr50_27975_c1_3112_3942 275
239 3300050514 nmdc:mga08x19_7305_c1 nmdc:mga08x19_7305_c1_50_880 275
240 3300050515 nmdc:mga0a205_114238_c1 nmdc:mga0a205_114238_c1_1658_2488 275
241 3300053096 Ga0500641_0009115 Ga0500641_0009115_1490_2320 275
242 3300003316 rootH1_10007122 rootH1_100071229 276
243 3300021361 Ga0213872_10030183 Ga0213872_100301833 276
244 3300031548 Ga0307408_100469520 Ga0307408_1004695201 276
245 3300031731 Ga0307405_10337276 Ga0307405_103372762 276
246 3300031901 Ga0307406_10376482 Ga0307406_103764821 276
247 3300031903 Ga0307407_10374785 Ga0307407_103747851 276
248 3300031911 Ga0307412_10087133 Ga0307412_100871332 276
249 3300031911 Ga0307412_10130715 Ga0307412_101307153 276
250 3300032002 Ga0307416_100239560 Ga0307416_1002395602 276
251 3300032005 Ga0307411_10169739 Ga0307411_101697392 276
252 3300042122 Ga0450920_004606 Ga0450920_004606_831_1670 276
253 3300001915 JGI24741J21665_1002187 JGI24741J21665_10021876 277
254 3300005295 Ga0065707_10144246 Ga0065707_101442462 277
255 3300005336 Ga0070680_100012734 Ga0070680_1000127345 277
256 3300005341 Ga0070691_10000595 Ga0070691_1000059511 277
257 3300005344 Ga0070661_100033178 Ga0070661_1000331784 277
258 3300005344 Ga0070661_100163551 Ga0070661_1001635512 277
259 3300005345 Ga0070692_10003790 Ga0070692_100037906 277
260 3300005455 Ga0070663_100235466 Ga0070663_1002354662 277
261 3300005458 Ga0070681_10001719 Ga0070681_100017197 277
262 3300005530 Ga0070679_100001729 Ga0070679_10000172913 277
263 3300005535 Ga0070684_100029902 Ga0070684_1000299023 277
264 3300005545 Ga0070695_100465556 Ga0070695_1004655561 277
265 3300005577 Ga0068857_100547506 Ga0068857_1005475061 277
266 3300005616 Ga0068852_100284768 Ga0068852_1002847682 277
267 3300005981 Ga0081538_10013869 Ga0081538_100138696 277
268 3300006852 Ga0075433_10025436 Ga0075433_100254367 277
269 3300006871 Ga0075434_100036665 Ga0075434_1000366652 277
270 3300006871 Ga0075434_100293231 Ga0075434_1002932312 277
271 3300006871 Ga0075434_100550231 Ga0075434_1005502312 277
272 3300007076 Ga0075435_100012459 Ga0075435_1000124596 277
273 3300007076 Ga0075435_100264831 Ga0075435_1002648312 277
274 3300007076 Ga0075435_100340794 Ga0075435_1003407941 277
275 3300007265 Ga0099794_10008156 Ga0099794_100081565 277
276 3300009093 Ga0105240_10368993 Ga0105240_103689932 277
277 3300009147 Ga0114129_10042514 Ga0114129_100425142 277
278 3300009147 Ga0114129_10117087 Ga0114129_101170872 277
279 3300013104 Ga0157370_10091193 Ga0157370_100911932 277
280 3300013104 Ga0157370_10237141 Ga0157370_102371412 277
281 3300013297 Ga0157378_10547286 Ga0157378_105472862 277
282 3300013307 Ga0157372_10181061 Ga0157372_101810613 277
283 3300020081 Ga0206354_10589031 Ga0206354_105890312 277
284 3300020082 Ga0206353_10706753 Ga0206353_107067532 277
285 3300025904 Ga0207647_10029100 Ga0207647_100291002 277
286 3300025909 Ga0207705_10007964 Ga0207705_100079642 277
287 3300025912 Ga0207707_10001385 Ga0207707_1000138514 277
288 3300025913 Ga0207695_10004841 Ga0207695_1000484112 277
289 3300025917 Ga0207660_10000181 Ga0207660_1000018130 277
290 3300025917 Ga0207660_10013894 Ga0207660_100138942 277
291 3300025919 Ga0207657_10011299 Ga0207657_100112998 277
292 3300025920 Ga0207649_10018236 Ga0207649_100182364 277
293 3300025921 Ga0207652_10000213 Ga0207652_100002137 277
294 3300025921 Ga0207652_10021866 Ga0207652_100218665 277
295 3300025932 Ga0207690_10058266 Ga0207690_100582662 277
296 3300025944 Ga0207661_10081146 Ga0207661_100811462 277
297 3300025949 Ga0207667_10005041 Ga0207667_1000504112 277
298 3300025981 Ga0207640_10020291 Ga0207640_100202912 277
299 3300026067 Ga0207678_10008351 Ga0207678_100083512 277
300 3300026078 Ga0207702_10199115 Ga0207702_101991152 277
301 3300027671 Ga0209588_1007225 Ga0209588_10072252 277
302 3300031691 Ga0316579_10006447 Ga0316579_100064477 277
303 3300031728 Ga0316578_10118339 Ga0316578_101183392 277
304 3300035114 Ga0373939_0003011 Ga0373939_0003011_2164_2997 277
305 3300035207 Ga0373942_0009817 Ga0373942_0009817_663_1496 277
306 3300035691 Ga0373931_0051001 Ga0373931_0051001_527_1360 277
307 3300036647 Ga0316582_0027140 Ga0316582_0027140_993_1835 277
308 3300037312 Ga0395899_0168696 Ga0395899_0168696_377_1282 277
309 3300037418 Ga0395900_0027401 Ga0395900_0027401_3684_4589 277
310 3300038443 Ga0395901_0039739 Ga0395901_0039739_2889_3794 277
311 3300041410 Ga0439461_0008254 Ga0439461_0008254_624_1463 277
312 3300042435 Ga0439434_0000637 Ga0439434_0000637_775_1614 277
313 3300042436 Ga0439435_0002977 Ga0439435_0002977_915_1754 277
314 3300044656 Ga0466969_0046506 Ga0466969_0046506_976_1809 277
315 3300044684 Ga0466966_0005163 Ga0466966_0005163_459_1292 277
316 3300045049 Ga0466959_0164215 Ga0466959_0164215_548_1381 277
317 3300045051 Ga0451576_0130989 Ga0451576_0130989_517_1350 277
318 3300049571 Ga0501034_0222242 Ga0501034_0222242_621_1454 277
319 3300049571 Ga0501034_0346354 Ga0501034_0346354_488_1321 277
320 3300049573 Ga0501037_0097857 Ga0501037_0097857_206_1039 277
321 3300049574 Ga0501038_0098144 Ga0501038_0098144_94_927 277
322 3300049579 Ga0501043_0370073 Ga0501043_0370073_215_1048 277
323 3300049581 Ga0501047_0056122 Ga0501047_0056122_638_1471 277
324 3300049581 Ga0501047_0083628 Ga0501047_0083628_1540_2373 277
325 3300049585 Ga0501069_0056248 Ga0501069_0056248_528_1361 277
326 3300049585 Ga0501069_0083285 Ga0501069_0083285_569_1402 277
327 3300049586 Ga0501070_0021196 Ga0501070_0021196_4245_5078 277
328 3300049586 Ga0501070_0031021 Ga0501070_0031021_1467_2300 277
329 3300049586 Ga0501070_0107525 Ga0501070_0107525_490_1323 277
330 3300049586 Ga0501070_0360574 Ga0501070_0360574_93_926 277
331 3300049587 Ga0501071_0001798 Ga0501071_0001798_6956_7789 277
332 3300049587 Ga0501071_0471320 Ga0501071_0471320_27_863 277
333 3300049589 Ga0501073_0008246 Ga0501073_0008246_4566_5417 277
334 3300049589 Ga0501073_0064245 Ga0501073_0064245_1127_1960 277
335 3300049590 Ga0501074_0007340 Ga0501074_0007340_5006_5839 277
336 3300049590 Ga0501074_0074216 Ga0501074_0074216_931_1764 277
337 3300049593 Ga0501077_0081477 Ga0501077_0081477_1005_1838 277
338 3300049741 Ga0501079_0424014 Ga0501079_0424014_38_871 277
339 3300049742 Ga0501080_0007632 Ga0501080_0007632_7054_7887 277
340 3300049742 Ga0501080_0267885 Ga0501080_0267885_330_1163 277
341 3300049742 Ga0501080_0471721 Ga0501080_0471721_251_1084 277
342 3300049822 Ga0501035_0000839 Ga0501035_0000839_14809_15642 277
343 3300049822 Ga0501035_0167205 Ga0501035_0167205_678_1511 277
344 3300049823 Ga0501044_0007834 Ga0501044_0007834_10494_11327 277
345 3300049823 Ga0501044_0024812 Ga0501044_0024812_2667_3500 277
346 3300050507 nmdc:mga05p37_124451_c1 nmdc:mga05p37_124451_c1_1435_2268 277
347 3300050507 nmdc:mga05p37_228889_c1 nmdc:mga05p37_228889_c1_202_1038 277
348 3300050507 nmdc:mga05p37_33584_c1 nmdc:mga05p37_33584_c1_1647_2480 277
349 3300050512 nmdc:mga0n895_174796_c1 nmdc:mga0n895_174796_c1_332_1165 277
350 3300050513 nmdc:mga0rr50_212951_c1 nmdc:mga0rr50_212951_c1_332_1165 277
351 3300050513 nmdc:mga0rr50_99465_c1 nmdc:mga0rr50_99465_c1_104_949 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

46

316

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.887 4 277
1ym5-assembly1.cif.gz_A-2 crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. 0.8807 1 277
1ym5-assembly1.cif.gz_A-2 crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. 0.8778 1 277
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.8775 2 277
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8747 4 277
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9776 2 109 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9515 2 109 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9382 5 113 3.10.310.10
af_P38765_5_131_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.9295 6 123 1.20.1730.10
1s7jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9218 2 117 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A6L3N8V3-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9917 4 114 GO:0005737
GO:0009058
GO:0016853
AF-A0A6G4TTW9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9907 2 275 GO:0005737
GO:0009058
GO:0016853
AF-A0A2N3TGD1-F1-model_v4 deleted 0.9887 37 266
AF-A0A520DSQ5-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9887 1 124 GO:0005737
GO:0009058
GO:0016853
AF-A0A3A6S008-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9883 2 277 GO:0005737
GO:0009058
GO:0016853

Feature Viewer

pLDDT pTM Quality
96.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map