F418525

General Info

Members Datasets Scaffolds Average Seq Length
351 170 702 93

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100639418|Ga0070659_1006394181
Length 108
Sequence LFREASVANARALFDGETTMNGQSDTDPVLRQVLQDVLGLSAERAAALTPDTGLFGHLPELDSMAVAGLLTEIEDRLGIVIDDDEVDGEMLETYGALLAFVRAKRGEA

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
126 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
164 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.99
Nodule 0.57
Rhizoplane 1.14
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100639418 3300005366 Bacteria 917
2 JGI24751J29686_10000313 3300002459 Bacteria 18157
3 Ga0065704_10572956 3300005289 Bacteria 622
4 Ga0065715_10779205 3300005293 Bacteria 618
5 Ga0065707_10611697 3300005295 Bacteria 684
6 Ga0070658_10049063 3300005327 Bacteria 3420
7 Ga0070658_10064391 3300005327 Bacteria 2990
8 Ga0070658_10125794 3300005327 Bacteria 2133
9 Ga0070658_10199226 3300005327 Bacteria 1689
10 Ga0070658_10270227 3300005327 Bacteria 1446
11 Ga0070658_10524334 3300005327 Bacteria 1024
12 Ga0070658_10565769 3300005327 Bacteria 984
13 Ga0070658_10866991 3300005327 Bacteria 785
14 Ga0070683_100159656 3300005329 Bacteria 2138
15 Ga0070690_100229451 3300005330 Bacteria 1305
16 Ga0070666_10028931 3300005335 Bacteria 3640
17 Ga0070666_10168477 3300005335 Bacteria 1533
18 Ga0070680_100009772 3300005336 Bacteria 7385
19 Ga0070680_100278108 3300005336 Bacteria 1418
20 Ga0070682_100443236 3300005337 Bacteria 993
21 Ga0070660_100014850 3300005339 Bacteria 5621
22 Ga0070660_100022793 3300005339 Bacteria 4637
23 Ga0070660_100398445 3300005339 Bacteria 1138
24 Ga0070691_10159836 3300005341 Bacteria 1161
25 Ga0070661_100001414 3300005344 Bacteria 16743
26 Ga0070661_101047200 3300005344 Bacteria 678
27 Ga0070661_101195972 3300005344 Bacteria 636
28 Ga0070661_101251200 3300005344 Bacteria 622
29 Ga0070661_101763739 3300005344 Bacteria 525
30 Ga0070692_10879601 3300005345 Bacteria 618
31 Ga0070668_100039126 3300005347 Bacteria 3627
32 Ga0070668_100224688 3300005347 Bacteria 1550
33 Ga0070669_100000868 3300005353 Bacteria 22009
34 Ga0070669_100068112 3300005353 Bacteria 2627
35 Ga0070669_101117093 3300005353 Bacteria 679
36 Ga0070675_102268572 3300005354 Bacteria 500
37 Ga0070671_100000030 3300005355 Bacteria 112182
38 Ga0070671_101783300 3300005355 Bacteria 547
39 Ga0070674_101704321 3300005356 Bacteria 570
40 Ga0070688_101357513 3300005365 Bacteria 575
41 Ga0070659_100067651 3300005366 Bacteria 2833
42 Ga0070659_100118736 3300005366 Bacteria 2140
43 Ga0070667_100000122 3300005367 Bacteria 99820
44 Ga0070667_100930193 3300005367 Bacteria 810
45 Ga0070714_101672111 3300005435 Bacteria 622
46 Ga0070700_100643997 3300005441 Bacteria 836
47 Ga0070663_100049808 3300005455 Bacteria 2977
48 Ga0070663_100584733 3300005455 Bacteria 937
49 Ga0070663_101887147 3300005455 Bacteria 536
50 Ga0070678_101346253 3300005456 Unclassified 665
51 Ga0070662_100003070 3300005457 Bacteria 10367
52 Ga0070662_100014033 3300005457 Bacteria 5342
53 Ga0070662_100356649 3300005457 Bacteria 1199
54 Ga0070681_10039428 3300005458 Bacteria 4735
55 Ga0070681_10785326 3300005458 Bacteria 869
56 Ga0070681_10863725 3300005458 Bacteria 823
57 Ga0070698_100927166 3300005471 Bacteria 817
58 Ga0070679_100046456 3300005530 Bacteria 4328
59 Ga0070679_100162628 3300005530 Bacteria 2206
60 Ga0070679_100184502 3300005530 Bacteria 2058
61 Ga0070679_100358970 3300005530 Bacteria 1404
62 Ga0070684_100013165 3300005535 Bacteria 6658
63 Ga0068853_100066025 3300005539 Bacteria 3141
64 Ga0068853_100471802 3300005539 Unclassified 1182
65 Ga0070686_100312667 3300005544 Bacteria 1169
66 Ga0070686_101285526 3300005544 Bacteria 610
67 Ga0070693_100452738 3300005547 Bacteria 901
68 Ga0070693_100943237 3300005547 Bacteria 649
69 Ga0070693_101052358 3300005547 Bacteria 618
70 Ga0070665_100134499 3300005548 Bacteria 2474
71 Ga0070665_100167312 3300005548 Bacteria 2200
72 Ga0070665_100167684 3300005548 Bacteria 2198
73 Ga0070704_100540095 3300005549 Bacteria 1017
74 Ga0068855_100033730 3300005563 Bacteria 6107
75 Ga0068855_100140244 3300005563 Bacteria 2756
76 Ga0068855_100391282 3300005563 Bacteria 1525
77 Ga0070664_100056442 3300005564 Bacteria 3337
78 Ga0070664_100084859 3300005564 Bacteria 2734
79 Ga0068857_100060675 3300005577 Bacteria 3359
80 Ga0068857_100372433 3300005577 Bacteria 1325
81 Ga0068857_100530689 3300005577 Bacteria 1107
82 Ga0068854_100000548 3300005578 Bacteria 22657
83 Ga0068854_100033652 3300005578 Bacteria 3574
84 Ga0068854_100456629 3300005578 Bacteria 1068
85 Ga0068854_100689044 3300005578 Bacteria 881
86 Ga0068856_100022865 3300005614 Bacteria 6080
87 Ga0068852_100254710 3300005616 Bacteria 1683
88 Ga0068852_100391684 3300005616 Bacteria 1365
89 Ga0068852_101841030 3300005616 Bacteria 627
90 Ga0068859_100054593 3300005617 Bacteria 4019
91 Ga0068859_100631991 3300005617 Bacteria 1163
92 Ga0068859_101014358 3300005617 Bacteria 912
93 Ga0068859_102128061 3300005617 Bacteria 619
94 Ga0068864_100004628 3300005618 Bacteria 11285
95 Ga0068864_100056847 3300005618 Bacteria 3380
96 Ga0068864_100250953 3300005618 Bacteria 1643
97 Ga0068864_101767955 3300005618 Bacteria 623
98 Ga0068863_100058482 3300005841 Bacteria 3648
99 Ga0068863_100063694 3300005841 Bacteria 3487
100 Ga0068863_100150427 3300005841 Bacteria 2227
101 Ga0068858_100242540 3300005842 Bacteria 1710
102 Ga0068860_100000007 3300005843 Bacteria 429329
103 Ga0068860_100000152 3300005843 Bacteria 112187
104 Ga0068860_100000437 3300005843 Bacteria 52907
105 Ga0068860_100027751 3300005843 Bacteria 5452
106 Ga0068862_100000135 3300005844 Bacteria 85248
107 Ga0068862_100004588 3300005844 Bacteria 11648
108 Ga0068862_100573330 3300005844 Bacteria 1080
109 Ga0081539_10311598 3300005985 Bacteria 672
110 Ga0075370_10081098 3300006353 Bacteria 1865
111 Ga0097620_100054594 3300006931 Bacteria 4019
112 Ga0097620_100631896 3300006931 Bacteria 1163
113 Ga0097620_101014320 3300006931 Bacteria 912
114 Ga0097620_102127116 3300006931 Bacteria 619
115 Ga0079104_1009106 3300006946 Bacteria 3393
116 Ga0079104_1044269 3300006946 Bacteria 1021
117 Ga0105240_12442576 3300009093 Bacteria 541
118 Ga0105247_10088851 3300009101 Bacteria 1959
119 Ga0105241_10774187 3300009174 Bacteria 882
120 Ga0105248_10187261 3300009177 Bacteria 2332
121 Ga0105248_12087700 3300009177 Bacteria 644
122 Ga0105249_10000097 3300009553 Bacteria 120886
123 Ga0105249_11380998 3300009553 Bacteria 776
124 Ga0105249_12949969 3300009553 Bacteria 546
125 Ga0105239_10171377 3300010375 Bacteria 2427
126 Ga0105246_10000471 3300011119 Bacteria 21717
127 Ga0157373_10203007 3300013100 Bacteria 1398
128 Ga0157373_10888002 3300013100 Bacteria 661
129 Ga0157373_11056334 3300013100 Bacteria 608
130 Ga0157373_11135694 3300013100 Bacteria 587
131 Ga0157371_10001205 3300013102 Bacteria 27626
132 Ga0157371_10062052 3300013102 Bacteria 2650
133 Ga0157371_10077718 3300013102 Bacteria 2350
134 Ga0157371_10764127 3300013102 Bacteria 726
135 Ga0157371_10801881 3300013102 Bacteria 710
136 Ga0157370_10012435 3300013104 Bacteria 8824
137 Ga0157370_10124629 3300013104 Bacteria 2405
138 Ga0157370_10486393 3300013104 Bacteria 1134
139 Ga0157370_10591816 3300013104 Bacteria 1016
140 Ga0157369_10001195 3300013105 Bacteria 32360
141 Ga0157369_10754783 3300013105 Bacteria 1001
142 Ga0157374_10241816 3300013296 Bacteria 1775
143 Ga0157372_10056453 3300013307 Bacteria 4387
144 Ga0157372_10092020 3300013307 Bacteria 3449
145 Ga0157372_10824215 3300013307 Bacteria 1077
146 Ga0157372_12467095 3300013307 Bacteria 597
147 Ga0157375_11638965 3300013308 Bacteria 761
148 Ga0157375_12183034 3300013308 Bacteria 659
149 Ga0157380_10364780 3300014326 Bacteria 1357
150 Ga0157380_11306858 3300014326 Bacteria 773
151 Ga0157380_12192349 3300014326 Bacteria 616
152 Ga0157380_12293702 3300014326 Bacteria 604
153 Ga0157379_10289252 3300014968 Bacteria 1492
154 Ga0163161_11179616 3300017792 Bacteria 661
155 Ga0207656_10513491 3300025321 Bacteria 609
156 Ga0207682_10134694 3300025893 Bacteria 1105
157 Ga0207710_10087674 3300025900 Bacteria 1452
158 Ga0207647_10024085 3300025904 Bacteria 4016
159 Ga0207705_10002842 3300025909 Bacteria 13242
160 Ga0207705_10057185 3300025909 Bacteria 2813
161 Ga0207705_10076935 3300025909 Bacteria 2427
162 Ga0207705_10121017 3300025909 Bacteria 1942
163 Ga0207705_10159710 3300025909 Bacteria 1693
164 Ga0207654_10197638 3300025911 Bacteria 1322
165 Ga0207707_10387152 3300025912 Bacteria 1201
166 Ga0207707_10849407 3300025912 Bacteria 758
167 Ga0207707_10900580 3300025912 Bacteria 731
168 Ga0207660_10012462 3300025917 Bacteria 5565
169 Ga0207660_10217887 3300025917 Bacteria 1497
170 Ga0207657_10000104 3300025919 Bacteria 81832
171 Ga0207657_10008267 3300025919 Bacteria 10592
172 Ga0207657_10580951 3300025919 Bacteria 875
173 Ga0207657_11074280 3300025919 Bacteria 616
174 Ga0207657_11497471 3300025919 Bacteria 504
175 Ga0207649_10043571 3300025920 Bacteria 2744
176 Ga0207649_10148429 3300025920 Bacteria 1612
177 Ga0207652_10017734 3300025921 Bacteria 5830
178 Ga0207652_10039611 3300025921 Bacteria 3999
179 Ga0207652_10252274 3300025921 Bacteria 1591
180 Ga0207681_10100265 3300025923 Bacteria 2087
181 Ga0207681_10626682 3300025923 Bacteria 890
182 Ga0207650_10528649 3300025925 Bacteria 987
183 Ga0207659_11429810 3300025926 Bacteria 592
184 Ga0207664_11337207 3300025929 Bacteria 636
185 Ga0207690_10037321 3300025932 Bacteria 3154
186 Ga0207690_10047980 3300025932 Bacteria 2836
187 Ga0207690_10218103 3300025932 Bacteria 1458
188 Ga0207706_10000324 3300025933 Bacteria 51659
189 Ga0207706_10005167 3300025933 Bacteria 12180
190 Ga0207706_10036237 3300025933 Bacteria 4383
191 Ga0207669_11820925 3300025937 Bacteria 520
192 Ga0207691_11160906 3300025940 Bacteria 641
193 Ga0207661_10675701 3300025944 Bacteria 949
194 Ga0207679_10265684 3300025945 Bacteria 1465
195 Ga0207667_10010149 3300025949 Bacteria 11030
196 Ga0207667_10070044 3300025949 Bacteria 3651
197 Ga0207667_10157694 3300025949 Bacteria 2335
198 Ga0207712_10000074 3300025961 Bacteria 120822
199 Ga0207712_10538445 3300025961 Bacteria 1003
200 Ga0207668_10021864 3300025972 Bacteria 4084
201 Ga0207668_10033955 3300025972 Bacteria 3383
202 Ga0207640_10000330 3300025981 Bacteria 31573
203 Ga0207640_10131080 3300025981 Bacteria 1812
204 Ga0207640_10809075 3300025981 Bacteria 812
205 Ga0207658_10000092 3300025986 Bacteria 99965
206 Ga0207658_10083038 3300025986 Bacteria 2461
207 Ga0207703_11669575 3300026035 Bacteria 613
208 Ga0207639_10156627 3300026041 Bacteria 1914
209 Ga0207678_10041538 3300026067 Bacteria 3987
210 Ga0207678_10109196 3300026067 Bacteria 2360
211 Ga0207678_10263640 3300026067 Bacteria 1477
212 Ga0207678_10530484 3300026067 Bacteria 1028
213 Ga0207708_11623417 3300026075 Bacteria 568
214 Ga0207702_10110377 3300026078 Bacteria 2444
215 Ga0207641_10004979 3300026088 Bacteria 11396
216 Ga0207641_10131905 3300026088 Bacteria 2244
217 Ga0207674_10022146 3300026116 Bacteria 6830
218 Ga0207674_10082681 3300026116 Bacteria 3212
219 Ga0207674_10416145 3300026116 Bacteria 1299
220 Ga0207674_10523550 3300026116 Bacteria 1145
221 Ga0207683_11284530 3300026121 Unclassified 678
222 Ga0207698_10190037 3300026142 Bacteria 1828
223 Ga0207698_10295750 3300026142 Bacteria 1505
224 Ga0207698_10409570 3300026142 Bacteria 1298
225 Ga0207698_10755139 3300026142 Bacteria 972
226 Ga0209983_1086236 3300027665 Bacteria 706
227 Ga0209974_10159324 3300027876 Bacteria 818
228 Ga0268266_10011913 3300028379 Bacteria 7532
229 Ga0268266_11059205 3300028379 Bacteria 785
230 Ga0268265_10000152 3300028380 Bacteria 85229
231 Ga0268265_10010654 3300028380 Bacteria 6209
232 Ga0268264_10000077 3300028381 Bacteria 252597
233 Ga0268264_10000111 3300028381 Bacteria 204718
234 Ga0268264_10001728 3300028381 Bacteria 20077
235 Ga0307408_100079847 3300031548 Bacteria 2442
236 Ga0307408_100201773 3300031548 Bacteria 1610
237 Ga0307408_100876999 3300031548 Bacteria 820
238 Ga0307408_102401286 3300031548 Bacteria 512
239 Ga0307405_10103863 3300031731 Bacteria 1911
240 Ga0307405_10685589 3300031731 Bacteria 847
241 Ga0307405_11401641 3300031731 Bacteria 611
242 Ga0307405_11419950 3300031731 Bacteria 607
243 Ga0307405_11670123 3300031731 Bacteria 564
244 Ga0307405_12002956 3300031731 Bacteria 518
245 Ga0307413_10164593 3300031824 Bacteria 1562
246 Ga0307413_11826823 3300031824 Bacteria 544
247 Ga0307410_10450192 3300031852 Bacteria 1050
248 Ga0307410_10704923 3300031852 Bacteria 851
249 Ga0307406_10096126 3300031901 Bacteria 2006
250 Ga0307406_10343307 3300031901 Bacteria 1164
251 Ga0307406_10719487 3300031901 Bacteria 835
252 Ga0307406_10907029 3300031901 Bacteria 751
253 Ga0307406_11306163 3300031901 Bacteria 633
254 Ga0307407_10051652 3300031903 Bacteria 2357
255 Ga0307407_10188068 3300031903 Bacteria 1374
256 Ga0307407_10584454 3300031903 Bacteria 830
257 Ga0307407_11025454 3300031903 Bacteria 638
258 Ga0307412_10298076 3300031911 Bacteria 1273
259 Ga0307412_10351907 3300031911 Bacteria 1183
260 Ga0307412_10410339 3300031911 Bacteria 1105
261 Ga0307412_11154750 3300031911 Bacteria 691
262 Ga0307412_11157940 3300031911 Bacteria 691
263 Ga0307412_12222191 3300031911 Bacteria 511
264 Ga0307409_100474477 3300031995 Bacteria 1212
265 Ga0307409_102386248 3300031995 Bacteria 558
266 Ga0307416_100221083 3300032002 Bacteria 1816
267 Ga0307416_100241892 3300032002 Bacteria 1749
268 Ga0307416_100539315 3300032002 Bacteria 1238
269 Ga0307416_100595236 3300032002 Bacteria 1185
270 Ga0307416_101214995 3300032002 Bacteria 859
271 Ga0307416_102085025 3300032002 Bacteria 669
272 Ga0307416_102255306 3300032002 Bacteria 645
273 Ga0307416_102400742 3300032002 Bacteria 627
274 Ga0307414_10105211 3300032004 Bacteria 2133
275 Ga0307414_10217067 3300032004 Bacteria 1567
276 Ga0307414_10218765 3300032004 Bacteria 1562
277 Ga0307414_10311308 3300032004 Bacteria 1336
278 Ga0307414_10499183 3300032004 Bacteria 1076
279 Ga0307414_10581284 3300032004 Bacteria 1002
280 Ga0307414_10602643 3300032004 Bacteria 985
281 Ga0307414_11606452 3300032004 Bacteria 606
282 Ga0307411_10334588 3300032005 Bacteria 1228
283 Ga0307411_10513111 3300032005 Bacteria 1016
284 Ga0307411_10918893 3300032005 Bacteria 779
285 Ga0307415_100121230 3300032126 Bacteria 1961
286 Ga0307415_100860106 3300032126 Bacteria 833
287 Ga0307415_100903869 3300032126 Bacteria 814
288 Ga0307415_101224074 3300032126 Bacteria 708
289 Ga0307415_101396053 3300032126 Bacteria 667
290 Ga0307415_101701051 3300032126 Bacteria 608
291 Ga0307415_101901768 3300032126 Bacteria 578
292 Ga0373955_0472784 3300035172 Bacteria 765
293 Ga0316582_0138751 3300036647 Bacteria 1638
294 Ga0395901_0238009 3300038443 Bacteria 1899
295 Ga0237819_00126 3300038705 Bacteria 28785
296 Ga0237816_03483 3300039145 Bacteria 1152
297 Ga0436362_0212947 3300039453 Bacteria 574
298 Ga0451800_0870467 3300041459 Bacteria 663
299 Ga0451853_1707690 3300041512 Bacteria 714
300 Ga0439448_0273925 3300042005 Bacteria 598
301 Ga0439462_0000816 3300042015 Bacteria 6502
302 Ga0450908_043809 3300042184 Bacteria 776
303 Ga0439435_0147622 3300042436 Bacteria 753
304 Ga0453684_2073536 3300044712 Bacteria 571
305 Ga0495638_0045634 3300046460 Bacteria 2756
306 Ga0495639_0586194 3300046475 Bacteria 573
307 Ga0495643_0076037 3300046522 Bacteria 1756
308 Ga0495643_0173538 3300046522 Bacteria 1052
309 Ga0495598_0023487 3300046537 Bacteria 1661
310 Ga0495621_0430970 3300046539 Bacteria 562
311 Ga0495673_0023960 3300047469 Bacteria 2959
312 Ga0495686_0000302 3300047472 Bacteria 84826
313 Ga0496101_1524477 3300048904 Bacteria 520
314 Ga0496105_1161490 3300048908 Bacteria 570
315 Ga0496114_0006528 3300048917 Bacteria 9192
316 Ga0496119_0026293 3300048922 Bacteria 4039
317 Ga0496123_0432752 3300048926 Bacteria 590
318 Ga0496126_0432378 3300048929 Bacteria 1062
319 Ga0496126_0755961 3300048929 Bacteria 750
320 Ga0501032_0482283 3300049569 Bacteria 793
321 Ga0501033_1103568 3300049570 Bacteria 528
322 Ga0501034_0128906 3300049571 Bacteria 2513
323 Ga0501036_0122827 3300049572 Bacteria 2193
324 Ga0501037_0268585 3300049573 Unclassified 1191
325 Ga0501042_0915847 3300049578 Bacteria 639
326 Ga0501047_0986133 3300049581 Bacteria 656
327 Ga0501070_0505092 3300049586 Bacteria 971
328 Ga0501267_008892 3300049764 Bacteria 996
329 Ga0501035_0705808 3300049822 Bacteria 813
330 Ga0501035_0801637 3300049822 Bacteria 752
331 Ga0501035_1474519 3300049822 Bacteria 519
332 Ga0501044_0148183 3300049823 Bacteria 2330
333 Ga0501044_0210367 3300049823 Bacteria 1899
334 Ga0501044_0495319 3300049823 Bacteria 1124
335 Ga0501044_0656516 3300049823 Bacteria 937
336 Ga0501044_0679617 3300049823 Unclassified 916
337 Ga0501044_1508918 3300049823 Bacteria 537
338 nmdc:mga07m45_358168_c1 3300050496 Bacteria 848
339 Ga0500643_000004 3300053087 Bacteria 857484
340 Ga0500643_010777 3300053087 Bacteria 3380
341 Ga0500562_082615 3300053108 Bacteria 870
342 Ga0500573_0265356 3300053140 Bacteria 877
343 Ga0500588_0005574 3300053146 Bacteria 2804
344 Ga0500604_0066113 3300053151 Bacteria 1145
345 Ga0500604_0358172 3300053151 Bacteria 507
346 Ga0500616_0010997 3300053153 Bacteria 5386
347 Ga0500622_0459175 3300053156 Bacteria 506
348 Ga0500624_000043 3300053157 Bacteria 90095
349 Ga0500627_0089584 3300053158 Bacteria 1377
350 Ga0500637_0000048 3300053178 Bacteria 43470
351 2896184693 2896184354 Bacteria 3258548
352 Ga0070659_100639418
353 JGI24751J29686_10000313
354 Ga0065704_10572956
355 Ga0065715_10779205
356 Ga0065707_10611697
357 Ga0070658_10049063
358 Ga0070658_10064391
359 Ga0070658_10125794
360 Ga0070658_10199226
361 Ga0070658_10270227
362 Ga0070658_10524334
363 Ga0070658_10565769
364 Ga0070658_10866991
365 Ga0070683_100159656
366 Ga0070690_100229451
367 Ga0070666_10028931
368 Ga0070666_10168477
369 Ga0070680_100009772
370 Ga0070680_100278108
371 Ga0070682_100443236
372 Ga0070660_100014850
373 Ga0070660_100022793
374 Ga0070660_100398445
375 Ga0070691_10159836
376 Ga0070661_100001414
377 Ga0070661_101047200
378 Ga0070661_101195972
379 Ga0070661_101251200
380 Ga0070661_101763739
381 Ga0070692_10879601
382 Ga0070668_100039126
383 Ga0070668_100224688
384 Ga0070669_100000868
385 Ga0070669_100068112
386 Ga0070669_101117093
387 Ga0070675_102268572
388 Ga0070671_100000030
389 Ga0070671_101783300
390 Ga0070674_101704321
391 Ga0070688_101357513
392 Ga0070659_100067651
393 Ga0070659_100118736
394 Ga0070667_100000122
395 Ga0070667_100930193
396 Ga0070714_101672111
397 Ga0070700_100643997
398 Ga0070663_100049808
399 Ga0070663_100584733
400 Ga0070663_101887147
401 Ga0070678_101346253
402 Ga0070662_100003070
403 Ga0070662_100014033
404 Ga0070662_100356649
405 Ga0070681_10039428
406 Ga0070681_10785326
407 Ga0070681_10863725
408 Ga0070698_100927166
409 Ga0070679_100046456
410 Ga0070679_100162628
411 Ga0070679_100184502
412 Ga0070679_100358970
413 Ga0070684_100013165
414 Ga0068853_100066025
415 Ga0068853_100471802
416 Ga0070686_100312667
417 Ga0070686_101285526
418 Ga0070693_100452738
419 Ga0070693_100943237
420 Ga0070693_101052358
421 Ga0070665_100134499
422 Ga0070665_100167312
423 Ga0070665_100167684
424 Ga0070704_100540095
425 Ga0068855_100033730
426 Ga0068855_100140244
427 Ga0068855_100391282
428 Ga0070664_100056442
429 Ga0070664_100084859
430 Ga0068857_100060675
431 Ga0068857_100372433
432 Ga0068857_100530689
433 Ga0068854_100000548
434 Ga0068854_100033652
435 Ga0068854_100456629
436 Ga0068854_100689044
437 Ga0068856_100022865
438 Ga0068852_100254710
439 Ga0068852_100391684
440 Ga0068852_101841030
441 Ga0068859_100054593
442 Ga0068859_100631991
443 Ga0068859_101014358
444 Ga0068859_102128061
445 Ga0068864_100004628
446 Ga0068864_100056847
447 Ga0068864_100250953
448 Ga0068864_101767955
449 Ga0068863_100058482
450 Ga0068863_100063694
451 Ga0068863_100150427
452 Ga0068858_100242540
453 Ga0068860_100000007
454 Ga0068860_100000152
455 Ga0068860_100000437
456 Ga0068860_100027751
457 Ga0068862_100000135
458 Ga0068862_100004588
459 Ga0068862_100573330
460 Ga0081539_10311598
461 Ga0075370_10081098
462 Ga0097620_100054594
463 Ga0097620_100631896
464 Ga0097620_101014320
465 Ga0097620_102127116
466 Ga0079104_1009106
467 Ga0079104_1044269
468 Ga0105240_12442576
469 Ga0105247_10088851
470 Ga0105241_10774187
471 Ga0105248_10187261
472 Ga0105248_12087700
473 Ga0105249_10000097
474 Ga0105249_11380998
475 Ga0105249_12949969
476 Ga0105239_10171377
477 Ga0105246_10000471
478 Ga0157373_10203007
479 Ga0157373_10888002
480 Ga0157373_11056334
481 Ga0157373_11135694
482 Ga0157371_10001205
483 Ga0157371_10062052
484 Ga0157371_10077718
485 Ga0157371_10764127
486 Ga0157371_10801881
487 Ga0157370_10012435
488 Ga0157370_10124629
489 Ga0157370_10486393
490 Ga0157370_10591816
491 Ga0157369_10001195
492 Ga0157369_10754783
493 Ga0157374_10241816
494 Ga0157372_10056453
495 Ga0157372_10092020
496 Ga0157372_10824215
497 Ga0157372_12467095
498 Ga0157375_11638965
499 Ga0157375_12183034
500 Ga0157380_10364780
501 Ga0157380_11306858
502 Ga0157380_12192349
503 Ga0157380_12293702
504 Ga0157379_10289252
505 Ga0163161_11179616
506 Ga0207656_10513491
507 Ga0207682_10134694
508 Ga0207710_10087674
509 Ga0207647_10024085
510 Ga0207705_10002842
511 Ga0207705_10057185
512 Ga0207705_10076935
513 Ga0207705_10121017
514 Ga0207705_10159710
515 Ga0207654_10197638
516 Ga0207707_10387152
517 Ga0207707_10849407
518 Ga0207707_10900580
519 Ga0207660_10012462
520 Ga0207660_10217887
521 Ga0207657_10000104
522 Ga0207657_10008267
523 Ga0207657_10580951
524 Ga0207657_11074280
525 Ga0207657_11497471
526 Ga0207649_10043571
527 Ga0207649_10148429
528 Ga0207652_10017734
529 Ga0207652_10039611
530 Ga0207652_10252274
531 Ga0207681_10100265
532 Ga0207681_10626682
533 Ga0207650_10528649
534 Ga0207659_11429810
535 Ga0207664_11337207
536 Ga0207690_10037321
537 Ga0207690_10047980
538 Ga0207690_10218103
539 Ga0207706_10000324
540 Ga0207706_10005167
541 Ga0207706_10036237
542 Ga0207669_11820925
543 Ga0207691_11160906
544 Ga0207661_10675701
545 Ga0207679_10265684
546 Ga0207667_10010149
547 Ga0207667_10070044
548 Ga0207667_10157694
549 Ga0207712_10000074
550 Ga0207712_10538445
551 Ga0207668_10021864
552 Ga0207668_10033955
553 Ga0207640_10000330
554 Ga0207640_10131080
555 Ga0207640_10809075
556 Ga0207658_10000092
557 Ga0207658_10083038
558 Ga0207703_11669575
559 Ga0207639_10156627
560 Ga0207678_10041538
561 Ga0207678_10109196
562 Ga0207678_10263640
563 Ga0207678_10530484
564 Ga0207708_11623417
565 Ga0207702_10110377
566 Ga0207641_10004979
567 Ga0207641_10131905
568 Ga0207674_10022146
569 Ga0207674_10082681
570 Ga0207674_10416145
571 Ga0207674_10523550
572 Ga0207683_11284530
573 Ga0207698_10190037
574 Ga0207698_10295750
575 Ga0207698_10409570
576 Ga0207698_10755139
577 Ga0209983_1086236
578 Ga0209974_10159324
579 Ga0268266_10011913
580 Ga0268266_11059205
581 Ga0268265_10000152
582 Ga0268265_10010654
583 Ga0268264_10000077
584 Ga0268264_10000111
585 Ga0268264_10001728
586 Ga0307408_100079847
587 Ga0307408_100201773
588 Ga0307408_100876999
589 Ga0307408_102401286
590 Ga0307405_10103863
591 Ga0307405_10685589
592 Ga0307405_11401641
593 Ga0307405_11419950
594 Ga0307405_11670123
595 Ga0307405_12002956
596 Ga0307413_10164593
597 Ga0307413_11826823
598 Ga0307410_10450192
599 Ga0307410_10704923
600 Ga0307406_10096126
601 Ga0307406_10343307
602 Ga0307406_10719487
603 Ga0307406_10907029
604 Ga0307406_11306163
605 Ga0307407_10051652
606 Ga0307407_10188068
607 Ga0307407_10584454
608 Ga0307407_11025454
609 Ga0307412_10298076
610 Ga0307412_10351907
611 Ga0307412_10410339
612 Ga0307412_11154750
613 Ga0307412_11157940
614 Ga0307412_12222191
615 Ga0307409_100474477
616 Ga0307409_102386248
617 Ga0307416_100221083
618 Ga0307416_100241892
619 Ga0307416_100539315
620 Ga0307416_100595236
621 Ga0307416_101214995
622 Ga0307416_102085025
623 Ga0307416_102255306
624 Ga0307416_102400742
625 Ga0307414_10105211
626 Ga0307414_10217067
627 Ga0307414_10218765
628 Ga0307414_10311308
629 Ga0307414_10499183
630 Ga0307414_10581284
631 Ga0307414_10602643
632 Ga0307414_11606452
633 Ga0307411_10334588
634 Ga0307411_10513111
635 Ga0307411_10918893
636 Ga0307415_100121230
637 Ga0307415_100860106
638 Ga0307415_100903869
639 Ga0307415_101224074
640 Ga0307415_101396053
641 Ga0307415_101701051
642 Ga0307415_101901768
643 Ga0373955_0472784
644 Ga0316582_0138751
645 Ga0395901_0238009
646 Ga0237819_00126
647 Ga0237816_03483
648 Ga0436362_0212947
649 Ga0451800_0870467
650 Ga0451853_1707690
651 Ga0439448_0273925
652 Ga0439462_0000816
653 Ga0450908_043809
654 Ga0439435_0147622
655 Ga0453684_2073536
656 Ga0495638_0045634
657 Ga0495639_0586194
658 Ga0495643_0076037
659 Ga0495643_0173538
660 Ga0495598_0023487
661 Ga0495621_0430970
662 Ga0495673_0023960
663 Ga0495686_0000302
664 Ga0496101_1524477
665 Ga0496105_1161490
666 Ga0496114_0006528
667 Ga0496119_0026293
668 Ga0496123_0432752
669 Ga0496126_0432378
670 Ga0496126_0755961
671 Ga0501032_0482283
672 Ga0501033_1103568
673 Ga0501034_0128906
674 Ga0501036_0122827
675 Ga0501037_0268585
676 Ga0501042_0915847
677 Ga0501047_0986133
678 Ga0501070_0505092
679 Ga0501267_008892
680 Ga0501035_0705808
681 Ga0501035_0801637
682 Ga0501035_1474519
683 Ga0501044_0148183
684 Ga0501044_0210367
685 Ga0501044_0495319
686 Ga0501044_0656516
687 Ga0501044_0679617
688 Ga0501044_1508918
689 nmdc:mga07m45_358168_c1
690 Ga0500643_000004
691 Ga0500643_010777
692 Ga0500562_082615
693 Ga0500573_0265356
694 Ga0500588_0005574
695 Ga0500604_0066113
696 Ga0500604_0358172
697 Ga0500616_0010997
698 Ga0500622_0459175
699 Ga0500624_000043
700 Ga0500627_0089584
701 Ga0500637_0000048
702 2896184693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

28

101

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lki-assembly1.cif.gz_A solution nmr structure of holo acyl carrier protein ne2163 from nitrosomonas europaea. northeast structural genomics consortium target net1. 0.9015 3 85
2lki-assembly1.cif.gz_A solution nmr structure of holo acyl carrier protein ne2163 from nitrosomonas europaea. northeast structural genomics consortium target net1. 0.8817 3 85
7qv0-assembly1.cif.gz_F-2 covalent complex between scalindua brodae amxfabz and amxacp 0.8766 5 87
7r49-assembly1.cif.gz_H crystal structure of the l. plantarum acyl carrier protein synthase (acps)in complex with d-alanyl carrier protein (dltc1) 0.8636 3 84
7qv0-assembly1.cif.gz_D-2 covalent complex between scalindua brodae amxfabz and amxacp 0.8598 1 87
ID Description Score Start End Superfamily
2lkiA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9015 3 85 1.10.1200.10
2lkiA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8817 3 85 1.10.1200.10
2amwA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8809 3 84 1.10.1200.10
2amwA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8523 3 84 1.10.1200.10
4bphA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8421 3 84 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A3M9YSQ4-F1-model_v4 Acyl carrier protein 1 5 85
AF-A0A6I5X0E5-F1-model_v4 Acyl carrier protein 0.9988 4 85
AF-A0A257YJ04-F1-model_v4 Acyl carrier protein 0.9985 4 84
AF-A0A4R6FF41-F1-model_v4 Acyl carrier protein 0.9969 4 83
AF-A0A1W2CNL3-F1-model_v4 Phosphopantetheine attachment site 0.9966 3 85

Map