F418401

General Info

Members Datasets Scaffolds Average Seq Length
350 208 298 363

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0019953|Ga0501038_0019953_4581_5759
Length 392
Sequence VSLWIDDPADLAARLRAAPPRVGLDTEFVRERTWWPKLALVQVALEGGDVLLVDALAPGMNAALAPMLADPAVLKVMHSASEDLVALQHACGVVPAPLFDTQVAAALAGVAAGAGYQRLVQDLLGIALPKGETRSDWLRRPLSAAQLEYAADDVLHLFALHDLLAARLAQAGRDDWLREDAHRTVAAAVDETPEPWPHLAMRSAQFLDAPAQRRLLRLLRWRDAHARRADRPRSWILDNELATALARKPPADRASLQRQLEATPKSPRALGDALWAALETPLPDEADAPLARADDRDKARMRKLQDAVAALSAELGLPDGVLASRRWLQALLDARADGTAAWPGPLAGWRRALLEPRLAPLLEASAAAATPVVAAPGPDAAATAGDVPPASV

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
15 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
18 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
19 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
20 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
21 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
22 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
23 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
24 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
25 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
26 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
27 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
28 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
29 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
30 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
31 2919513703 Luteimonas sp. 3794 Isolate Unclassified
32 2919675420 Luteimonas terrae 4099 Isolate Unclassified
33 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
34 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
35 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
36 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
37 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
38 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
39 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
40 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
43 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
44 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
45 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
46 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
47 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
48 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
122 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
123 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
206 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
207 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
208 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.14
Metatranscriptomes 0
Isolates 14.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 20.29
Nodule 0.29
Rhizoplane 4.29
Rhizosphere 47.14
Stem 0
Stem Tuber 0
Unclassified 27.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000074 3300002773 Bacteria 66463
2 JGI25150J39212_1000056 3300002774 Bacteria 66462
3 JGI25151J46595_10000032 3300003187 Bacteria 195408
4 JGI25151J46595_10000178 3300003187 Bacteria 80734
5 JGI25151J46595_10011087 3300003187 Bacteria 4157
6 JGI25153J46596_10000131 3300003215 Bacteria 80734
7 rootH2_10002263 3300003320 Bacteria 5621
8 rootH1_10193337 3300003323 Bacteria 5510
9 Ga0055526_1000038 3300003771 Bacteria 131858
10 Ga0055526_1031123 3300003771 Bacteria 1538
11 Ga0055537_1000057 3300003773 Bacteria 81507
12 Ga0055537_1002160 3300003773 Bacteria 6864
13 Ga0055524_1000066 3300003775 Bacteria 131691
14 Ga0055524_1011635 3300003775 Bacteria 3427
15 Ga0055536_1001310 3300003781 Bacteria 15287
16 Ga0055536_1009531 3300003781 Bacteria 4001
17 Ga0055536_1029249 3300003781 Bacteria 1484
18 Ga0055534_1000082 3300003784 Bacteria 75351
19 Ga0055534_1000472 3300003784 Bacteria 22716
20 Ga0055528_1000023 3300003790 Bacteria 131856
21 Ga0055528_1000274 3300003790 Bacteria 43734
22 Ga0055530_10002304 3300003791 Bacteria 12481
23 Ga0055531_10011681 3300003794 Bacteria 4206
24 Ga0055531_10021672 3300003794 Bacteria 2482
25 Ga0058692_1000006 3300003856 Bacteria 398109
26 Ga0058692_1000012 3300003856 Bacteria 318930
27 Ga0065714_10015918 3300005288 Bacteria 1888
28 Ga0065704_10079495 3300005289 Bacteria 4147
29 Ga0070670_100007892 3300005331 Bacteria 9053
30 Ga0070670_100174800 3300005331 Bacteria 1864
31 Ga0070661_100247160 3300005344 Bacteria 1376
32 Ga0070669_100016661 3300005353 Bacteria 5245
33 Ga0070671_100099525 3300005355 Bacteria 2439
34 Ga0070671_100100744 3300005355 Bacteria 2423
35 Ga0070671_100271545 3300005355 Bacteria 1441
36 Ga0070674_100077191 3300005356 Bacteria 2371
37 Ga0070678_100108892 3300005456 Bacteria 2163
38 Ga0070662_100123292 3300005457 Bacteria 1989
39 Ga0070679_100154695 3300005530 Bacteria 2268
40 Ga0070672_100196972 3300005543 Bacteria 1683
41 Ga0070665_100326738 3300005548 Bacteria 1538
42 Ga0068862_100068427 3300005844 Bacteria 3063
43 Ga0081539_10028816 3300005985 Bacteria 3485
44 Ga0075364_10000327 3300006051 Bacteria 23551
45 Ga0075364_10006972 3300006051 Bacteria 6676
46 Ga0105251_10000634 3300009011 Bacteria 32237
47 Ga0105244_10018190 3300009036 Bacteria 3951
48 Ga0105243_10007468 3300009148 Bacteria 8400
49 Ga0105248_10221526 3300009177 Bacteria 2130
50 Ga0105248_10269174 3300009177 Bacteria 1918
51 Ga0157373_10035259 3300013100 Bacteria 3593
52 Ga0157373_10122081 3300013100 Bacteria 1831
53 Ga0157371_10000344 3300013102 Bacteria 59668
54 Ga0157371_10007349 3300013102 Bacteria 8931
55 Ga0157371_10080762 3300013102 Bacteria 2303
56 Ga0157370_10032318 3300013104 Bacteria 5111
57 Ga0157372_10252303 3300013307 Bacteria 2048
58 Ga0182008_10000339 3300014497 Bacteria 36578
59 Ga0182008_10005802 3300014497 Bacteria 6980
60 Ga0182006_1010257 3300015261 Bacteria 4172
61 Ga0182007_10000081 3300015262 Bacteria 73360
62 Ga0182005_1000687 3300015265 Bacteria 15827
63 Ga0183360_10001 3300015689 Bacteria 3943671
64 Ga0163161_10000633 3300017792 Bacteria 28051
65 Ga0163161_10047186 3300017792 Bacteria 3111
66 Ga0207425_1000108 3300025245 Bacteria 77709
67 Ga0209129_1000178 3300025258 Bacteria 92006
68 Ga0209565_1000005 3300025263 Bacteria 947317
69 Ga0209565_1000022 3300025263 Bacteria 390888
70 Ga0209565_1005397 3300025263 Bacteria 3722
71 Ga0209673_1000027 3300025273 Bacteria 360561
72 Ga0209673_1000110 3300025273 Bacteria 181173
73 Ga0209130_1010646 3300025284 Bacteria 2516
74 Ga0209675_1000004 3300025291 Bacteria 947166
75 Ga0209675_1000165 3300025291 Bacteria 81556
76 Ga0209675_1003307 3300025291 Bacteria 7742
77 Ga0209676_1000219 3300025292 Bacteria 125330
78 Ga0209676_1000603 3300025292 Bacteria 53099
79 Ga0209676_1000790 3300025292 Bacteria 41824
80 Ga0209676_1000888 3300025292 Bacteria 38155
81 Ga0209676_1001117 3300025292 Bacteria 29720
82 Ga0209676_1008423 3300025292 Bacteria 4599
83 Ga0209025_1000005 3300025294 Bacteria 1272149
84 Ga0209025_1000012 3300025294 Bacteria 924362
85 Ga0209025_1001283 3300025294 Bacteria 34499
86 Ga0209025_1008798 3300025294 Bacteria 7180
87 Ga0209564_1000050 3300025295 Bacteria 360560
88 Ga0209564_1000541 3300025295 Bacteria 61140
89 Ga0209564_1032307 3300025295 Bacteria 1580
90 Ga0209758_1000018 3300025297 Bacteria 753320
91 Ga0209758_1005507 3300025297 Bacteria 9696
92 Ga0209050_1000578 3300025298 Bacteria 59363
93 Ga0209050_1000850 3300025298 Bacteria 41582
94 Ga0209050_1001491 3300025298 Bacteria 24866
95 Ga0209050_1023100 3300025298 Bacteria 2201
96 Ga0209256_1000031 3300025299 Bacteria 410189
97 Ga0209256_1000889 3300025299 Bacteria 36807
98 Ga0209256_1003460 3300025299 Bacteria 11048
99 Ga0209256_1025835 3300025299 Bacteria 1704
100 Ga0209051_1007631 3300025303 Bacteria 5884
101 Ga0209257_1000255 3300025304 Bacteria 123098
102 Ga0209257_1000263 3300025304 Bacteria 120530
103 Ga0209257_1000283 3300025304 Bacteria 113507
104 Ga0209257_1000839 3300025304 Bacteria 44159
105 Ga0209257_1000879 3300025304 Bacteria 42464
106 Ga0209257_1001220 3300025304 Bacteria 32205
107 Ga0209257_1001545 3300025304 Bacteria 26779
108 Ga0209257_1001810 3300025304 Bacteria 23425
109 Ga0209257_1008532 3300025304 Bacteria 5790
110 Ga0207713_1011391 3300025735 Bacteria 4840
111 Ga0207713_1032500 3300025735 Bacteria 2290
112 Ga0207652_10293266 3300025921 Bacteria 1468
113 Ga0207681_10010569 3300025923 Bacteria 5658
114 Ga0207650_10005410 3300025925 Bacteria 8714
115 Ga0207644_10003431 3300025931 Bacteria 10240
116 Ga0207644_10226249 3300025931 Bacteria 1485
117 Ga0207706_10162187 3300025933 Bacteria 1965
118 Ga0207709_10002504 3300025935 Bacteria 11496
119 Ga0207691_10001954 3300025940 Bacteria 20125
120 Ga0207651_10252485 3300025960 Bacteria 1444
121 Ga0207668_10129769 3300025972 Bacteria 1923
122 Ga0209371_1000007 3300027312 Bacteria 1050654
123 Ga0209371_1000016 3300027312 Bacteria 646301
124 Ga0209983_1002457 3300027665 Bacteria 4057
125 Ga0209974_10009578 3300027876 Bacteria 3289
126 Ga0209974_10011628 3300027876 Bacteria 2954
127 Ga0268265_10052124 3300028380 Bacteria 3093
128 Ga0268256_1000008 3300030500 Bacteria 1050654
129 Ga0268256_1000015 3300030500 Bacteria 646300
130 Ga0316178_1173477 3300030735 Bacteria 1391
131 Ga0316183_1169855 3300030742 Bacteria 3611
132 Ga0307513_10025731 3300031456 Bacteria 6808
133 Ga0307513_10101217 3300031456 Bacteria 2904
134 Ga0307408_100105745 3300031548 Bacteria 2152
135 Ga0307413_10000115 3300031824 Bacteria 20626
136 Ga0307406_10064017 3300031901 Bacteria 2384
137 Ga0307412_10015356 3300031911 Bacteria 4538
138 Ga0307412_10063050 3300031911 Bacteria 2499
139 Ga0307416_100057348 3300032002 Bacteria 3150
140 Ga0307416_100159086 3300032002 Bacteria 2085
141 Ga0307414_10001369 3300032004 Bacteria 12607
142 Ga0307414_10006113 3300032004 Bacteria 6684
143 Ga0307414_10024242 3300032004 Bacteria 3866
144 Ga0307414_10088528 3300032004 Bacteria 2291
145 Ga0307411_10169038 3300032005 Bacteria 1647
146 Ga0307415_100123013 3300032126 Bacteria 1949
147 Ga0395899_0006032 3300037312 Bacteria 9409
148 Ga0395900_0021673 3300037418 Bacteria 6569
149 Ga0395905_0323810 3300037471 Bacteria 1431
150 Ga0395901_0061733 3300038443 Bacteria 3900
151 Ga0237819_00505 3300038705 Bacteria 13123
152 Ga0237819_01766 3300038705 Bacteria 5085
153 Ga0439436_0005959 3300041404 Bacteria 3738
154 Ga0439436_0033083 3300041404 Bacteria 1498
155 Ga0439436_0053242 3300041404 Bacteria 1140
156 Ga0439439_0004166 3300041406 Bacteria 3239
157 Ga0439447_005137 3300041407 Bacteria 4390
158 Ga0439465_0001813 3300041413 Bacteria 6991
159 Ga0439465_0003508 3300041413 Bacteria 5110
160 Ga0439465_0008052 3300041413 Bacteria 3335
161 Ga0451791_0116265 3300041451 Bacteria 1967
162 Ga0451793_0709379 3300041452 Bacteria 4053
163 Ga0451797_0089562 3300041453 Bacteria 4423
164 Ga0451797_1196246 3300041453 Bacteria 1055
165 Ga0451800_1612293 3300041459 Bacteria 1396
166 Ga0451807_0597550 3300041486 Bacteria 1406
167 Ga0451807_0663756 3300041486 Bacteria 1681
168 Ga0439431_0031782 3300041997 Bacteria 1313
169 Ga0439445_0002910 3300042004 Bacteria 3823
170 Ga0439432_028400 3300042006 Bacteria 1821
171 Ga0439449_0000032 3300042007 Bacteria 41302
172 Ga0439449_0004509 3300042007 Bacteria 5380
173 Ga0439449_0015277 3300042007 Bacteria 2884
174 Ga0451577_0002616 3300042876 Bacteria 21112
175 Ga0453684_0123860 3300044712 Bacteria 3115
176 Ga0495627_013258 3300046453 Bacteria 2902
177 Ga0495607_0053623 3300046501 Bacteria 2328
178 Ga0495610_0003727 3300046512 Bacteria 11664
179 Ga0495616_0030782 3300046513 Bacteria 2816
180 Ga0495631_0002482 3300046518 Bacteria 10382
181 Ga0495643_0001083 3300046522 Bacteria 27159
182 Ga0495663_0000897 3300046525 Bacteria 10032
183 Ga0495663_0001909 3300046525 Bacteria 6412
184 Ga0495663_0003414 3300046525 Bacteria 4584
185 Ga0495663_0008069 3300046525 Bacteria 2913
186 Ga0495598_0002823 3300046537 Bacteria 3619
187 Ga0495621_0010652 3300046539 Bacteria 2821
188 Ga0495633_0001984 3300046558 Bacteria 14817
189 Ga0495633_0033047 3300046558 Bacteria 2496
190 Ga0495668_0002733 3300046616 Bacteria 14134
191 Ga0495668_0044695 3300046616 Bacteria 2462
192 Ga0495625_0171495 3300046660 Bacteria 1448
193 Ga0495670_0091034 3300046691 Bacteria 1561
194 Ga0495660_0017660 3300046810 Bacteria 4105
195 Ga0495636_0000111 3300047318 Bacteria 34245
196 Ga0495636_0000237 3300047318 Bacteria 21836
197 Ga0495672_0002120 3300047320 Bacteria 18599
198 Ga0495686_0098157 3300047472 Bacteria 1770
199 Ga0496100_0385739 3300048903 Bacteria 1065
200 Ga0496101_0188026 3300048904 Bacteria 1593
201 Ga0496104_0031563 3300048907 Bacteria 4928
202 Ga0496105_0030633 3300048908 Bacteria 4408
203 Ga0496109_0074392 3300048912 Bacteria 3123
204 Ga0496112_0044225 3300048915 Bacteria 4363
205 Ga0496113_0089043 3300048916 Bacteria 2375
206 Ga0496113_0272980 3300048916 Bacteria 1351
207 Ga0496116_0003621 3300048919 Bacteria 15184
208 Ga0496116_0008289 3300048919 Bacteria 9034
209 Ga0496116_0009243 3300048919 Bacteria 8432
210 Ga0496116_0053212 3300048919 Bacteria 2675
211 Ga0496117_0001015 3300048920 Bacteria 42934
212 Ga0496117_0003364 3300048920 Bacteria 18642
213 Ga0496117_0006501 3300048920 Bacteria 11788
214 Ga0496117_0016756 3300048920 Bacteria 6160
215 Ga0496117_0032472 3300048920 Bacteria 3965
216 Ga0496117_0160744 3300048920 Bacteria 1316
217 Ga0496118_0001060 3300048921 Bacteria 42963
218 Ga0496118_0002044 3300048921 Bacteria 28528
219 Ga0496118_0004869 3300048921 Bacteria 15632
220 Ga0496118_0012271 3300048921 Bacteria 8246
221 Ga0496118_0047523 3300048921 Bacteria 3324
222 Ga0496118_0093486 3300048921 Bacteria 2060
223 Ga0496119_0001961 3300048922 Bacteria 23396
224 Ga0496119_0002881 3300048922 Bacteria 18359
225 Ga0496119_0020138 3300048922 Bacteria 4877
226 Ga0496119_0021439 3300048922 Bacteria 4671
227 Ga0496120_0000618 3300048923 Bacteria 53642
228 Ga0496120_0000870 3300048923 Bacteria 42759
229 Ga0496120_0018440 3300048923 Bacteria 4498
230 Ga0496121_0001093 3300048924 Bacteria 47915
231 Ga0496121_0007181 3300048924 Bacteria 13494
232 Ga0496121_0032477 3300048924 Bacteria 4743
233 Ga0496121_0148778 3300048924 Bacteria 1726
234 Ga0496122_0000468 3300048925 Bacteria 84377
235 Ga0496122_0001135 3300048925 Bacteria 45756
236 Ga0496122_0003191 3300048925 Bacteria 21871
237 Ga0496122_0007823 3300048925 Bacteria 11745
238 Ga0496122_0017772 3300048925 Bacteria 6616
239 Ga0496122_0019678 3300048925 Bacteria 6153
240 Ga0496122_0031265 3300048925 Bacteria 4435
241 Ga0496123_0000226 3300048926 Bacteria 113889
242 Ga0496123_0000497 3300048926 Bacteria 68228
243 Ga0496123_0006156 3300048926 Bacteria 11756
244 Ga0496123_0037105 3300048926 Bacteria 3446
245 Ga0496123_0040122 3300048926 Bacteria 3265
246 Ga0496123_0042754 3300048926 Bacteria 3122
247 Ga0496123_0056072 3300048926 Bacteria 2579
248 Ga0496124_0000009 3300048927 Bacteria 734820
249 Ga0496124_0000785 3300048927 Bacteria 51854
250 Ga0496124_0000930 3300048927 Bacteria 47209
251 Ga0496124_0006244 3300048927 Bacteria 13052
252 Ga0496124_0006459 3300048927 Bacteria 12768
253 Ga0496124_0006913 3300048927 Bacteria 12193
254 Ga0496124_0018185 3300048927 Bacteria 6593
255 Ga0496124_0022490 3300048927 Bacteria 5776
256 Ga0496124_0102181 3300048927 Bacteria 2320
257 Ga0496125_0001212 3300048928 Bacteria 38782
258 Ga0496125_0003758 3300048928 Bacteria 18073
259 Ga0496125_0009225 3300048928 Bacteria 10191
260 Ga0496125_0016250 3300048928 Bacteria 7154
261 Ga0496125_0032606 3300048928 Bacteria 4625
262 Ga0496125_0073257 3300048928 Bacteria 2664
263 Ga0496125_0116811 3300048928 Bacteria 1915
264 Ga0496126_0000352 3300048929 Bacteria 96433
265 Ga0496126_0010871 3300048929 Bacteria 9486
266 Ga0496126_0053638 3300048929 Bacteria 3656
267 Ga0496126_0100709 3300048929 Bacteria 2528
268 Ga0496126_0298017 3300048929 Bacteria 1331
269 Ga0501031_0017425 3300049568 Bacteria 4667
270 Ga0501033_0000715 3300049570 Bacteria 30454
271 Ga0501033_0061360 3300049570 Bacteria 2771
272 Ga0501033_0078302 3300049570 Bacteria 2426
273 Ga0501034_0000261 3300049571 Bacteria 95451
274 Ga0501034_0002420 3300049571 Bacteria 22586
275 Ga0501034_0015386 3300049571 Bacteria 7863
276 Ga0501034_0357795 3300049571 Bacteria 1387
277 Ga0501036_0008361 3300049572 Bacteria 8479
278 Ga0501037_0004462 3300049573 Bacteria 10166
279 Ga0501038_0001502 3300049574 Bacteria 21456
280 Ga0501038_0019953 3300049574 Bacteria 6033
281 Ga0501043_0008896 3300049579 Bacteria 7903
282 Ga0501043_0019479 3300049579 Bacteria 5325
283 Ga0501043_0213851 3300049579 Bacteria 1494
284 Ga0501047_0136196 3300049581 Bacteria 2336
285 Ga0501070_0027428 3300049586 Bacteria 4778
286 Ga0501071_0114487 3300049587 Bacteria 1995
287 Ga0501073_0193229 3300049589 Bacteria 1408
288 Ga0501080_0010549 3300049742 Bacteria 8462
289 Ga0501275_000055 3300049772 Bacteria 11440
290 Ga0501035_0032020 3300049822 Bacteria 4787
291 Ga0501035_0185908 3300049822 Bacteria 1788
292 Ga0501044_0023229 3300049823 Bacteria 6598
293 Ga0501044_0037232 3300049823 Bacteria 5086
294 Ga0501044_0250329 3300049823 Bacteria 1713
295 Ga0501044_0357226 3300049823 Bacteria 1379
296 nmdc:mga00v17_4454_c1 3300050491 Bacteria 7292
297 nmdc:mga00v17_554_c1 3300050491 Bacteria 20868
298 Ga0500634_0000138 3300053161 Bacteria 26502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_1196246 Ga0451797_1196246_121_1032 299
2 3300041404 Ga0439436_0005959 Ga0439436_0005959_15_926 300
3 3300041404 Ga0439436_0053242 Ga0439436_0053242_164_1099 300
4 3300025960 Ga0207651_10252485 Ga0207651_102524852 313
5 3300037471 Ga0395905_0323810 Ga0395905_0323810_133_1245 320
6 3300048903 Ga0496100_0385739 Ga0496100_0385739_13_1035 336
7 3300049579 Ga0501043_0213851 Ga0501043_0213851_14_1129 337
8 3300032002 Ga0307416_100159086 Ga0307416_1001590862 339
9 3300049571 Ga0501034_0357795 Ga0501034_0357795_113_1207 341
10 3300032002 Ga0307416_100057348 Ga0307416_1000573483 343
11 3300049570 Ga0501033_0061360 Ga0501033_0061360_754_1893 343
12 3300049822 Ga0501035_0185908 Ga0501035_0185908_435_1574 343
13 3300049823 Ga0501044_0357226 Ga0501044_0357226_22_1161 343
14 3300041404 Ga0439436_0033083 Ga0439436_0033083_268_1374 344
15 3300041413 Ga0439465_0008052 Ga0439465_0008052_525_1628 344
16 3300046525 Ga0495663_0008069 Ga0495663_0008069_415_1488 345
17 3300046558 Ga0495633_0001984 Ga0495633_0001984_195_1268 345
18 3300041451 Ga0451791_0116265 Ga0451791_0116265_524_1588 347
19 3300041452 Ga0451793_0709379 Ga0451793_0709379_381_1445 347
20 3300041486 Ga0451807_0663756 Ga0451807_0663756_206_1270 347
21 3300041997 Ga0439431_0031782 Ga0439431_0031782_99_1163 347
22 3300046525 Ga0495663_0003414 Ga0495663_0003414_902_1966 347
23 3300048925 Ga0496122_0017772 Ga0496122_0017772_5321_6385 347
24 3300048926 Ga0496123_0056072 Ga0496123_0056072_1232_2296 347
25 iso_pu_bacteria 2842757796 2842760032 352
26 3300031456 Ga0307513_10025731 Ga0307513_100257316 353
27 3300031456 Ga0307513_10101217 Ga0307513_101012172 353
28 iso_pu_bacteria 2547132130 2547500375 353
29 iso_pu_bacteria 2576861471 2578457693 353
30 iso_pu_bacteria 2643221559 2643818794 353
31 iso_pu_bacteria 2643221573 2643878458 353
32 iso_pu_bacteria 2643221586 2643941047 353
33 iso_pu_bacteria 2643221612 2644079914 353
34 iso_pu_bacteria 2643221720 2644659766 353
35 iso_pu_bacteria 2643221727 2644695509 353
36 iso_pu_bacteria 2643221728 2644700493 353
37 iso_pu_bacteria 2747842428 2747948196 353
38 iso_pu_bacteria 2747842501 2748015978 353
39 iso_pu_bacteria 2765235840 2765579801 353
40 iso_pu_bacteria 2816332141 2816519147 353
41 iso_pu_bacteria 2842391507 2842394770 353
42 iso_pu_bacteria 2852649853 2852650141 353
43 iso_pu_bacteria 2874220319 2874222487 353
44 iso_pu_bacteria 2919089067 2919090426 353
45 iso_pu_bacteria 2919134579 2919137639 353
46 iso_pu_bacteria 2928496128 2928498263 353
47 iso_pu_bacteria 2931380184 2931384057 353
48 iso_pu_bacteria 2937610967 2937614781 353
49 iso_pu_bacteria 2939589442 2939591023 353
50 iso_pu_bacteria 2939622612 2939625626 353
51 iso_pu_bacteria 2939626828 2939628404 353
52 iso_pu_bacteria 2941489479 2941491514 353
53 iso_pu_bacteria 2961047084 2961049252 353
54 iso_pu_bacteria 2961064222 2961066049 353
55 iso_pu_bacteria 2974307012 2974308303 353
56 iso_pu_bacteria 2977247770 2977249061 353
57 iso_pu_bacteria 2984514374 2984516487 353
58 iso_pu_bacteria 2995948881 2995952380 353
59 iso_pu_bacteria 2643221593 2643975898 354
60 iso_pu_bacteria 2643221695 2644528952 354
61 iso_pu_bacteria 2818991457 2819660036 354
62 iso_pu_bacteria 2842780639 2842780846 354
63 iso_pu_bacteria 2852684882 2852685148 354
64 iso_pu_bacteria 2919130084 2919130688 354
65 iso_pu_bacteria 2929195423 2929198309 354
66 iso_pu_bacteria 2987605356 2987606184 354
67 iso_pu_bacteria 8021622325 8021626453 354
68 iso_pu_bacteria 8021626552 8021630178 354
69 iso_pu_bacteria 8021648035 8021650698 354
70 3300005344 Ga0070661_100247160 Ga0070661_1002471602 355
71 3300005457 Ga0070662_100123292 Ga0070662_1001232922 355
72 3300005530 Ga0070679_100154695 Ga0070679_1001546953 355
73 3300013307 Ga0157372_10252303 Ga0157372_102523033 355
74 3300025921 Ga0207652_10293266 Ga0207652_102932662 355
75 3300025933 Ga0207706_10162187 Ga0207706_101621872 355
76 iso_pu_bacteria 2894414249 2894415423 355
77 iso_pu_bacteria 2895498888 2895504063 355
78 iso_pu_bacteria 2895511927 2895515417 355
79 iso_pu_bacteria 2895522137 2895525072 355
80 iso_pu_bacteria 2895525241 2895527781 355
81 iso_pu_bacteria 8003014200 8003016260 355
82 3300005331 Ga0070670_100174800 Ga0070670_1001748003 356
83 3300005355 Ga0070671_100099525 Ga0070671_1000995252 356
84 3300005456 Ga0070678_100108892 Ga0070678_1001088922 356
85 3300025298 Ga0209050_1023100 Ga0209050_10231003 356
86 3300025304 Ga0209257_1001220 Ga0209257_10012207 356
87 3300025931 Ga0207644_10226249 Ga0207644_102262492 356
88 3300048912 Ga0496109_0074392 Ga0496109_0074392_389_1501 356
89 3300048925 Ga0496122_0003191 Ga0496122_0003191_8673_9749 356
90 3300048926 Ga0496123_0006156 Ga0496123_0006156_1269_2345 356
91 3300048929 Ga0496126_0010871 Ga0496126_0010871_3097_4173 356
92 3300049568 Ga0501031_0017425 Ga0501031_0017425_2970_4079 356
93 3300049570 Ga0501033_0000715 Ga0501033_0000715_17309_18388 356
94 3300049570 Ga0501033_0078302 Ga0501033_0078302_316_1425 356
95 3300049571 Ga0501034_0015386 Ga0501034_0015386_3620_4720 356
96 3300049572 Ga0501036_0008361 Ga0501036_0008361_3342_4451 356
97 3300049573 Ga0501037_0004462 Ga0501037_0004462_3744_4853 356
98 3300049574 Ga0501038_0001502 Ga0501038_0001502_3869_4978 356
99 3300049579 Ga0501043_0019479 Ga0501043_0019479_443_1552 356
100 3300049581 Ga0501047_0136196 Ga0501047_0136196_221_1330 356
101 3300049586 Ga0501070_0027428 Ga0501070_0027428_136_1245 356
102 3300049587 Ga0501071_0114487 Ga0501071_0114487_814_1923 356
103 3300049589 Ga0501073_0193229 Ga0501073_0193229_228_1337 356
104 3300049742 Ga0501080_0010549 Ga0501080_0010549_3733_4842 356
105 3300049822 Ga0501035_0032020 Ga0501035_0032020_434_1543 356
106 3300049823 Ga0501044_0023229 Ga0501044_0023229_4250_5359 356
107 3300003187 JGI25151J46595_10000032 JGI25151J46595_1000003290 357
108 3300003187 JGI25151J46595_10011087 JGI25151J46595_100110874 357
109 3300003320 rootH2_10002263 rootH2_100022633 357
110 3300003323 rootH1_10193337 rootH1_101933373 357
111 3300003771 Ga0055526_1000038 Ga0055526_100003864 357
112 3300003771 Ga0055526_1031123 Ga0055526_10311232 357
113 3300003773 Ga0055537_1000057 Ga0055537_100005736 357
114 3300003773 Ga0055537_1002160 Ga0055537_10021604 357
115 3300003775 Ga0055524_1000066 Ga0055524_100006664 357
116 3300003775 Ga0055524_1011635 Ga0055524_10116352 357
117 3300003781 Ga0055536_1001310 Ga0055536_100131011 357
118 3300003781 Ga0055536_1009531 Ga0055536_10095313 357
119 3300003784 Ga0055534_1000082 Ga0055534_100008264 357
120 3300003784 Ga0055534_1000472 Ga0055534_100047215 357
121 3300003790 Ga0055528_1000023 Ga0055528_100002364 357
122 3300003790 Ga0055528_1000274 Ga0055528_100027436 357
123 3300003791 Ga0055530_10002304 Ga0055530_1000230410 357
124 3300003794 Ga0055531_10011681 Ga0055531_100116812 357
125 3300003794 Ga0055531_10021672 Ga0055531_100216723 357
126 3300003856 Ga0058692_1000012 Ga0058692_100001258 357
127 3300005288 Ga0065714_10015918 Ga0065714_100159182 357
128 3300005353 Ga0070669_100016661 Ga0070669_1000166615 357
129 3300005355 Ga0070671_100100744 Ga0070671_1001007442 357
130 3300005356 Ga0070674_100077191 Ga0070674_1000771912 357
131 3300005543 Ga0070672_100196972 Ga0070672_1001969722 357
132 3300005548 Ga0070665_100326738 Ga0070665_1003267382 357
133 3300005985 Ga0081539_10028816 Ga0081539_100288162 357
134 3300009148 Ga0105243_10007468 Ga0105243_100074684 357
135 3300009177 Ga0105248_10221526 Ga0105248_102215262 357
136 3300013100 Ga0157373_10035259 Ga0157373_100352593 357
137 3300013100 Ga0157373_10122081 Ga0157373_101220812 357
138 3300013102 Ga0157371_10007349 Ga0157371_100073494 357
139 3300013102 Ga0157371_10080762 Ga0157371_100807622 357
140 3300013104 Ga0157370_10032318 Ga0157370_100323183 357
141 3300014497 Ga0182008_10000339 Ga0182008_1000033913 357
142 3300014497 Ga0182008_10005802 Ga0182008_100058022 357
143 3300015261 Ga0182006_1010257 Ga0182006_10102572 357
144 3300015689 Ga0183360_10001 Ga0183360_10001865 357
145 3300017792 Ga0163161_10000633 Ga0163161_100006333 357
146 3300017792 Ga0163161_10047186 Ga0163161_100471862 357
147 3300025263 Ga0209565_1000005 Ga0209565_1000005275 357
148 3300025263 Ga0209565_1000022 Ga0209565_1000022217 357
149 3300025263 Ga0209565_1005397 Ga0209565_10053975 357
150 3300025273 Ga0209673_1000027 Ga0209673_1000027276 357
151 3300025273 Ga0209673_1000110 Ga0209673_100011039 357
152 3300025284 Ga0209130_1010646 Ga0209130_10106462 357
153 3300025291 Ga0209675_1000004 Ga0209675_1000004275 357
154 3300025291 Ga0209675_1000165 Ga0209675_100016574 357
155 3300025291 Ga0209675_1003307 Ga0209675_10033072 357
156 3300025292 Ga0209676_1000219 Ga0209676_1000219100 357
157 3300025292 Ga0209676_1000603 Ga0209676_100060345 357
158 3300025292 Ga0209676_1000790 Ga0209676_100079019 357
159 3300025292 Ga0209676_1000888 Ga0209676_100088820 357
160 3300025292 Ga0209676_1001117 Ga0209676_100111719 357
161 3300025294 Ga0209025_1000005 Ga0209025_1000005125 357
162 3300025294 Ga0209025_1001283 Ga0209025_100128312 357
163 3300025295 Ga0209564_1000050 Ga0209564_1000050276 357
164 3300025295 Ga0209564_1000541 Ga0209564_100054125 357
165 3300025295 Ga0209564_1032307 Ga0209564_10323072 357
166 3300025297 Ga0209758_1005507 Ga0209758_10055072 357
167 3300025298 Ga0209050_1000578 Ga0209050_100057829 357
168 3300025298 Ga0209050_1000850 Ga0209050_100085023 357
169 3300025298 Ga0209050_1001491 Ga0209050_100149113 357
170 3300025299 Ga0209256_1000031 Ga0209256_1000031276 357
171 3300025299 Ga0209256_1003460 Ga0209256_10034608 357
172 3300025299 Ga0209256_1025835 Ga0209256_10258352 357
173 3300025303 Ga0209051_1007631 Ga0209051_10076312 357
174 3300025304 Ga0209257_1000255 Ga0209257_100025558 357
175 3300025304 Ga0209257_1000263 Ga0209257_1000263109 357
176 3300025304 Ga0209257_1000283 Ga0209257_100028369 357
177 3300025304 Ga0209257_1000839 Ga0209257_100083921 357
178 3300025304 Ga0209257_1000879 Ga0209257_100087921 357
179 3300025304 Ga0209257_1001545 Ga0209257_100154519 357
180 3300025304 Ga0209257_1008532 Ga0209257_10085325 357
181 3300025735 Ga0207713_1032500 Ga0207713_10325002 357
182 3300025923 Ga0207681_10010569 Ga0207681_100105693 357
183 3300025935 Ga0207709_10002504 Ga0207709_100025043 357
184 3300025940 Ga0207691_10001954 Ga0207691_100019544 357
185 3300025972 Ga0207668_10129769 Ga0207668_101297692 357
186 3300027312 Ga0209371_1000007 Ga0209371_1000007331 357
187 3300027876 Ga0209974_10009578 Ga0209974_100095782 357
188 3300030500 Ga0268256_1000008 Ga0268256_1000008619 357
189 3300030742 Ga0316183_1169855 Ga0316183_11698552 357
190 3300031911 Ga0307412_10015356 Ga0307412_100153562 357
191 3300032004 Ga0307414_10006113 Ga0307414_100061135 357
192 3300032004 Ga0307414_10088528 Ga0307414_100885281 357
193 3300038705 Ga0237819_01766 Ga0237819_01766_3373_4452 357
194 3300041406 Ga0439439_0004166 Ga0439439_0004166_989_2074 357
195 3300041407 Ga0439447_005137 Ga0439447_005137_2251_3354 357
196 3300041453 Ga0451797_0089562 Ga0451797_0089562_3275_4369 357
197 3300042006 Ga0439432_028400 Ga0439432_028400_172_1287 357
198 3300042007 Ga0439449_0004509 Ga0439449_0004509_1848_2963 357
199 3300046453 Ga0495627_013258 Ga0495627_013258_1805_2881 357
200 3300046512 Ga0495610_0003727 Ga0495610_0003727_1561_2643 357
201 3300046518 Ga0495631_0002482 Ga0495631_0002482_8870_9952 357
202 3300046522 Ga0495643_0001083 Ga0495643_0001083_9300_10382 357
203 3300046525 Ga0495663_0000897 Ga0495663_0000897_5612_6691 357
204 3300046525 Ga0495663_0001909 Ga0495663_0001909_4057_5136 357
205 3300046537 Ga0495598_0002823 Ga0495598_0002823_1651_2799 357
206 3300046539 Ga0495621_0010652 Ga0495621_0010652_1093_2190 357
207 3300046616 Ga0495668_0002733 Ga0495668_0002733_12297_13400 357
208 3300046616 Ga0495668_0044695 Ga0495668_0044695_16_1113 357
209 3300046660 Ga0495625_0171495 Ga0495625_0171495_200_1282 357
210 3300046810 Ga0495660_0017660 Ga0495660_0017660_222_1304 357
211 3300047320 Ga0495672_0002120 Ga0495672_0002120_2779_3861 357
212 3300048916 Ga0496113_0089043 Ga0496113_0089043_146_1246 357
213 3300048919 Ga0496116_0003621 Ga0496116_0003621_13879_14958 357
214 3300048919 Ga0496116_0053212 Ga0496116_0053212_837_1919 357
215 3300048920 Ga0496117_0006501 Ga0496117_0006501_8826_9902 357
216 3300048920 Ga0496117_0016756 Ga0496117_0016756_195_1277 357
217 3300048920 Ga0496117_0032472 Ga0496117_0032472_1148_2230 357
218 3300048921 Ga0496118_0002044 Ga0496118_0002044_11611_12690 357
219 3300048921 Ga0496118_0004869 Ga0496118_0004869_5794_6873 357
220 3300048921 Ga0496118_0012271 Ga0496118_0012271_638_1720 357
221 3300048921 Ga0496118_0093486 Ga0496118_0093486_966_2048 357
222 3300048922 Ga0496119_0020138 Ga0496119_0020138_733_1812 357
223 3300048922 Ga0496119_0021439 Ga0496119_0021439_2458_3540 357
224 3300048923 Ga0496120_0018440 Ga0496120_0018440_2393_3475 357
225 3300048924 Ga0496121_0001093 Ga0496121_0001093_5062_6174 357
226 3300048924 Ga0496121_0007181 Ga0496121_0007181_8050_9129 357
227 3300048924 Ga0496121_0148778 Ga0496121_0148778_208_1287 357
228 3300048925 Ga0496122_0007823 Ga0496122_0007823_6393_7472 357
229 3300048925 Ga0496122_0031265 Ga0496122_0031265_2225_3307 357
230 3300048926 Ga0496123_0040122 Ga0496123_0040122_1113_2195 357
231 3300048926 Ga0496123_0042754 Ga0496123_0042754_2023_3105 357
232 3300048927 Ga0496124_0000930 Ga0496124_0000930_37437_38519 357
233 3300048927 Ga0496124_0006244 Ga0496124_0006244_1479_2561 357
234 3300048927 Ga0496124_0006459 Ga0496124_0006459_9702_10781 357
235 3300048927 Ga0496124_0006913 Ga0496124_0006913_8638_9714 357
236 3300048927 Ga0496124_0022490 Ga0496124_0022490_195_1274 357
237 3300048928 Ga0496125_0032606 Ga0496125_0032606_1153_2235 357
238 3300048929 Ga0496126_0053638 Ga0496126_0053638_1494_2576 357
239 3300048929 Ga0496126_0298017 Ga0496126_0298017_155_1231 357
240 3300049579 Ga0501043_0008896 Ga0501043_0008896_3173_4273 357
241 iso_pu_bacteria 2941475908 2941476559 357
242 3300003781 Ga0055536_1029249 Ga0055536_10292491 358
243 3300003856 Ga0058692_1000006 Ga0058692_1000006341 358
244 3300005289 Ga0065704_10079495 Ga0065704_100794953 358
245 3300005331 Ga0070670_100007892 Ga0070670_1000078922 358
246 3300005355 Ga0070671_100271545 Ga0070671_1002715452 358
247 3300005844 Ga0068862_100068427 Ga0068862_1000684272 358
248 3300009011 Ga0105251_10000634 Ga0105251_1000063428 358
249 3300009177 Ga0105248_10269174 Ga0105248_102691743 358
250 3300025292 Ga0209676_1008423 Ga0209676_10084234 358
251 3300025294 Ga0209025_1008798 Ga0209025_100879810 358
252 3300025299 Ga0209256_1000889 Ga0209256_10008899 358
253 3300025304 Ga0209257_1001810 Ga0209257_10018105 358
254 3300025735 Ga0207713_1011391 Ga0207713_10113912 358
255 3300025925 Ga0207650_10005410 Ga0207650_100054103 358
256 3300025931 Ga0207644_10003431 Ga0207644_1000343110 358
257 3300027312 Ga0209371_1000016 Ga0209371_1000016337 358
258 3300027665 Ga0209983_1002457 Ga0209983_10024572 358
259 3300027876 Ga0209974_10011628 Ga0209974_100116282 358
260 3300028380 Ga0268265_10052124 Ga0268265_100521242 358
261 3300030500 Ga0268256_1000015 Ga0268256_1000015233 358
262 3300030735 Ga0316178_1173477 Ga0316178_11734772 358
263 3300031548 Ga0307408_100105745 Ga0307408_1001057452 358
264 3300031901 Ga0307406_10064017 Ga0307406_100640172 358
265 3300032004 Ga0307414_10024242 Ga0307414_100242421 358
266 3300032126 Ga0307415_100123013 Ga0307415_1001230132 358
267 3300037312 Ga0395899_0006032 Ga0395899_0006032_2200_3312 358
268 3300037418 Ga0395900_0021673 Ga0395900_0021673_5245_6357 358
269 3300038443 Ga0395901_0061733 Ga0395901_0061733_383_1495 358
270 3300038705 Ga0237819_00505 Ga0237819_00505_6382_7467 358
271 3300041413 Ga0439465_0003508 Ga0439465_0003508_1086_2195 358
272 3300041459 Ga0451800_1612293 Ga0451800_1612293_89_1174 358
273 3300041486 Ga0451807_0597550 Ga0451807_0597550_88_1173 358
274 3300042004 Ga0439445_0002910 Ga0439445_0002910_262_1371 358
275 3300042007 Ga0439449_0000032 Ga0439449_0000032_24302_25411 358
276 3300042007 Ga0439449_0015277 Ga0439449_0015277_194_1303 358
277 3300042876 Ga0451577_0002616 Ga0451577_0002616_18755_19882 358
278 3300044712 Ga0453684_0123860 Ga0453684_0123860_1752_2879 358
279 3300046501 Ga0495607_0053623 Ga0495607_0053623_773_1858 358
280 3300046513 Ga0495616_0030782 Ga0495616_0030782_1095_2180 358
281 3300046691 Ga0495670_0091034 Ga0495670_0091034_164_1264 358
282 3300047318 Ga0495636_0000111 Ga0495636_0000111_8502_9602 358
283 3300047318 Ga0495636_0000237 Ga0495636_0000237_3579_4679 358
284 3300048904 Ga0496101_0188026 Ga0496101_0188026_191_1303 358
285 3300048915 Ga0496112_0044225 Ga0496112_0044225_2790_3902 358
286 3300048916 Ga0496113_0272980 Ga0496113_0272980_167_1279 358
287 3300048920 Ga0496117_0003364 Ga0496117_0003364_17197_18282 358
288 3300048922 Ga0496119_0002881 Ga0496119_0002881_3116_4201 358
289 3300048923 Ga0496120_0000870 Ga0496120_0000870_3083_4168 358
290 3300048925 Ga0496122_0000468 Ga0496122_0000468_26174_27256 358
291 3300048925 Ga0496122_0001135 Ga0496122_0001135_3161_4246 358
292 3300048926 Ga0496123_0000226 Ga0496123_0000226_109644_110729 358
293 3300048926 Ga0496123_0000497 Ga0496123_0000497_9974_11056 358
294 3300048927 Ga0496124_0000009 Ga0496124_0000009_478028_479113 358
295 3300048927 Ga0496124_0000785 Ga0496124_0000785_10025_11110 358
296 3300048928 Ga0496125_0003758 Ga0496125_0003758_14685_15767 358
297 3300048929 Ga0496126_0100709 Ga0496126_0100709_77_1162 358
298 3300049571 Ga0501034_0000261 Ga0501034_0000261_84459_85586 358
299 3300049571 Ga0501034_0002420 Ga0501034_0002420_18742_19836 358
300 3300049574 Ga0501038_0019953 Ga0501038_0019953_4581_5759 358
301 3300049772 Ga0501275_000055 Ga0501275_000055_7449_8582 358
302 3300049823 Ga0501044_0037232 Ga0501044_0037232_3634_4812 358
303 3300049823 Ga0501044_0250329 Ga0501044_0250329_180_1319 358
304 3300053161 Ga0500634_0000138 Ga0500634_0000138_15167_16261 358
305 iso_pu_bacteria 2919513703 2919514797 358
306 iso_pu_bacteria 2919675420 2919677417 358
307 3300006051 Ga0075364_10000327 Ga0075364_1000032716 359
308 3300009036 Ga0105244_10018190 Ga0105244_100181902 359
309 3300013102 Ga0157371_10000344 Ga0157371_1000034435 359
310 3300015262 Ga0182007_10000081 Ga0182007_1000008137 359
311 3300015265 Ga0182005_1000687 Ga0182005_100068711 359
312 3300031824 Ga0307413_10000115 Ga0307413_100001153 359
313 3300032004 Ga0307414_10001369 Ga0307414_100013695 359
314 3300041413 Ga0439465_0001813 Ga0439465_0001813_5479_6594 359
315 3300046558 Ga0495633_0033047 Ga0495633_0033047_824_1918 359
316 3300048907 Ga0496104_0031563 Ga0496104_0031563_1964_3058 359
317 3300048908 Ga0496105_0030633 Ga0496105_0030633_2391_3485 359
318 3300048919 Ga0496116_0008289 Ga0496116_0008289_7687_8778 359
319 3300048919 Ga0496116_0009243 Ga0496116_0009243_4978_6072 359
320 3300048920 Ga0496117_0001015 Ga0496117_0001015_28462_29553 359
321 3300048920 Ga0496117_0160744 Ga0496117_0160744_206_1297 359
322 3300048921 Ga0496118_0001060 Ga0496118_0001060_13403_14494 359
323 3300048921 Ga0496118_0047523 Ga0496118_0047523_1656_2747 359
324 3300048922 Ga0496119_0001961 Ga0496119_0001961_8026_9120 359
325 3300048923 Ga0496120_0000618 Ga0496120_0000618_38291_39385 359
326 3300048924 Ga0496121_0032477 Ga0496121_0032477_2877_3971 359
327 3300048925 Ga0496122_0019678 Ga0496122_0019678_4840_5931 359
328 3300048926 Ga0496123_0037105 Ga0496123_0037105_2092_3183 359
329 3300048927 Ga0496124_0018185 Ga0496124_0018185_1612_2703 359
330 3300048927 Ga0496124_0102181 Ga0496124_0102181_1124_2215 359
331 3300048928 Ga0496125_0001212 Ga0496125_0001212_33473_34567 359
332 3300048928 Ga0496125_0009225 Ga0496125_0009225_7151_8245 359
333 3300048928 Ga0496125_0016250 Ga0496125_0016250_4204_5295 359
334 3300048928 Ga0496125_0073257 Ga0496125_0073257_14_1108 359
335 3300048928 Ga0496125_0116811 Ga0496125_0116811_303_1424 359
336 3300048929 Ga0496126_0000352 Ga0496126_0000352_9617_10711 359
337 3300050491 nmdc:mga00v17_554_c1 nmdc:mga00v17_554_c1_17220_18314 359
338 3300002773 JGI25152J39213_1000074 JGI25152J39213_100007417 360
339 3300002774 JGI25150J39212_1000056 JGI25150J39212_100005617 360
340 3300003187 JGI25151J46595_10000178 JGI25151J46595_1000017844 360
341 3300003215 JGI25153J46596_10000131 JGI25153J46596_1000013129 360
342 3300006051 Ga0075364_10006972 Ga0075364_100069722 360
343 3300025245 Ga0207425_1000108 Ga0207425_100010816 360
344 3300025258 Ga0209129_1000178 Ga0209129_100017828 360
345 3300025294 Ga0209025_1000012 Ga0209025_100001292 360
346 3300025297 Ga0209758_1000018 Ga0209758_1000018566 360
347 3300031911 Ga0307412_10063050 Ga0307412_100630502 360
348 3300032005 Ga0307411_10169038 Ga0307411_101690382 360
349 3300047472 Ga0495686_0098157 Ga0495686_0098157_404_1576 360
350 3300050491 nmdc:mga00v17_4454_c1 nmdc:mga00v17_4454_c1_4574_5701 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

4

169

0.95

PF00570

HRDC

HRDC domain

211

278

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c0x-assembly1.cif.gz_K structure of a 12-subunit nuclear exosome complex bound to structured rna 0.8837 3 186
7d4i-assembly1.cif.gz_r6 cryo-em structure of 90s small ribosomal precursors complex with the deah-box rna helicase dhr1 (state f) 0.8733 3 186
6fsz-assembly1.cif.gz_KK structure of the nuclear rna exosome 0.8733 3 186
2fbv-assembly1.cif.gz_A wrn exonuclease, mn complex 0.8663 1 166
5zo3-assembly1.cif.gz_A apo form of the nuclease 0.8649 4 192
ID Description Score Start End Superfamily
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9386 3 189 3.30.420.10
af_A0A1D8PDF4_132_438_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9169 2 186 3.30.420.10
4nlbA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9153 1 186 3.30.420.10
af_G5EBX6_179_483_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9025 2 186 3.30.420.10
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9015 3 189 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7X5N586-F1-model_v4 Ribonuclease D 0.9919 55 146 GO:0003676
GO:0006139
GO:0008408
AF-A0A091AZ48-F1-model_v4 HRDC domain-containing protein 0.9759 3 360 GO:0000166
GO:0003676
GO:0005737
GO:0008033
GO:0008408
GO:0033890
AF-A0A6P0FS07-F1-model_v4 Ribonuclease D 0.9714 3 209 GO:0003676
GO:0006139
GO:0008408
AF-A0A091AZ48-F1-model_v4 HRDC domain-containing protein 0.9679 3 360 GO:0000166
GO:0003676
GO:0005737
GO:0008033
GO:0008408
GO:0033890
AF-A0A7D0IQV7-F1-model_v4 deleted 0.9653 1 360

Feature Viewer

pLDDT pTM Quality
93.59 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map