F418598

General Info

Members Datasets Scaffolds Average Seq Length
351 222 702 174

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100705122|Ga0075428_1007051222
Length 191
Sequence MSRIGRKPIAIPDGVTVEIKPDLVLVKGPKGELTQTVSPEMRISQGEGSSVGETDGGKDLLGTLTVERPTDRGEHRALHGLTRSLIANMVQGVTEGFEKRLEIQGVGYRARLQGKALELNVGYSHPVSVAAPDGIEFEVPTPTQVVVRGIDKQLVGEIAARIRRSRPPEPYKGKGIRYVGEHVRRKVGKRA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
110 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 2.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 0
Rhizoplane 7.41
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100705122 3300006844 Bacteria 1075
2 JGI24034J26672_10000068 3300002239 Bacteria 28347
3 JGI24742J22300_10004044 3300002244 Bacteria 2391
4 JGI26137J50245_101654 3300003396 Unclassified 688
5 Ga0058863_10021271 3300004799 Bacteria 2141
6 Ga0058862_10004297 3300004803 Bacteria 2265
7 Ga0070683_100111442 3300005329 Bacteria 2581
8 Ga0070690_100016764 3300005330 Bacteria 4396
9 Ga0070666_10500901 3300005335 Bacteria 880
10 Ga0070680_101062465 3300005336 Bacteria 700
11 Ga0070682_100000009 3300005337 Bacteria 291635
12 Ga0070688_100225362 3300005365 Bacteria 1323
13 Ga0070714_100025290 3300005435 Bacteria 4897
14 Ga0070711_100100576 3300005439 Bacteria 2103
15 Ga0070708_100289853 3300005445 Bacteria 1541
16 Ga0070678_100635177 3300005456 Bacteria 956
17 Ga0070678_101307711 3300005456 Bacteria 675
18 Ga0070662_100000007 3300005457 Bacteria 168761
19 Ga0070681_10366051 3300005458 Bacteria 1352
20 Ga0070685_10062480 3300005466 Bacteria 2184
21 Ga0070685_10383622 3300005466 Bacteria 969
22 Ga0070685_10608524 3300005466 Bacteria 787
23 Ga0070686_100062792 3300005544 Bacteria 2404
24 Ga0070704_100026298 3300005549 Bacteria 3844
25 Ga0068855_100539950 3300005563 Bacteria 1263
26 Ga0068859_100423253 3300005617 Bacteria 1428
27 Ga0068864_100283143 3300005618 Bacteria 1548
28 Ga0068861_101399998 3300005719 Bacteria 683
29 Ga0068862_100359483 3300005844 Bacteria 1353
30 Ga0081539_10015309 3300005985 Bacteria 5584
31 Ga0070717_10096992 3300006028 Bacteria 2497
32 Ga0075365_10013680 3300006038 Bacteria 4864
33 Ga0075365_10125969 3300006038 Bacteria 1770
34 Ga0075368_10150408 3300006042 Bacteria 972
35 Ga0075363_100013047 3300006048 Bacteria 4017
36 Ga0075363_100091082 3300006048 Bacteria 1678
37 Ga0075364_10025803 3300006051 Bacteria 3744
38 Ga0075364_10095260 3300006051 Bacteria 1979
39 Ga0075364_10766339 3300006051 Bacteria 658
40 Ga0075432_10092848 3300006058 Bacteria 1106
41 Ga0070716_100214313 3300006173 Bacteria 1289
42 Ga0075367_10031691 3300006178 Bacteria 3037
43 Ga0075367_10248314 3300006178 Bacteria 1116
44 Ga0075428_100010646 3300006844 Bacteria 10221
45 Ga0075428_100033220 3300006844 Bacteria 5698
46 Ga0075430_100012417 3300006846 Bacteria 7246
47 Ga0075430_100776407 3300006846 Bacteria 790
48 Ga0075431_100030007 3300006847 Bacteria 5600
49 Ga0075431_100128827 3300006847 Bacteria 2611
50 Ga0075433_10060571 3300006852 Bacteria 3315
51 Ga0075433_10100597 3300006852 Bacteria 2560
52 Ga0075434_100064073 3300006871 Bacteria 3659
53 Ga0068865_100070530 3300006881 Bacteria 2476
54 Ga0075436_100686422 3300006914 Bacteria 758
55 Ga0097620_100423238 3300006931 Bacteria 1428
56 Ga0075435_100008314 3300007076 Bacteria 7436
57 Ga0105240_10028384 3300009093 Bacteria 7310
58 Ga0111539_10015681 3300009094 Bacteria 9419
59 Ga0111539_10534008 3300009094 Bacteria 1366
60 Ga0111539_10641855 3300009094 Bacteria 1236
61 Ga0105245_10015882 3300009098 Bacteria 6559
62 Ga0105245_10413071 3300009098 Bacteria 1351
63 Ga0105247_10050035 3300009101 Bacteria 2571
64 Ga0114129_10117297 3300009147 Bacteria 3668
65 Ga0114129_10210825 3300009147 Bacteria 2626
66 Ga0114129_10439820 3300009147 Bacteria 1712
67 Ga0105241_11212652 3300009174 Bacteria 715
68 Ga0105242_10058287 3300009176 Bacteria 3165
69 Ga0105239_10326878 3300010375 Bacteria 1730
70 Ga0105246_10846364 3300011119 Bacteria 815
71 Ga0157371_10587111 3300013102 Bacteria 828
72 Ga0157378_10087024 3300013297 Bacteria 2833
73 Ga0163162_12054712 3300013306 Bacteria 655
74 Ga0157372_11054933 3300013307 Bacteria 941
75 Ga0157375_11576897 3300013308 Bacteria 776
76 Ga0157380_10249211 3300014326 Bacteria 1606
77 Ga0157379_10411299 3300014968 Bacteria 1245
78 Ga0197907_11121951 3300020069 Bacteria 2803
79 Ga0206354_11413070 3300020081 Bacteria 3576
80 Ga0206353_11279411 3300020082 Bacteria 2449
81 Ga0224712_10011133 3300022467 Bacteria 2777
82 Ga0207710_10026443 3300025900 Bacteria 2508
83 Ga0207688_10023171 3300025901 Bacteria 3399
84 Ga0207688_10594624 3300025901 Bacteria 697
85 Ga0207680_10279271 3300025903 Bacteria 1160
86 Ga0207693_10026245 3300025915 Bacteria 4611
87 Ga0207693_10118425 3300025915 Bacteria 2079
88 Ga0207663_10005211 3300025916 Bacteria 6542
89 Ga0207694_10000008 3300025924 Bacteria 484902
90 Ga0207687_10061572 3300025927 Bacteria 2651
91 Ga0207700_10093587 3300025928 Bacteria 2379
92 Ga0207664_10153700 3300025929 Bacteria 1957
93 Ga0207664_10354951 3300025929 Bacteria 1298
94 Ga0207686_10040728 3300025934 Bacteria 2827
95 Ga0207709_10255778 3300025935 Bacteria 1282
96 Ga0207665_10208228 3300025939 Bacteria 1427
97 Ga0207661_10621368 3300025944 Bacteria 992
98 Ga0207667_10457830 3300025949 Bacteria 1296
99 Ga0207683_10033041 3300026121 Bacteria 4494
100 Ga0207683_10288837 3300026121 Bacteria 1499
101 Ga0209969_1000547 3300027360 Bacteria 5071
102 Ga0209967_1017109 3300027364 Bacteria 1044
103 Ga0209981_1003758 3300027378 Bacteria 1975
104 Ga0209996_1009502 3300027395 Bacteria 1282
105 Ga0209996_1032577 3300027395 Bacteria 760
106 Ga0210000_1012870 3300027462 Bacteria 1246
107 Ga0209968_1025816 3300027526 Bacteria 969
108 Ga0209999_1014199 3300027543 Bacteria 1446
109 Ga0209970_1029843 3300027614 Bacteria 945
110 Ga0209971_1000807 3300027682 Bacteria 8071
111 Ga0209974_10025772 3300027876 Bacteria 1946
112 Ga0207428_10456564 3300027907 Bacteria 931
113 Ga0268265_10362660 3300028380 Bacteria 1327
114 Ga0265337_1000032 3300028556 Bacteria 61342
115 Ga0265326_10000040 3300028558 Bacteria 85624
116 Ga0265318_10086803 3300028577 Bacteria 1153
117 Ga0265322_10000012 3300028654 Bacteria 152373
118 Ga0265338_10009193 3300028800 Bacteria 11839
119 Ga0265338_10131113 3300028800 Bacteria 1979
120 Ga0265324_10017099 3300029957 Bacteria 2638
121 Ga0265332_10020220 3300031238 Bacteria 2939
122 Ga0265328_10002899 3300031239 Bacteria 7647
123 Ga0265320_10000001 3300031240 Bacteria 847191
124 Ga0265329_10000919 3300031242 Bacteria 14805
125 Ga0265340_10040021 3300031247 Bacteria 2310
126 Ga0265331_10001467 3300031250 Bacteria 17360
127 Ga0265327_10000003 3300031251 Bacteria 852750
128 Ga0265316_10144167 3300031344 Bacteria 1787
129 Ga0316575_10003983 3300031665 Bacteria 5170
130 Ga0316579_10000952 3300031691 Bacteria 10118
131 Ga0265314_10000178 3300031711 Bacteria 94070
132 Ga0316578_10168194 3300031728 Bacteria 1321
133 Ga0316583_10002208 3300032133 Bacteria 6709
134 Ga0316583_10007463 3300032133 Bacteria 3936
135 Ga0316593_10000192 3300032168 Bacteria 9387
136 Ga0316593_10036532 3300032168 Bacteria 1620
137 Ga0316588_1003102 3300033528 Bacteria 2985
138 Ga0316582_0002553 3300036647 Bacteria 8612
139 Ga0395899_0005268 3300037312 Bacteria 10047
140 Ga0395899_0038477 3300037312 Bacteria 3582
141 Ga0395899_0172191 3300037312 Bacteria 1524
142 Ga0395900_0026501 3300037418 Bacteria 5935
143 Ga0395900_0053661 3300037418 Bacteria 4148
144 Ga0395900_0413168 3300037418 Bacteria 1311
145 Ga0395898_0009239 3300037466 Bacteria 10370
146 Ga0395898_0011468 3300037466 Bacteria 9204
147 Ga0395898_0255428 3300037466 Bacteria 1671
148 Ga0395898_0433782 3300037466 Bacteria 1252
149 Ga0395898_0560506 3300037466 Bacteria 1085
150 Ga0395905_0009415 3300037471 Bacteria 9550
151 Ga0395905_0221098 3300037471 Bacteria 1772
152 Ga0395905_0225550 3300037471 Bacteria 1753
153 Ga0395905_0379632 3300037471 Bacteria 1307
154 Ga0316581_0001079 3300037588 Bacteria 5893
155 Ga0395901_0001204 3300038443 Bacteria 27493
156 Ga0395901_0011288 3300038443 Bacteria 9050
157 Ga0395901_0019973 3300038443 Bacteria 6854
158 Ga0395901_0124285 3300038443 Bacteria 2711
159 Ga0395901_0769407 3300038443 Bacteria 954
160 Ga0400489_83611 3300039093 Bacteria 2906
161 Ga0436363_0859249 3300039450 Bacteria 1513
162 Ga0436362_0927205 3300039453 Bacteria 796
163 Ga0451577_0000814 3300042876 Bacteria 46993
164 Ga0451577_0007199 3300042876 Bacteria 10963
165 Ga0453684_0001720 3300044712 Bacteria 58676
166 Ga0453684_0017333 3300044712 Bacteria 11163
167 Ga0453684_0036565 3300044712 Bacteria 6766
168 Ga0453684_0133170 3300044712 Bacteria 2980
169 Ga0451576_1018272 3300045051 Bacteria 868
170 Ga0466967_0039082 3300045976 Bacteria 4076
171 Ga0495592_0050759 3300046454 Bacteria 3082
172 Ga0495603_0495371 3300046455 Bacteria 700
173 Ga0495653_0390359 3300046463 Bacteria 887
174 Ga0495580_0806612 3300046472 Bacteria 608
175 Ga0495582_0050938 3300046473 Bacteria 2283
176 Ga0495582_0190879 3300046473 Bacteria 1169
177 Ga0495662_0060668 3300046476 Bacteria 1826
178 Ga0495630_0031418 3300046517 Bacteria 3954
179 Ga0495652_0514868 3300046529 Bacteria 828
180 Ga0495640_0326175 3300046533 Bacteria 950
181 Ga0495586_0021677 3300046535 Bacteria 3427
182 Ga0495645_0013177 3300046543 Bacteria 5845
183 Ga0495667_0000067 3300046559 Bacteria 81751
184 Ga0495634_0000021 3300046642 Bacteria 120521
185 Ga0495588_0244170 3300046674 Bacteria 947
186 Ga0495599_0158868 3300046678 Bacteria 1398
187 Ga0495658_0015478 3300046683 Bacteria 3913
188 Ga0495658_0054569 3300046683 Bacteria 2274
189 Ga0495613_0265726 3300046689 Bacteria 1194
190 Ga0495613_0308287 3300046689 Bacteria 1095
191 Ga0495624_0067638 3300046690 Bacteria 2228
192 Ga0495671_0097374 3300046692 Bacteria 1439
193 Ga0495674_0052946 3300047319 Bacteria 3570
194 Ga0495676_0099369 3300047321 Bacteria 2157
195 Ga0495680_0009089 3300047322 Bacteria 8968
196 Ga0495680_0251098 3300047322 Bacteria 1254
197 Ga0495614_0074547 3300048089 Bacteria 1466
198 Ga0496100_0122773 3300048903 Bacteria 1819
199 Ga0496100_0160207 3300048903 Bacteria 1613
200 Ga0496101_0473040 3300048904 Bacteria 989
201 Ga0496102_0040338 3300048905 Bacteria 4222
202 Ga0496103_0209674 3300048906 Bacteria 1253
203 Ga0496103_0348978 3300048906 Bacteria 951
204 Ga0496104_0001101 3300048907 Bacteria 23115
205 Ga0496104_0529935 3300048907 Bacteria 1089
206 Ga0496104_1570148 3300048907 Bacteria 561
207 Ga0496105_0000654 3300048908 Bacteria 23208
208 Ga0496105_0092030 3300048908 Bacteria 2504
209 Ga0496105_0102423 3300048908 Bacteria 2364
210 Ga0496105_0201638 3300048908 Bacteria 1624
211 Ga0496106_0001451 3300048909 Bacteria 17805
212 Ga0496107_0007562 3300048910 Bacteria 7494
213 Ga0496108_0029525 3300048911 Bacteria 4541
214 Ga0496109_0595064 3300048912 Bacteria 1042
215 Ga0496109_0873699 3300048912 Bacteria 837
216 Ga0496110_0032342 3300048913 Bacteria 4516
217 Ga0496111_0501290 3300048914 Bacteria 894
218 Ga0496112_0129231 3300048915 Bacteria 2497
219 Ga0496112_1348700 3300048915 Bacteria 628
220 Ga0496113_0043533 3300048916 Bacteria 3323
221 Ga0496114_0002329 3300048917 Bacteria 14462
222 Ga0496114_0450192 3300048917 Bacteria 1140
223 Ga0496115_0000552 3300048918 Bacteria 29009
224 Ga0496116_0000529 3300048919 Bacteria 51417
225 Ga0496118_0032830 3300048921 Bacteria 4268
226 Ga0496119_0003596 3300048922 Bacteria 15948
227 Ga0496121_0002121 3300048924 Bacteria 31165
228 Ga0496126_0051712 3300048929 Bacteria 3738
229 Ga0501031_0001256 3300049568 Bacteria 15526
230 Ga0501031_0144075 3300049568 Bacteria 1557
231 Ga0501031_0182537 3300049568 Bacteria 1371
232 Ga0501032_0008331 3300049569 Bacteria 7554
233 Ga0501033_0002178 3300049570 Bacteria 16914
234 Ga0501033_0004532 3300049570 Bacteria 11123
235 Ga0501034_0010161 3300049571 Bacteria 9819
236 Ga0501034_0041744 3300049571 Bacteria 4641
237 Ga0501036_0001191 3300049572 Bacteria 19824
238 Ga0501036_0248369 3300049572 Bacteria 1491
239 Ga0501036_0569692 3300049572 Bacteria 940
240 Ga0501037_0003295 3300049573 Bacteria 11730
241 Ga0501037_0005647 3300049573 Bacteria 9114
242 Ga0501038_0004500 3300049574 Bacteria 12962
243 Ga0501038_0005917 3300049574 Bacteria 11307
244 Ga0501038_0394346 3300049574 Bacteria 1072
245 Ga0501038_0768927 3300049574 Bacteria 718
246 Ga0501039_0010315 3300049575 Bacteria 7126
247 Ga0501039_0030233 3300049575 Bacteria 4176
248 Ga0501039_0073603 3300049575 Bacteria 2654
249 Ga0501039_0110120 3300049575 Bacteria 2153
250 Ga0501039_0587946 3300049575 Bacteria 873
251 Ga0501039_0630091 3300049575 Bacteria 840
252 Ga0501039_0916850 3300049575 Bacteria 682
253 Ga0501040_0032136 3300049576 Bacteria 3551
254 Ga0501040_0098066 3300049576 Bacteria 2042
255 Ga0501040_0161946 3300049576 Bacteria 1582
256 Ga0501040_0574229 3300049576 Bacteria 814
257 Ga0501040_1234721 3300049576 Bacteria 542
258 Ga0501041_0299461 3300049577 Bacteria 1013
259 Ga0501042_0034012 3300049578 Bacteria 3615
260 Ga0501042_0060885 3300049578 Bacteria 2697
261 Ga0501042_0294527 3300049578 Bacteria 1172
262 Ga0501042_0321503 3300049578 Bacteria 1118
263 Ga0501043_0007921 3300049579 Bacteria 8396
264 Ga0501043_0009492 3300049579 Bacteria 7630
265 Ga0501046_0001288 3300049580 Bacteria 24284
266 Ga0501047_0009643 3300049581 Bacteria 9126
267 Ga0501047_0072714 3300049581 Bacteria 3309
268 Ga0501048_0001273 3300049582 Bacteria 19105
269 Ga0501048_0039618 3300049582 Bacteria 3380
270 Ga0501048_0077989 3300049582 Bacteria 2338
271 Ga0501067_0114572 3300049583 Bacteria 1499
272 Ga0501067_0219694 3300049583 Bacteria 1058
273 Ga0501068_0100713 3300049584 Bacteria 1790
274 Ga0501068_0798641 3300049584 Bacteria 619
275 Ga0501069_0032900 3300049585 Bacteria 2854
276 Ga0501070_0000267 3300049586 Bacteria 49167
277 Ga0501070_0035569 3300049586 Bacteria 4161
278 Ga0501070_0789688 3300049586 Bacteria 746
279 Ga0501071_0680369 3300049587 Bacteria 792
280 Ga0501071_0782886 3300049587 Bacteria 735
281 Ga0501073_0005920 3300049589 Bacteria 9129
282 Ga0501073_0008863 3300049589 Bacteria 7436
283 Ga0501073_0476274 3300049589 Bacteria 863
284 Ga0501074_0014241 3300049590 Bacteria 5783
285 Ga0501074_0018349 3300049590 Bacteria 5081
286 Ga0501074_0068207 3300049590 Bacteria 2557
287 Ga0501074_0135512 3300049590 Bacteria 1761
288 Ga0501075_0027042 3300049591 Bacteria 4227
289 Ga0501076_0061204 3300049592 Bacteria 2996
290 Ga0501077_0004329 3300049593 Bacteria 8601
291 Ga0501077_0038538 3300049593 Bacteria 3043
292 Ga0501077_0041863 3300049593 Bacteria 2915
293 Ga0501079_0116809 3300049741 Bacteria 2074
294 Ga0501079_0124818 3300049741 Bacteria 2002
295 Ga0501079_0187142 3300049741 Bacteria 1616
296 Ga0501079_0309179 3300049741 Bacteria 1237
297 Ga0501079_0430452 3300049741 Bacteria 1036
298 Ga0501080_0011521 3300049742 Bacteria 8096
299 Ga0501080_0026067 3300049742 Bacteria 5430
300 Ga0501080_0028144 3300049742 Bacteria 5226
301 Ga0501081_0008282 3300049743 Bacteria 6747
302 Ga0501083_0000061 3300049744 Bacteria 76744
303 Ga0501083_0002932 3300049744 Bacteria 11809
304 Ga0501035_0000877 3300049822 Bacteria 31897
305 Ga0501035_0093976 3300049822 Bacteria 2637
306 Ga0501044_0001422 3300049823 Bacteria 28073
307 Ga0501044_0206310 3300049823 Bacteria 1921
308 Ga0501045_0011988 3300049824 Bacteria 6094
309 Ga0501045_0049368 3300049824 Bacteria 3068
310 Ga0501045_0053944 3300049824 Bacteria 2938
311 Ga0501045_0181059 3300049824 Bacteria 1570
312 Ga0501045_0282754 3300049824 Bacteria 1235
313 nmdc:mga03n38_25509_c1 3300050490 Bacteria 2429
314 nmdc:mga03n38_290745_c1 3300050490 Bacteria 875
315 nmdc:mga00v17_29201_c1 3300050491 Bacteria 3235
316 nmdc:mga00v17_309197_c1 3300050491 Bacteria 1027
317 nmdc:mga00v17_56812_c1 3300050491 Bacteria 2393
318 nmdc:mga0yw44_19837_c1 3300050492 Bacteria 3716
319 nmdc:mga0yw44_509254_c1 3300050492 Bacteria 817
320 nmdc:mga0yw44_5534_c1 3300050492 Bacteria 4531
321 nmdc:mga05p37_134408_c1 3300050507 Bacteria 3034
322 nmdc:mga05p37_24194_c1 3300050507 Bacteria 7379
323 nmdc:mga05p37_715338_c1 3300050507 Bacteria 1110
324 nmdc:mga0qj67_388036_c1 3300050509 Bacteria 1127
325 nmdc:mga0qj67_673592_c1 3300050509 Bacteria 824
326 nmdc:mga0qj67_9221_c1 3300050509 Bacteria 7331
327 nmdc:mga06r32_24235_c1 3300050510 Bacteria 5628
328 nmdc:mga06r32_707428_c1 3300050510 Bacteria 973
329 nmdc:mga08y16_343468_c1 3300050511 Bacteria 1534
330 nmdc:mga08y16_393229_c1 3300050511 Bacteria 1420
331 nmdc:mga0n895_535929_c1 3300050512 Bacteria 1177
332 nmdc:mga0rr50_456920_c1 3300050513 Bacteria 1083
333 nmdc:mga08x19_931300_c1 3300050514 Bacteria 617
334 nmdc:mga0a205_139366_c1 3300050515 Bacteria 2326
335 nmdc:mga0a205_6812_c1 3300050515 Bacteria 10339
336 Ga0495601_0080715 3300053077 Bacteria 2087
337 Ga0495619_0007307 3300053085 Bacteria 6996
338 Ga0495619_0027481 3300053085 Bacteria 3665
339 Ga0500647_0000104 3300053091 Bacteria 16366
340 Ga0500566_0248268 3300053094 Bacteria 867
341 Ga0500648_000010 3300053097 Bacteria 53408
342 Ga0500595_020404 3300053119 Bacteria 2386
343 Ga0500586_178014 3300053145 Bacteria 711
344 Ga0501084_0008596 3300054114 Bacteria 8442
345 Ga0501084_0038714 3300054114 Bacteria 3987
346 Ga0501084_0251369 3300054114 Bacteria 1492
347 Ga0501082_0067656 3300060353 Bacteria 3076
348 Ga0501082_0157434 3300060353 Bacteria 1973
349 Ga0501082_0489078 3300060353 Bacteria 1075
350 Ga0530510_0015250 3300061734 Bacteria 5427
351 Ga0530510_0139752 3300061734 Bacteria 1784
352 Ga0075428_100705122
353 JGI24034J26672_10000068
354 JGI24742J22300_10004044
355 JGI26137J50245_101654
356 Ga0058863_10021271
357 Ga0058862_10004297
358 Ga0070683_100111442
359 Ga0070690_100016764
360 Ga0070666_10500901
361 Ga0070680_101062465
362 Ga0070682_100000009
363 Ga0070688_100225362
364 Ga0070714_100025290
365 Ga0070711_100100576
366 Ga0070708_100289853
367 Ga0070678_100635177
368 Ga0070678_101307711
369 Ga0070662_100000007
370 Ga0070681_10366051
371 Ga0070685_10062480
372 Ga0070685_10383622
373 Ga0070685_10608524
374 Ga0070686_100062792
375 Ga0070704_100026298
376 Ga0068855_100539950
377 Ga0068859_100423253
378 Ga0068864_100283143
379 Ga0068861_101399998
380 Ga0068862_100359483
381 Ga0081539_10015309
382 Ga0070717_10096992
383 Ga0075365_10013680
384 Ga0075365_10125969
385 Ga0075368_10150408
386 Ga0075363_100013047
387 Ga0075363_100091082
388 Ga0075364_10025803
389 Ga0075364_10095260
390 Ga0075364_10766339
391 Ga0075432_10092848
392 Ga0070716_100214313
393 Ga0075367_10031691
394 Ga0075367_10248314
395 Ga0075428_100010646
396 Ga0075428_100033220
397 Ga0075430_100012417
398 Ga0075430_100776407
399 Ga0075431_100030007
400 Ga0075431_100128827
401 Ga0075433_10060571
402 Ga0075433_10100597
403 Ga0075434_100064073
404 Ga0068865_100070530
405 Ga0075436_100686422
406 Ga0097620_100423238
407 Ga0075435_100008314
408 Ga0105240_10028384
409 Ga0111539_10015681
410 Ga0111539_10534008
411 Ga0111539_10641855
412 Ga0105245_10015882
413 Ga0105245_10413071
414 Ga0105247_10050035
415 Ga0114129_10117297
416 Ga0114129_10210825
417 Ga0114129_10439820
418 Ga0105241_11212652
419 Ga0105242_10058287
420 Ga0105239_10326878
421 Ga0105246_10846364
422 Ga0157371_10587111
423 Ga0157378_10087024
424 Ga0163162_12054712
425 Ga0157372_11054933
426 Ga0157375_11576897
427 Ga0157380_10249211
428 Ga0157379_10411299
429 Ga0197907_11121951
430 Ga0206354_11413070
431 Ga0206353_11279411
432 Ga0224712_10011133
433 Ga0207710_10026443
434 Ga0207688_10023171
435 Ga0207688_10594624
436 Ga0207680_10279271
437 Ga0207693_10026245
438 Ga0207693_10118425
439 Ga0207663_10005211
440 Ga0207694_10000008
441 Ga0207687_10061572
442 Ga0207700_10093587
443 Ga0207664_10153700
444 Ga0207664_10354951
445 Ga0207686_10040728
446 Ga0207709_10255778
447 Ga0207665_10208228
448 Ga0207661_10621368
449 Ga0207667_10457830
450 Ga0207683_10033041
451 Ga0207683_10288837
452 Ga0209969_1000547
453 Ga0209967_1017109
454 Ga0209981_1003758
455 Ga0209996_1009502
456 Ga0209996_1032577
457 Ga0210000_1012870
458 Ga0209968_1025816
459 Ga0209999_1014199
460 Ga0209970_1029843
461 Ga0209971_1000807
462 Ga0209974_10025772
463 Ga0207428_10456564
464 Ga0268265_10362660
465 Ga0265337_1000032
466 Ga0265326_10000040
467 Ga0265318_10086803
468 Ga0265322_10000012
469 Ga0265338_10009193
470 Ga0265338_10131113
471 Ga0265324_10017099
472 Ga0265332_10020220
473 Ga0265328_10002899
474 Ga0265320_10000001
475 Ga0265329_10000919
476 Ga0265340_10040021
477 Ga0265331_10001467
478 Ga0265327_10000003
479 Ga0265316_10144167
480 Ga0316575_10003983
481 Ga0316579_10000952
482 Ga0265314_10000178
483 Ga0316578_10168194
484 Ga0316583_10002208
485 Ga0316583_10007463
486 Ga0316593_10000192
487 Ga0316593_10036532
488 Ga0316588_1003102
489 Ga0316582_0002553
490 Ga0395899_0005268
491 Ga0395899_0038477
492 Ga0395899_0172191
493 Ga0395900_0026501
494 Ga0395900_0053661
495 Ga0395900_0413168
496 Ga0395898_0009239
497 Ga0395898_0011468
498 Ga0395898_0255428
499 Ga0395898_0433782
500 Ga0395898_0560506
501 Ga0395905_0009415
502 Ga0395905_0221098
503 Ga0395905_0225550
504 Ga0395905_0379632
505 Ga0316581_0001079
506 Ga0395901_0001204
507 Ga0395901_0011288
508 Ga0395901_0019973
509 Ga0395901_0124285
510 Ga0395901_0769407
511 Ga0400489_83611
512 Ga0436363_0859249
513 Ga0436362_0927205
514 Ga0451577_0000814
515 Ga0451577_0007199
516 Ga0453684_0001720
517 Ga0453684_0017333
518 Ga0453684_0036565
519 Ga0453684_0133170
520 Ga0451576_1018272
521 Ga0466967_0039082
522 Ga0495592_0050759
523 Ga0495603_0495371
524 Ga0495653_0390359
525 Ga0495580_0806612
526 Ga0495582_0050938
527 Ga0495582_0190879
528 Ga0495662_0060668
529 Ga0495630_0031418
530 Ga0495652_0514868
531 Ga0495640_0326175
532 Ga0495586_0021677
533 Ga0495645_0013177
534 Ga0495667_0000067
535 Ga0495634_0000021
536 Ga0495588_0244170
537 Ga0495599_0158868
538 Ga0495658_0015478
539 Ga0495658_0054569
540 Ga0495613_0265726
541 Ga0495613_0308287
542 Ga0495624_0067638
543 Ga0495671_0097374
544 Ga0495674_0052946
545 Ga0495676_0099369
546 Ga0495680_0009089
547 Ga0495680_0251098
548 Ga0495614_0074547
549 Ga0496100_0122773
550 Ga0496100_0160207
551 Ga0496101_0473040
552 Ga0496102_0040338
553 Ga0496103_0209674
554 Ga0496103_0348978
555 Ga0496104_0001101
556 Ga0496104_0529935
557 Ga0496104_1570148
558 Ga0496105_0000654
559 Ga0496105_0092030
560 Ga0496105_0102423
561 Ga0496105_0201638
562 Ga0496106_0001451
563 Ga0496107_0007562
564 Ga0496108_0029525
565 Ga0496109_0595064
566 Ga0496109_0873699
567 Ga0496110_0032342
568 Ga0496111_0501290
569 Ga0496112_0129231
570 Ga0496112_1348700
571 Ga0496113_0043533
572 Ga0496114_0002329
573 Ga0496114_0450192
574 Ga0496115_0000552
575 Ga0496116_0000529
576 Ga0496118_0032830
577 Ga0496119_0003596
578 Ga0496121_0002121
579 Ga0496126_0051712
580 Ga0501031_0001256
581 Ga0501031_0144075
582 Ga0501031_0182537
583 Ga0501032_0008331
584 Ga0501033_0002178
585 Ga0501033_0004532
586 Ga0501034_0010161
587 Ga0501034_0041744
588 Ga0501036_0001191
589 Ga0501036_0248369
590 Ga0501036_0569692
591 Ga0501037_0003295
592 Ga0501037_0005647
593 Ga0501038_0004500
594 Ga0501038_0005917
595 Ga0501038_0394346
596 Ga0501038_0768927
597 Ga0501039_0010315
598 Ga0501039_0030233
599 Ga0501039_0073603
600 Ga0501039_0110120
601 Ga0501039_0587946
602 Ga0501039_0630091
603 Ga0501039_0916850
604 Ga0501040_0032136
605 Ga0501040_0098066
606 Ga0501040_0161946
607 Ga0501040_0574229
608 Ga0501040_1234721
609 Ga0501041_0299461
610 Ga0501042_0034012
611 Ga0501042_0060885
612 Ga0501042_0294527
613 Ga0501042_0321503
614 Ga0501043_0007921
615 Ga0501043_0009492
616 Ga0501046_0001288
617 Ga0501047_0009643
618 Ga0501047_0072714
619 Ga0501048_0001273
620 Ga0501048_0039618
621 Ga0501048_0077989
622 Ga0501067_0114572
623 Ga0501067_0219694
624 Ga0501068_0100713
625 Ga0501068_0798641
626 Ga0501069_0032900
627 Ga0501070_0000267
628 Ga0501070_0035569
629 Ga0501070_0789688
630 Ga0501071_0680369
631 Ga0501071_0782886
632 Ga0501073_0005920
633 Ga0501073_0008863
634 Ga0501073_0476274
635 Ga0501074_0014241
636 Ga0501074_0018349
637 Ga0501074_0068207
638 Ga0501074_0135512
639 Ga0501075_0027042
640 Ga0501076_0061204
641 Ga0501077_0004329
642 Ga0501077_0038538
643 Ga0501077_0041863
644 Ga0501079_0116809
645 Ga0501079_0124818
646 Ga0501079_0187142
647 Ga0501079_0309179
648 Ga0501079_0430452
649 Ga0501080_0011521
650 Ga0501080_0026067
651 Ga0501080_0028144
652 Ga0501081_0008282
653 Ga0501083_0000061
654 Ga0501083_0002932
655 Ga0501035_0000877
656 Ga0501035_0093976
657 Ga0501044_0001422
658 Ga0501044_0206310
659 Ga0501045_0011988
660 Ga0501045_0049368
661 Ga0501045_0053944
662 Ga0501045_0181059
663 Ga0501045_0282754
664 nmdc:mga03n38_25509_c1
665 nmdc:mga03n38_290745_c1
666 nmdc:mga00v17_29201_c1
667 nmdc:mga00v17_309197_c1
668 nmdc:mga00v17_56812_c1
669 nmdc:mga0yw44_19837_c1
670 nmdc:mga0yw44_509254_c1
671 nmdc:mga0yw44_5534_c1
672 nmdc:mga05p37_134408_c1
673 nmdc:mga05p37_24194_c1
674 nmdc:mga05p37_715338_c1
675 nmdc:mga0qj67_388036_c1
676 nmdc:mga0qj67_673592_c1
677 nmdc:mga0qj67_9221_c1
678 nmdc:mga06r32_24235_c1
679 nmdc:mga06r32_707428_c1
680 nmdc:mga08y16_343468_c1
681 nmdc:mga08y16_393229_c1
682 nmdc:mga0n895_535929_c1
683 nmdc:mga0rr50_456920_c1
684 nmdc:mga08x19_931300_c1
685 nmdc:mga0a205_139366_c1
686 nmdc:mga0a205_6812_c1
687 Ga0495601_0080715
688 Ga0495619_0007307
689 Ga0495619_0027481
690 Ga0500647_0000104
691 Ga0500566_0248268
692 Ga0500648_000010
693 Ga0500595_020404
694 Ga0500586_178014
695 Ga0501084_0008596
696 Ga0501084_0038714
697 Ga0501084_0251369
698 Ga0501082_0067656
699 Ga0501082_0157434
700 Ga0501082_0489078
701 Ga0530510_0015250
702 Ga0530510_0139752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

104

179

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

11

60

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xyw-assembly1.cif.gz_Af structure of the plant mitochondrial ribosome 0.8959 69 166
6xyw-assembly1.cif.gz_Af structure of the plant mitochondrial ribosome 0.8707 69 166
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.8357 60 156
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.7415 60 156
5mbq-assembly1.cif.gz_A ceue (h227a variant) a periplasmic protein from campylobacter jejuni 0.721 14 38
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9713 72 162 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9618 72 157 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.951 72 157 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9469 72 161 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9454 74 166 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A4Q7CIM0-F1-model_v4 50S ribosomal protein L6 1.001 74 150 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A448QXD1-F1-model_v4 deleted 0.9865 71 161
AF-A0A3D0SRG5-F1-model_v4 50S ribosomal protein L6 0.9835 80 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9827 71 157
AF-A0A4Q7CIM0-F1-model_v4 50S ribosomal protein L6 0.9759 74 150 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map