F417799

General Info

Members Datasets Scaffolds Average Seq Length
349 224 348 179

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100522890|Ga0068868_1005228901
Length 183
Sequence MGAAAAVVAVSRNDTHAVSKPNCAAITLLAGLGVEGDTHAGETVQHRSRVARDPTQPNLRQVHLIHSELHDELRSSGFHVAPGQMGENVTTRGVDLLALPTGARLRLGDGGALIEITGLRNPCTQLDGIQAGLMQATLDRDADGELIRKAGVMAVVLAGGEVRPGDRIAVELPAAPHRALEPV

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 1.43
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 1.72
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10003280 3300003316 Bacteria 2631
2 rootH1_10003280 3300003323 Bacteria 3148
3 Ga0070658_10249100 3300005327 Bacteria 1507
4 Ga0070683_100005341 3300005329 Bacteria 10712
5 Ga0070683_100012378 3300005329 Bacteria 7412
6 Ga0070683_100213501 3300005329 Bacteria 1833
7 Ga0070682_100770158 3300005337 Bacteria 779
8 Ga0068868_100522890 3300005338 Bacteria 1042
9 Ga0070689_100092302 3300005340 Bacteria 2388
10 Ga0070691_10004162 3300005341 Bacteria 6569
11 Ga0070691_10165024 3300005341 Bacteria 1144
12 Ga0070692_10057822 3300005345 Bacteria 2035
13 Ga0070669_100425689 3300005353 Bacteria 1090
14 Ga0070671_100099462 3300005355 Bacteria 2440
15 Ga0070673_100260406 3300005364 Bacteria 1515
16 Ga0070688_100661760 3300005365 Bacteria 805
17 Ga0070659_100006276 3300005366 Bacteria 8591
18 Ga0070667_100584714 3300005367 Bacteria 1028
19 Ga0070667_100745386 3300005367 Bacteria 908
20 Ga0070714_100002763 3300005435 Bacteria 12931
21 Ga0070713_100008926 3300005436 Bacteria 7142
22 Ga0070713_100568282 3300005436 Bacteria 1075
23 Ga0070711_100005810 3300005439 Bacteria 7408
24 Ga0070694_100211199 3300005444 Bacteria 1451
25 Ga0070708_100471085 3300005445 Bacteria 1185
26 Ga0070678_100285601 3300005456 Bacteria 1397
27 Ga0070662_101215355 3300005457 Bacteria 648
28 Ga0070681_10065467 3300005458 Bacteria 3603
29 Ga0070681_10077277 3300005458 Bacteria 3287
30 Ga0070685_10005963 3300005466 Bacteria 6202
31 Ga0070685_10066331 3300005466 Bacteria 2126
32 Ga0070706_100000487 3300005467 Bacteria 46726
33 Ga0070706_100456494 3300005467 Bacteria 1189
34 Ga0070707_100044695 3300005468 Unclassified 4240
35 Ga0070698_100897311 3300005471 Bacteria 832
36 Ga0070699_100247629 3300005518 Bacteria 1592
37 Ga0070679_100002504 3300005530 Bacteria 16640
38 Ga0070679_100149484 3300005530 Bacteria 2313
39 Ga0070679_100336133 3300005530 Bacteria 1458
40 Ga0070684_100000537 3300005535 Bacteria 26052
41 Ga0070684_100005984 3300005535 Bacteria 9371
42 Ga0070684_100116142 3300005535 Bacteria 2404
43 Ga0070684_100168257 3300005535 Bacteria 1990
44 Ga0070686_100153944 3300005544 Bacteria 1612
45 Ga0070686_100231370 3300005544 Bacteria 1341
46 Ga0070686_100394119 3300005544 Bacteria 1051
47 Ga0070695_100790328 3300005545 Bacteria 760
48 Ga0070693_100489408 3300005547 Bacteria 870
49 Ga0068855_101353891 3300005563 Bacteria 735
50 Ga0070664_100069925 3300005564 Bacteria 3005
51 Ga0070664_100323323 3300005564 Bacteria 1398
52 Ga0068857_100006295 3300005577 Bacteria 10157
53 Ga0068857_100772185 3300005577 Bacteria 916
54 Ga0068854_100304231 3300005578 Bacteria 1291
55 Ga0068856_100001844 3300005614 Bacteria 22160
56 Ga0068856_100008470 3300005614 Bacteria 10008
57 Ga0068852_100006011 3300005616 Bacteria 8743
58 Ga0068852_100110136 3300005616 Bacteria 2502
59 Ga0068859_100067927 3300005617 Bacteria 3600
60 Ga0068859_100403703 3300005617 Bacteria 1463
61 Ga0068864_100184915 3300005618 Bacteria 1907
62 Ga0068863_100316720 3300005841 Bacteria 1515
63 Ga0068863_101578451 3300005841 Bacteria 665
64 Ga0068858_100990528 3300005842 Bacteria 823
65 Ga0081455_10000505 3300005937 Bacteria 50605
66 Ga0081539_10012372 3300005985 Bacteria 6584
67 Ga0075362_10164725 3300006177 Bacteria 1069
68 Ga0075427_10012530 3300006194 Bacteria 1287
69 Ga0075366_10056714 3300006195 Bacteria 2327
70 Ga0097621_100164348 3300006237 Bacteria 1910
71 Ga0068871_100466502 3300006358 Bacteria 1134
72 Ga0075428_100145532 3300006844 Bacteria 2575
73 Ga0075430_100005745 3300006846 Bacteria 10466
74 Ga0075430_100060086 3300006846 Bacteria 3194
75 Ga0075430_100236941 3300006846 Bacteria 1512
76 Ga0075431_100008439 3300006847 Bacteria 10315
77 Ga0075431_100027071 3300006847 Bacteria 5881
78 Ga0075431_100065790 3300006847 Unclassified 3742
79 Ga0075431_101353516 3300006847 Bacteria 672
80 Ga0075429_100028882 3300006880 Bacteria 4817
81 Ga0075429_100053826 3300006880 Bacteria 3501
82 Ga0075429_100126044 3300006880 Bacteria 2239
83 Ga0075429_100341187 3300006880 Unclassified 1311
84 Ga0075429_100602616 3300006880 Unclassified 962
85 Ga0075436_100046749 3300006914 Bacteria 2985
86 Ga0097620_100067928 3300006931 Bacteria 3600
87 Ga0097620_100403678 3300006931 Bacteria 1463
88 Ga0105240_10031396 3300009093 Bacteria 6889
89 Ga0111539_10389621 3300009094 Bacteria 1623
90 Ga0105245_10027834 3300009098 Bacteria 4981
91 Ga0105245_10643354 3300009098 Bacteria 1090
92 Ga0114129_10012393 3300009147 Bacteria 12136
93 Ga0114129_10109822 3300009147 Bacteria 3807
94 Ga0114129_10446474 3300009147 Bacteria 1697
95 Ga0114129_10791034 3300009147 Bacteria 1211
96 Ga0105243_10540795 3300009148 Bacteria 1111
97 Ga0105241_11572935 3300009174 Unclassified 635
98 Ga0105242_10010632 3300009176 Bacteria 7066
99 Ga0105242_10067118 3300009176 Bacteria 2964
100 Ga0105248_10066037 3300009177 Bacteria 4062
101 Ga0105248_10151370 3300009177 Bacteria 2617
102 Ga0105248_11273384 3300009177 Unclassified 832
103 Ga0105237_10091566 3300009545 Bacteria 3030
104 Ga0105238_10007174 3300009551 Bacteria 11146
105 Ga0105249_10035058 3300009553 Bacteria 4548
106 Ga0105249_10139818 3300009553 Bacteria 2320
107 Ga0105249_10318059 3300009553 Bacteria 1567
108 Ga0105249_10329637 3300009553 Bacteria 1540
109 Ga0157371_10099526 3300013102 Bacteria 2062
110 Ga0157370_10008132 3300013104 Bacteria 11349
111 Ga0157369_10038112 3300013105 Bacteria 5258
112 Ga0157369_10397654 3300013105 Bacteria 1430
113 Ga0157369_11022383 3300013105 Bacteria 846
114 Ga0157374_11328795 3300013296 Bacteria 741
115 Ga0163162_10157175 3300013306 Bacteria 2394
116 Ga0157372_10006679 3300013307 Bacteria 12270
117 Ga0157375_10179036 3300013308 Bacteria 2271
118 Ga0157375_11893442 3300013308 Bacteria 708
119 Ga0163163_10152788 3300014325 Bacteria 2352
120 Ga0157380_10868417 3300014326 Bacteria 925
121 Ga0157379_10908125 3300014968 Bacteria 836
122 Ga0206356_11074039 3300020070 Bacteria 1302
123 Ga0206349_1930794 3300020075 Bacteria 1688
124 Ga0213874_10001562 3300021377 Unclassified 4777
125 Ga0213876_10045488 3300021384 Bacteria 2321
126 Ga0224712_10028995 3300022467 Bacteria 1984
127 Ga0224712_10092884 3300022467 Bacteria 1267
128 Ga0224712_10226016 3300022467 Bacteria 858
129 Ga0209147_100050 3300025229 Bacteria 274639
130 Ga0209257_1000629 3300025304 Bacteria 56718
131 Ga0207684_10000336 3300025910 Bacteria 65671
132 Ga0207684_10229052 3300025910 Bacteria 1603
133 Ga0207707_10004324 3300025912 Bacteria 12576
134 Ga0207707_10182335 3300025912 Bacteria 1833
135 Ga0207671_10090030 3300025914 Bacteria 2310
136 Ga0207671_10169348 3300025914 Bacteria 1695
137 Ga0207671_10307259 3300025914 Bacteria 1253
138 Ga0207663_10005711 3300025916 Bacteria 6292
139 Ga0207660_10027066 3300025917 Bacteria 3909
140 Ga0207652_10027620 3300025921 Bacteria 4729
141 Ga0207652_10124146 3300025921 Bacteria 2299
142 Ga0207646_10037191 3300025922 Unclassified 4390
143 Ga0207681_10522901 3300025923 Bacteria 974
144 Ga0207694_10022949 3300025924 Bacteria 4735
145 Ga0207659_10311338 3300025926 Bacteria 1296
146 Ga0207687_10107673 3300025927 Bacteria 2063
147 Ga0207700_10012442 3300025928 Bacteria 5489
148 Ga0207664_10010852 3300025929 Bacteria 6450
149 Ga0207690_10016427 3300025932 Bacteria 4502
150 Ga0207706_10819707 3300025933 Bacteria 790
151 Ga0207686_10011497 3300025934 Bacteria 4849
152 Ga0207709_10471399 3300025935 Bacteria 974
153 Ga0207670_10419545 3300025936 Bacteria 1073
154 Ga0207670_10453156 3300025936 Bacteria 1035
155 Ga0207711_10284346 3300025941 Bacteria 1523
156 Ga0207661_10002146 3300025944 Bacteria 13578
157 Ga0207661_10012082 3300025944 Bacteria 6272
158 Ga0207661_10166040 3300025944 Bacteria 1918
159 Ga0207679_10056617 3300025945 Bacteria 2896
160 Ga0207712_10090587 3300025961 Bacteria 2251
161 Ga0207712_10277793 3300025961 Bacteria 1366
162 Ga0207640_10050675 3300025981 Bacteria 2695
163 Ga0207658_10245676 3300025986 Unclassified 1519
164 Ga0207677_10629372 3300026023 Bacteria 945
165 Ga0207678_10147886 3300026067 Bacteria 2005
166 Ga0207678_10358814 3300026067 Bacteria 1258
167 Ga0207708_10179617 3300026075 Bacteria 1680
168 Ga0207702_10004854 3300026078 Bacteria 11843
169 Ga0207702_10454202 3300026078 Bacteria 1243
170 Ga0207676_10358286 3300026095 Bacteria 1351
171 Ga0207674_10004531 3300026116 Bacteria 16683
172 Ga0207674_10431810 3300026116 Bacteria 1273
173 Ga0207683_10499079 3300026121 Bacteria 1124
174 Ga0207698_10101356 3300026142 Bacteria 2387
175 Ga0268265_10019842 3300028380 Bacteria 4681
176 Ga0268265_10673561 3300028380 Bacteria 997
177 Ga0268264_10096542 3300028381 Bacteria 2560
178 Ga0265334_10056727 3300028573 Bacteria 1486
179 Ga0265323_10032452 3300028653 Bacteria 1937
180 Ga0265336_10051443 3300028666 Bacteria 1244
181 Ga0265338_10006168 3300028800 Bacteria 15373
182 Ga0265338_10025848 3300028800 Bacteria 5941
183 Ga0265338_10109210 3300028800 Bacteria 2232
184 Ga0265325_10000368 3300031241 Bacteria 31707
185 Ga0265339_10007183 3300031249 Bacteria 7222
186 Ga0265316_10012139 3300031344 Bacteria 7734
187 Ga0265313_10000512 3300031595 Bacteria 40630
188 Ga0316575_10031122 3300031665 Unclassified 2088
189 Ga0265342_10086272 3300031712 Bacteria 1805
190 Ga0316576_10152996 3300031727 Bacteria 1738
191 Ga0316576_10672943 3300031727 Bacteria 751
192 Ga0316578_10167427 3300031728 Unclassified 1324
193 Ga0307407_11317695 3300031903 Bacteria 567
194 Ga0307409_100423460 3300031995 Bacteria 1278
195 Ga0307416_100522839 3300032002 Unclassified 1255
196 Ga0307415_101116879 3300032126 Bacteria 739
197 Ga0316583_10051932 3300032133 Unclassified 1443
198 Ga0316580_10010259 3300032139 Unclassified 2826
199 Ga0373934_0043317 3300035086 Bacteria 1779
200 Ga0373953_0003058 3300035117 Bacteria 5138
201 Ga0373954_0001863 3300035118 Bacteria 8714
202 Ga0373954_0278630 3300035118 Bacteria 824
203 Ga0373956_0049609 3300035119 Bacteria 1883
204 Ga0373956_0235274 3300035119 Bacteria 870
205 Ga0373924_0316873 3300035410 Bacteria 693
206 Ga0373933_0019465 3300035724 Bacteria 3835
207 Ga0373933_0024239 3300035724 Bacteria 3473
208 Ga0373937_0004016 3300036401 Bacteria 12458
209 Ga0373937_0054602 3300036401 Bacteria 3666
210 Ga0373937_0097492 3300036401 Bacteria 2727
211 Ga0373937_0210895 3300036401 Bacteria 1828
212 Ga0316582_0057382 3300036647 Unclassified 2487
213 Ga0395901_0354892 3300038443 Bacteria 1513
214 Ga0436365_1837670 3300039437 Bacteria 5193
215 Ga0436360_0314870 3300039438 Bacteria 1436
216 Ga0436363_0868802 3300039450 Unclassified 4610
217 Ga0436362_0006970 3300039453 Bacteria 2224
218 Ga0436362_0527205 3300039453 Bacteria 8491
219 Ga0439447_034204 3300041407 Bacteria 1264
220 Ga0450923_038248 3300042125 Bacteria 1001
221 Ga0451577_0741218 3300042876 Bacteria 889
222 Ga0439440_0119920 3300042993 Bacteria 731
223 Ga0453683_0559656 3300044673 Bacteria 744
224 Ga0466963_0140830 3300044694 Bacteria 1671
225 Ga0453684_0000142 3300044712 Bacteria 316405
226 Ga0453684_0017556 3300044712 Bacteria 11074
227 Ga0453684_0186378 3300044712 Unclassified 2431
228 Ga0453684_0236753 3300044712 Bacteria 2104
229 Ga0453684_1339560 3300044712 Unclassified 745
230 Ga0466967_0039760 3300045976 Bacteria 4046
231 Ga0466967_0179159 3300045976 Bacteria 1998
232 Ga0466967_0456826 3300045976 Bacteria 1249
233 Ga0495629_0063882 3300046459 Bacteria 2571
234 Ga0495582_0003298 3300046473 Bacteria 9069
235 Ga0495666_0213461 3300046526 Bacteria 885
236 Ga0495667_0212628 3300046559 Unclassified 1236
237 Ga0495659_0108699 3300046664 Bacteria 1081
238 Ga0495657_0628099 3300046675 Bacteria 620
239 Ga0495613_0155825 3300046689 Bacteria 1627
240 Ga0495613_0782977 3300046689 Bacteria 623
241 Ga0495604_0207842 3300047317 Bacteria 1354
242 Ga0495674_0021044 3300047319 Bacteria 6035
243 Ga0495674_0073972 3300047319 Bacteria 2936
244 Ga0495674_0394927 3300047319 Unclassified 1117
245 Ga0495676_0314731 3300047321 Bacteria 1053
246 Ga0495675_0176755 3300047444 Unclassified 1309
247 Ga0495675_0412683 3300047444 Unclassified 786
248 Ga0495677_0333609 3300047445 Bacteria 598
249 Ga0496104_0044178 3300048907 Bacteria 4187
250 Ga0496108_0000067 3300048911 Bacteria 116015
251 Ga0496109_0308775 3300048912 Bacteria 1492
252 Ga0496110_0002733 3300048913 Bacteria 13329
253 Ga0496111_0102812 3300048914 Bacteria 2101
254 Ga0496112_0050965 3300048915 Bacteria 4060
255 Ga0501031_0000806 3300049568 Bacteria 18888
256 Ga0501032_0016548 3300049569 Bacteria 5185
257 Ga0501033_0000294 3300049570 Bacteria 47989
258 Ga0501033_0326534 3300049570 Bacteria 1077
259 Ga0501034_0020831 3300049571 Bacteria 6691
260 Ga0501034_0593089 3300049571 Bacteria 1014
261 Ga0501036_0005562 3300049572 Bacteria 10223
262 Ga0501037_0000378 3300049573 Bacteria 37014
263 Ga0501038_0000087 3300049574 Bacteria 78741
264 Ga0501038_0098932 3300049574 Bacteria 2432
265 Ga0501039_0001020 3300049575 Bacteria 20404
266 Ga0501040_0000007 3300049576 Bacteria 90368
267 Ga0501041_0000005 3300049577 Bacteria 75426
268 Ga0501041_0157787 3300049577 Bacteria 1418
269 Ga0501041_0729245 3300049577 Bacteria 635
270 Ga0501042_0003216 3300049578 Bacteria 10205
271 Ga0501043_0000998 3300049579 Bacteria 24892
272 Ga0501043_0504939 3300049579 Bacteria 903
273 Ga0501046_0001278 3300049580 Bacteria 24362
274 Ga0501046_0130009 3300049580 Bacteria 1910
275 Ga0501047_0000592 3300049581 Bacteria 38584
276 Ga0501047_0001775 3300049581 Bacteria 20844
277 Ga0501047_0007269 3300049581 Bacteria 10408
278 Ga0501047_0007794 3300049581 Bacteria 10084
279 Ga0501047_0212645 3300049581 Bacteria 1792
280 Ga0501048_0000184 3300049582 Bacteria 39741
281 Ga0501067_0029113 3300049583 Bacteria 3061
282 Ga0501067_0656218 3300049583 Bacteria 589
283 Ga0501068_0000134 3300049584 Bacteria 33588
284 Ga0501068_0013586 3300049584 Bacteria 4636
285 Ga0501069_0000426 3300049585 Bacteria 19142
286 Ga0501069_0037257 3300049585 Bacteria 2684
287 Ga0501070_0016073 3300049586 Bacteria 6290
288 Ga0501070_0016393 3300049586 Bacteria 6225
289 Ga0501070_0039947 3300049586 Bacteria 3913
290 Ga0501070_0253288 3300049586 Bacteria 1440
291 Ga0501070_0398260 3300049586 Bacteria 1114
292 Ga0501071_0000005 3300049587 Bacteria 78747
293 Ga0501072_0000269 3300049588 Bacteria 37902
294 Ga0501072_0365706 3300049588 Bacteria 1145
295 Ga0501073_0001327 3300049589 Bacteria 18226
296 Ga0501073_0154117 3300049589 Bacteria 1592
297 Ga0501073_0973661 3300049589 Bacteria 584
298 Ga0501074_0001138 3300049590 Bacteria 17415
299 Ga0501074_0240121 3300049590 Bacteria 1289
300 Ga0501075_0000009 3300049591 Bacteria 97052
301 Ga0501076_0000028 3300049592 Bacteria 76828
302 Ga0501077_0000006 3300049593 Bacteria 119936
303 Ga0501079_0000881 3300049741 Bacteria 20585
304 Ga0501079_0167594 3300049741 Bacteria 1713
305 Ga0501080_0000626 3300049742 Bacteria 28026
306 Ga0501080_0009753 3300049742 Bacteria 8771
307 Ga0501080_0076981 3300049742 Bacteria 3102
308 Ga0501080_0254124 3300049742 Bacteria 1602
309 Ga0501081_0000003 3300049743 Bacteria 97558
310 Ga0501083_0001918 3300049744 Bacteria 14292
311 Ga0501083_0006289 3300049744 Bacteria 8422
312 Ga0501035_0000175 3300049822 Bacteria 78747
313 Ga0501044_0002291 3300049823 Bacteria 21805
314 Ga0501044_0027638 3300049823 Bacteria 5992
315 Ga0501044_0037000 3300049823 Bacteria 5103
316 Ga0501045_0000009 3300049824 Bacteria 75255
317 Ga0501045_0171615 3300049824 Bacteria 1615
318 nmdc:mga05p37_146597_c1 3300050507 Bacteria 2890
319 nmdc:mga05p37_213779_c1 3300050507 Bacteria 2330
320 nmdc:mga05p37_263711_c1 3300050507 Bacteria 2060
321 nmdc:mga05p37_38150_c1 3300050507 Bacteria 5891
322 nmdc:mga05p37_55790_c1 3300050507 Unclassified 4864
323 nmdc:mga09592_16120_c1 3300050508 Bacteria 6107
324 nmdc:mga09592_57552_c1 3300050508 Bacteria 3286
325 nmdc:mga09592_62811_c1 3300050508 Bacteria 3142
326 nmdc:mga09592_87843_c1 3300050508 Unclassified 2655
327 nmdc:mga09592_93327_c1 3300050508 Bacteria 2574
328 nmdc:mga0qj67_1298_c2 3300050509 Bacteria 10507
329 nmdc:mga0qj67_58414_c1 3300050509 Bacteria 3059
330 nmdc:mga0qj67_90105_c1 3300050509 Bacteria 2464
331 nmdc:mga06r32_473666_c1 3300050510 Bacteria 1231
332 nmdc:mga06r32_51501_c1 3300050510 Bacteria 3941
333 nmdc:mga0n895_121650_c1 3300050512 Bacteria 2631
334 nmdc:mga0n895_457207_c1 3300050512 Bacteria 1288
335 nmdc:mga08x19_359101_c1 3300050514 Bacteria 1018
336 nmdc:mga0a205_828912_c1 3300050515 Bacteria 772
337 Ga0495595_0012158 3300053084 Bacteria 3614
338 Ga0495619_0011016 3300053085 Bacteria 5691
339 Ga0495619_0089341 3300053085 Bacteria 2084
340 Ga0500651_0224590 3300053093 Bacteria 1100
341 Ga0500595_000731 3300053119 Bacteria 19548
342 Ga0500604_0014821 3300053151 Bacteria 2126
343 Ga0501084_0005874 3300054114 Bacteria 10101
344 Ga0501084_0010706 3300054114 Bacteria 7591
345 Ga0501082_0000063 3300060353 Bacteria 76891
346 Ga0501082_0001543 3300060353 Bacteria 20276
347 Ga0530510_0000014 3300061734 Bacteria 106661
348 Ga0530510_0983166 3300061734 Bacteria 646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100236941 Ga0075430_1002369412 157
2 3300006847 Ga0075431_100008439 Ga0075431_1000084393 157
3 3300006880 Ga0075429_100028882 Ga0075429_1000288823 157
4 3300009147 Ga0114129_10012393 Ga0114129_1001239317 157
5 3300050507 nmdc:mga05p37_38150_c1 nmdc:mga05p37_38150_c1_1853_2410 157
6 3300050508 nmdc:mga09592_93327_c1 nmdc:mga09592_93327_c1_129_686 157
7 3300050509 nmdc:mga0qj67_58414_c1 nmdc:mga0qj67_58414_c1_2264_2821 157
8 3300050510 nmdc:mga06r32_51501_c1 nmdc:mga06r32_51501_c1_2621_3178 157
9 3300006844 Ga0075428_100145532 Ga0075428_1001455323 158
10 3300049579 Ga0501043_0504939 Ga0501043_0504939_14_496 160
11 3300042993 Ga0439440_0119920 Ga0439440_0119920_197_691 164
12 3300005329 Ga0070683_100005341 Ga0070683_1000053415 165
13 3300005345 Ga0070692_10057822 Ga0070692_100578222 165
14 3300005366 Ga0070659_100006276 Ga0070659_1000062762 165
15 3300005458 Ga0070681_10077277 Ga0070681_100772774 165
16 3300005530 Ga0070679_100002504 Ga0070679_1000025049 165
17 3300005535 Ga0070684_100005984 Ga0070684_1000059846 165
18 3300005578 Ga0068854_100304231 Ga0068854_1003042312 165
19 3300005614 Ga0068856_100008470 Ga0068856_1000084705 165
20 3300005616 Ga0068852_100006011 Ga0068852_1000060115 165
21 3300009093 Ga0105240_10031396 Ga0105240_100313967 165
22 3300009147 Ga0114129_10446474 Ga0114129_104464743 165
23 3300009551 Ga0105238_10007174 Ga0105238_1000717412 165
24 3300009553 Ga0105249_10035058 Ga0105249_100350584 165
25 3300009553 Ga0105249_10318059 Ga0105249_103180592 165
26 3300009553 Ga0105249_10329637 Ga0105249_103296372 165
27 3300013102 Ga0157371_10099526 Ga0157371_100995262 165
28 3300013104 Ga0157370_10008132 Ga0157370_100081328 165
29 3300013308 Ga0157375_11893442 Ga0157375_118934422 165
30 3300014325 Ga0163163_10152788 Ga0163163_101527882 165
31 3300025912 Ga0207707_10004324 Ga0207707_100043249 165
32 3300025914 Ga0207671_10169348 Ga0207671_101693482 165
33 3300025917 Ga0207660_10027066 Ga0207660_100270666 165
34 3300025921 Ga0207652_10027620 Ga0207652_100276201 165
35 3300025924 Ga0207694_10022949 Ga0207694_100229494 165
36 3300025932 Ga0207690_10016427 Ga0207690_100164278 165
37 3300025944 Ga0207661_10002146 Ga0207661_100021465 165
38 3300025961 Ga0207712_10277793 Ga0207712_102777932 165
39 3300025981 Ga0207640_10050675 Ga0207640_100506752 165
40 3300026078 Ga0207702_10454202 Ga0207702_104542021 165
41 3300026142 Ga0207698_10101356 Ga0207698_101013562 165
42 3300041407 Ga0439447_034204 Ga0439447_034204_234_731 165
43 3300042125 Ga0450923_038248 Ga0450923_038248_302_799 165
44 3300049571 Ga0501034_0593089 Ga0501034_0593089_302_799 165
45 3300050515 nmdc:mga0a205_828912_c1 nmdc:mga0a205_828912_c1_10_507 165
46 3300048911 Ga0496108_0000067 Ga0496108_0000067_65940_66446 168
47 3300045976 Ga0466967_0039760 Ga0466967_0039760_3358_3879 173
48 3300006195 Ga0075366_10056714 Ga0075366_100567142 176
49 iso_pu_bacteria 2891554331 2891561866 176
50 3300044694 Ga0466963_0140830 Ga0466963_0140830_743_1276 177
51 3300045976 Ga0466967_0179159 Ga0466967_0179159_37_570 177
52 3300005439 Ga0070711_100005810 Ga0070711_1000058105 178
53 3300005445 Ga0070708_100471085 Ga0070708_1004710851 178
54 3300005467 Ga0070706_100456494 Ga0070706_1004564942 178
55 3300005471 Ga0070698_100897311 Ga0070698_1008973112 178
56 3300005518 Ga0070699_100247629 Ga0070699_1002476292 178
57 3300005547 Ga0070693_100489408 Ga0070693_1004894081 178
58 3300005841 Ga0068863_101578451 Ga0068863_1015784512 178
59 3300025910 Ga0207684_10229052 Ga0207684_102290522 178
60 3300025916 Ga0207663_10005711 Ga0207663_100057112 178
61 3300028381 Ga0268264_10096542 Ga0268264_100965423 178
62 3300028800 Ga0265338_10109210 Ga0265338_101092102 178
63 3300031241 Ga0265325_10000368 Ga0265325_1000036816 178
64 3300031249 Ga0265339_10007183 Ga0265339_100071835 178
65 3300031344 Ga0265316_10012139 Ga0265316_100121395 178
66 3300031595 Ga0265313_10000512 Ga0265313_1000051214 178
67 3300031712 Ga0265342_10086272 Ga0265342_100862722 178
68 3300035086 Ga0373934_0043317 Ga0373934_0043317_1080_1616 178
69 3300035119 Ga0373956_0235274 Ga0373956_0235274_297_833 178
70 3300035724 Ga0373933_0019465 Ga0373933_0019465_2599_3135 178
71 3300036401 Ga0373937_0054602 Ga0373937_0054602_2486_3022 178
72 3300044712 Ga0453684_0000142 Ga0453684_0000142_161385_161924 178
73 3300049581 Ga0501047_0212645 Ga0501047_0212645_1163_1699 178
74 3300005353 Ga0070669_100425689 Ga0070669_1004256892 179
75 3300005367 Ga0070667_100584714 Ga0070667_1005847142 179
76 3300005367 Ga0070667_100745386 Ga0070667_1007453862 179
77 3300005457 Ga0070662_101215355 Ga0070662_1012153551 179
78 3300005564 Ga0070664_100323323 Ga0070664_1003233232 179
79 3300005577 Ga0068857_100772185 Ga0068857_1007721852 179
80 3300005617 Ga0068859_100067927 Ga0068859_1000679272 179
81 3300005618 Ga0068864_100184915 Ga0068864_1001849152 179
82 3300006177 Ga0075362_10164725 Ga0075362_101647251 179
83 3300006931 Ga0097620_100067928 Ga0097620_1000679282 179
84 3300009094 Ga0111539_10389621 Ga0111539_103896212 179
85 3300009174 Ga0105241_11572935 Ga0105241_115729351 179
86 3300009176 Ga0105242_10010632 Ga0105242_100106324 179
87 3300009177 Ga0105248_10151370 Ga0105248_101513702 179
88 3300009553 Ga0105249_10139818 Ga0105249_101398183 179
89 3300014326 Ga0157380_10868417 Ga0157380_108684172 179
90 3300014968 Ga0157379_10908125 Ga0157379_109081251 179
91 3300025933 Ga0207706_10819707 Ga0207706_108197071 179
92 3300025934 Ga0207686_10011497 Ga0207686_100114976 179
93 3300025986 Ga0207658_10245676 Ga0207658_102456762 179
94 3300026095 Ga0207676_10358286 Ga0207676_103582862 179
95 3300026116 Ga0207674_10431810 Ga0207674_104318102 179
96 3300035117 Ga0373953_0003058 Ga0373953_0003058_2763_3305 179
97 3300035118 Ga0373954_0001863 Ga0373954_0001863_6864_7406 179
98 3300035118 Ga0373954_0278630 Ga0373954_0278630_221_763 179
99 3300035119 Ga0373956_0049609 Ga0373956_0049609_1096_1638 179
100 3300035410 Ga0373924_0316873 Ga0373924_0316873_65_607 179
101 3300035724 Ga0373933_0024239 Ga0373933_0024239_884_1426 179
102 3300036401 Ga0373937_0004016 Ga0373937_0004016_4945_5487 179
103 3300036401 Ga0373937_0210895 Ga0373937_0210895_625_1167 179
104 3300046459 Ga0495629_0063882 Ga0495629_0063882_1667_2212 179
105 3300046526 Ga0495666_0213461 Ga0495666_0213461_168_713 179
106 3300046675 Ga0495657_0628099 Ga0495657_0628099_39_581 179
107 3300046689 Ga0495613_0155825 Ga0495613_0155825_797_1342 179
108 3300047321 Ga0495676_0314731 Ga0495676_0314731_478_1023 179
109 3300049583 Ga0501067_0656218 Ga0501067_0656218_24_563 179
110 3300053084 Ga0495595_0012158 Ga0495595_0012158_2765_3307 179
111 3300053085 Ga0495619_0011016 Ga0495619_0011016_41_583 179
112 3300053085 Ga0495619_0089341 Ga0495619_0089341_750_1292 179
113 3300061734 Ga0530510_0983166 Ga0530510_0983166_61_603 179
114 3300003316 rootH1_10003280 rootH1_100032802 180
115 3300005327 Ga0070658_10249100 Ga0070658_102491002 180
116 3300005329 Ga0070683_100012378 Ga0070683_1000123788 180
117 3300005329 Ga0070683_100213501 Ga0070683_1002135012 180
118 3300005337 Ga0070682_100770158 Ga0070682_1007701581 180
119 3300005338 Ga0068868_100522890 Ga0068868_1005228901 180
120 3300005340 Ga0070689_100092302 Ga0070689_1000923021 180
121 3300005341 Ga0070691_10004162 Ga0070691_100041622 180
122 3300005341 Ga0070691_10165024 Ga0070691_101650242 180
123 3300005355 Ga0070671_100099462 Ga0070671_1000994622 180
124 3300005364 Ga0070673_100260406 Ga0070673_1002604062 180
125 3300005365 Ga0070688_100661760 Ga0070688_1006617602 180
126 3300005435 Ga0070714_100002763 Ga0070714_1000027636 180
127 3300005436 Ga0070713_100008926 Ga0070713_1000089265 180
128 3300005436 Ga0070713_100568282 Ga0070713_1005682821 180
129 3300005444 Ga0070694_100211199 Ga0070694_1002111991 180
130 3300005456 Ga0070678_100285601 Ga0070678_1002856012 180
131 3300005458 Ga0070681_10065467 Ga0070681_100654672 180
132 3300005466 Ga0070685_10005963 Ga0070685_100059634 180
133 3300005466 Ga0070685_10066331 Ga0070685_100663312 180
134 3300005467 Ga0070706_100000487 Ga0070706_10000048754 180
135 3300005468 Ga0070707_100044695 Ga0070707_1000446952 180
136 3300005530 Ga0070679_100149484 Ga0070679_1001494842 180
137 3300005530 Ga0070679_100336133 Ga0070679_1003361333 180
138 3300005535 Ga0070684_100000537 Ga0070684_10000053718 180
139 3300005535 Ga0070684_100116142 Ga0070684_1001161423 180
140 3300005535 Ga0070684_100168257 Ga0070684_1001682573 180
141 3300005544 Ga0070686_100153944 Ga0070686_1001539442 180
142 3300005544 Ga0070686_100231370 Ga0070686_1002313702 180
143 3300005544 Ga0070686_100394119 Ga0070686_1003941191 180
144 3300005545 Ga0070695_100790328 Ga0070695_1007903281 180
145 3300005563 Ga0068855_101353891 Ga0068855_1013538911 180
146 3300005564 Ga0070664_100069925 Ga0070664_1000699252 180
147 3300005577 Ga0068857_100006295 Ga0068857_1000062959 180
148 3300005614 Ga0068856_100001844 Ga0068856_10000184418 180
149 3300005616 Ga0068852_100110136 Ga0068852_1001101362 180
150 3300005617 Ga0068859_100403703 Ga0068859_1004037032 180
151 3300005841 Ga0068863_100316720 Ga0068863_1003167202 180
152 3300005842 Ga0068858_100990528 Ga0068858_1009905282 180
153 3300005937 Ga0081455_10000505 Ga0081455_1000050545 180
154 3300005985 Ga0081539_10012372 Ga0081539_100123723 180
155 3300006194 Ga0075427_10012530 Ga0075427_100125302 180
156 3300006237 Ga0097621_100164348 Ga0097621_1001643482 180
157 3300006358 Ga0068871_100466502 Ga0068871_1004665022 180
158 3300006846 Ga0075430_100005745 Ga0075430_10000574511 180
159 3300006846 Ga0075430_100060086 Ga0075430_1000600862 180
160 3300006847 Ga0075431_100027071 Ga0075431_1000270712 180
161 3300006847 Ga0075431_100065790 Ga0075431_1000657902 180
162 3300006847 Ga0075431_101353516 Ga0075431_1013535161 180
163 3300006880 Ga0075429_100053826 Ga0075429_1000538265 180
164 3300006880 Ga0075429_100126044 Ga0075429_1001260442 180
165 3300006880 Ga0075429_100341187 Ga0075429_1003411872 180
166 3300006880 Ga0075429_100602616 Ga0075429_1006026162 180
167 3300006914 Ga0075436_100046749 Ga0075436_1000467492 180
168 3300006931 Ga0097620_100403678 Ga0097620_1004036782 180
169 3300009098 Ga0105245_10027834 Ga0105245_100278345 180
170 3300009098 Ga0105245_10643354 Ga0105245_106433542 180
171 3300009147 Ga0114129_10109822 Ga0114129_101098223 180
172 3300009147 Ga0114129_10791034 Ga0114129_107910341 180
173 3300009148 Ga0105243_10540795 Ga0105243_105407951 180
174 3300009176 Ga0105242_10067118 Ga0105242_100671183 180
175 3300009177 Ga0105248_10066037 Ga0105248_100660373 180
176 3300009177 Ga0105248_11273384 Ga0105248_112733842 180
177 3300009545 Ga0105237_10091566 Ga0105237_100915663 180
178 3300013105 Ga0157369_10038112 Ga0157369_100381125 180
179 3300013105 Ga0157369_10397654 Ga0157369_103976542 180
180 3300013105 Ga0157369_11022383 Ga0157369_110223832 180
181 3300013296 Ga0157374_11328795 Ga0157374_113287952 180
182 3300013306 Ga0163162_10157175 Ga0163162_101571753 180
183 3300013307 Ga0157372_10006679 Ga0157372_100066795 180
184 3300013308 Ga0157375_10179036 Ga0157375_101790362 180
185 3300020070 Ga0206356_11074039 Ga0206356_110740391 180
186 3300020075 Ga0206349_1930794 Ga0206349_19307943 180
187 3300021377 Ga0213874_10001562 Ga0213874_100015627 180
188 3300021384 Ga0213876_10045488 Ga0213876_100454883 180
189 3300022467 Ga0224712_10028995 Ga0224712_100289952 180
190 3300022467 Ga0224712_10092884 Ga0224712_100928841 180
191 3300022467 Ga0224712_10226016 Ga0224712_102260162 180
192 3300025229 Ga0209147_100050 Ga0209147_100050102 180
193 3300025304 Ga0209257_1000629 Ga0209257_100062956 180
194 3300025910 Ga0207684_10000336 Ga0207684_1000033619 180
195 3300025912 Ga0207707_10182335 Ga0207707_101823352 180
196 3300025914 Ga0207671_10090030 Ga0207671_100900302 180
197 3300025914 Ga0207671_10307259 Ga0207671_103072592 180
198 3300025921 Ga0207652_10124146 Ga0207652_101241462 180
199 3300025922 Ga0207646_10037191 Ga0207646_100371914 180
200 3300025923 Ga0207681_10522901 Ga0207681_105229012 180
201 3300025926 Ga0207659_10311338 Ga0207659_103113382 180
202 3300025927 Ga0207687_10107673 Ga0207687_101076732 180
203 3300025928 Ga0207700_10012442 Ga0207700_100124425 180
204 3300025929 Ga0207664_10010852 Ga0207664_100108527 180
205 3300025935 Ga0207709_10471399 Ga0207709_104713992 180
206 3300025936 Ga0207670_10419545 Ga0207670_104195452 180
207 3300025936 Ga0207670_10453156 Ga0207670_104531562 180
208 3300025941 Ga0207711_10284346 Ga0207711_102843462 180
209 3300025944 Ga0207661_10012082 Ga0207661_100120823 180
210 3300025944 Ga0207661_10166040 Ga0207661_101660403 180
211 3300025945 Ga0207679_10056617 Ga0207679_100566172 180
212 3300025961 Ga0207712_10090587 Ga0207712_100905872 180
213 3300026023 Ga0207677_10629372 Ga0207677_106293722 180
214 3300026067 Ga0207678_10147886 Ga0207678_101478861 180
215 3300026067 Ga0207678_10358814 Ga0207678_103588142 180
216 3300026075 Ga0207708_10179617 Ga0207708_101796172 180
217 3300026078 Ga0207702_10004854 Ga0207702_100048545 180
218 3300026116 Ga0207674_10004531 Ga0207674_100045318 180
219 3300026121 Ga0207683_10499079 Ga0207683_104990792 180
220 3300028380 Ga0268265_10019842 Ga0268265_100198422 180
221 3300028380 Ga0268265_10673561 Ga0268265_106735612 180
222 3300028573 Ga0265334_10056727 Ga0265334_100567272 180
223 3300028653 Ga0265323_10032452 Ga0265323_100324523 180
224 3300028666 Ga0265336_10051443 Ga0265336_100514432 180
225 3300028800 Ga0265338_10006168 Ga0265338_100061682 180
226 3300028800 Ga0265338_10025848 Ga0265338_100258482 180
227 3300031665 Ga0316575_10031122 Ga0316575_100311222 180
228 3300031727 Ga0316576_10152996 Ga0316576_101529963 180
229 3300031727 Ga0316576_10672943 Ga0316576_106729431 180
230 3300031728 Ga0316578_10167427 Ga0316578_101674271 180
231 3300031903 Ga0307407_11317695 Ga0307407_113176951 180
232 3300031995 Ga0307409_100423460 Ga0307409_1004234602 180
233 3300032002 Ga0307416_100522839 Ga0307416_1005228392 180
234 3300032126 Ga0307415_101116879 Ga0307415_1011168792 180
235 3300032133 Ga0316583_10051932 Ga0316583_100519322 180
236 3300032139 Ga0316580_10010259 Ga0316580_100102593 180
237 3300036401 Ga0373937_0097492 Ga0373937_0097492_555_1109 180
238 3300036647 Ga0316582_0057382 Ga0316582_0057382_1912_2454 180
239 3300038443 Ga0395901_0354892 Ga0395901_0354892_87_629 180
240 3300039437 Ga0436365_1837670 Ga0436365_1837670_3839_4390 180
241 3300039438 Ga0436360_0314870 Ga0436360_0314870_467_1009 180
242 3300039450 Ga0436363_0868802 Ga0436363_0868802_734_1297 180
243 3300039453 Ga0436362_0006970 Ga0436362_0006970_611_1162 180
244 3300039453 Ga0436362_0527205 Ga0436362_0527205_7262_7825 180
245 3300042876 Ga0451577_0741218 Ga0451577_0741218_309_851 180
246 3300044673 Ga0453683_0559656 Ga0453683_0559656_135_677 180
247 3300044712 Ga0453684_0017556 Ga0453684_0017556_383_925 180
248 3300044712 Ga0453684_0186378 Ga0453684_0186378_212_754 180
249 3300044712 Ga0453684_0236753 Ga0453684_0236753_591_1133 180
250 3300044712 Ga0453684_1339560 Ga0453684_1339560_123_665 180
251 3300045976 Ga0466967_0456826 Ga0466967_0456826_543_1094 180
252 3300046473 Ga0495582_0003298 Ga0495582_0003298_4206_4748 180
253 3300046559 Ga0495667_0212628 Ga0495667_0212628_500_1042 180
254 3300046664 Ga0495659_0108699 Ga0495659_0108699_300_842 180
255 3300046689 Ga0495613_0782977 Ga0495613_0782977_24_566 180
256 3300047317 Ga0495604_0207842 Ga0495604_0207842_266_808 180
257 3300047319 Ga0495674_0021044 Ga0495674_0021044_2213_2767 180
258 3300047319 Ga0495674_0073972 Ga0495674_0073972_632_1204 180
259 3300047319 Ga0495674_0394927 Ga0495674_0394927_412_954 180
260 3300047444 Ga0495675_0176755 Ga0495675_0176755_557_1099 180
261 3300047444 Ga0495675_0412683 Ga0495675_0412683_86_628 180
262 3300047445 Ga0495677_0333609 Ga0495677_0333609_27_569 180
263 3300048907 Ga0496104_0044178 Ga0496104_0044178_903_1463 180
264 3300048912 Ga0496109_0308775 Ga0496109_0308775_737_1297 180
265 3300048913 Ga0496110_0002733 Ga0496110_0002733_5873_6433 180
266 3300048914 Ga0496111_0102812 Ga0496111_0102812_1092_1652 180
267 3300048915 Ga0496112_0050965 Ga0496112_0050965_563_1123 180
268 3300049568 Ga0501031_0000806 Ga0501031_0000806_14165_14719 180
269 3300049569 Ga0501032_0016548 Ga0501032_0016548_3189_3743 180
270 3300049570 Ga0501033_0000294 Ga0501033_0000294_12877_13431 180
271 3300049570 Ga0501033_0326534 Ga0501033_0326534_111_653 180
272 3300049571 Ga0501034_0020831 Ga0501034_0020831_2035_2589 180
273 3300049572 Ga0501036_0005562 Ga0501036_0005562_8218_8772 180
274 3300049573 Ga0501037_0000378 Ga0501037_0000378_13574_14128 180
275 3300049574 Ga0501038_0000087 Ga0501038_0000087_1458_2012 180
276 3300049574 Ga0501038_0098932 Ga0501038_0098932_823_1365 180
277 3300049575 Ga0501039_0001020 Ga0501039_0001020_6974_7528 180
278 3300049576 Ga0501040_0000007 Ga0501040_0000007_13079_13633 180
279 3300049577 Ga0501041_0000005 Ga0501041_0000005_66098_66652 180
280 3300049577 Ga0501041_0157787 Ga0501041_0157787_451_1008 180
281 3300049577 Ga0501041_0729245 Ga0501041_0729245_23_568 180
282 3300049578 Ga0501042_0003216 Ga0501042_0003216_8218_8772 180
283 3300049579 Ga0501043_0000998 Ga0501043_0000998_22887_23441 180
284 3300049580 Ga0501046_0001278 Ga0501046_0001278_10804_11358 180
285 3300049580 Ga0501046_0130009 Ga0501046_0130009_982_1524 180
286 3300049581 Ga0501047_0000592 Ga0501047_0000592_10794_11348 180
287 3300049581 Ga0501047_0001775 Ga0501047_0001775_897_1439 180
288 3300049581 Ga0501047_0007269 Ga0501047_0007269_7565_8107 180
289 3300049581 Ga0501047_0007794 Ga0501047_0007794_6021_6563 180
290 3300049582 Ga0501048_0000184 Ga0501048_0000184_34559_35113 180
291 3300049583 Ga0501067_0029113 Ga0501067_0029113_2495_3037 180
292 3300049584 Ga0501068_0000134 Ga0501068_0000134_27245_27799 180
293 3300049584 Ga0501068_0013586 Ga0501068_0013586_565_1107 180
294 3300049585 Ga0501069_0000426 Ga0501069_0000426_1441_1995 180
295 3300049585 Ga0501069_0037257 Ga0501069_0037257_2126_2668 180
296 3300049586 Ga0501070_0016073 Ga0501070_0016073_4203_4757 180
297 3300049586 Ga0501070_0016393 Ga0501070_0016393_2666_3208 180
298 3300049586 Ga0501070_0039947 Ga0501070_0039947_893_1435 180
299 3300049586 Ga0501070_0253288 Ga0501070_0253288_221_763 180
300 3300049586 Ga0501070_0398260 Ga0501070_0398260_197_754 180
301 3300049587 Ga0501071_0000005 Ga0501071_0000005_76736_77290 180
302 3300049588 Ga0501072_0000269 Ga0501072_0000269_14590_15144 180
303 3300049588 Ga0501072_0365706 Ga0501072_0365706_581_1123 180
304 3300049589 Ga0501073_0001327 Ga0501073_0001327_16249_16803 180
305 3300049589 Ga0501073_0154117 Ga0501073_0154117_382_924 180
306 3300049589 Ga0501073_0973661 Ga0501073_0973661_19_561 180
307 3300049590 Ga0501074_0001138 Ga0501074_0001138_3857_4411 180
308 3300049590 Ga0501074_0240121 Ga0501074_0240121_234_776 180
309 3300049591 Ga0501075_0000009 Ga0501075_0000009_5495_6049 180
310 3300049592 Ga0501076_0000028 Ga0501076_0000028_1458_2012 180
311 3300049593 Ga0501077_0000006 Ga0501077_0000006_34559_35113 180
312 3300049741 Ga0501079_0000881 Ga0501079_0000881_8090_8644 180
313 3300049741 Ga0501079_0167594 Ga0501079_0167594_104_661 180
314 3300049742 Ga0501080_0000626 Ga0501080_0000626_27307_27861 180
315 3300049742 Ga0501080_0009753 Ga0501080_0009753_8106_8648 180
316 3300049742 Ga0501080_0076981 Ga0501080_0076981_292_834 180
317 3300049742 Ga0501080_0254124 Ga0501080_0254124_818_1360 180
318 3300049743 Ga0501081_0000003 Ga0501081_0000003_14590_15144 180
319 3300049744 Ga0501083_0001918 Ga0501083_0001918_3092_3646 180
320 3300049744 Ga0501083_0006289 Ga0501083_0006289_3359_3901 180
321 3300049822 Ga0501035_0000175 Ga0501035_0000175_1458_2012 180
322 3300049823 Ga0501044_0002291 Ga0501044_0002291_17792_18334 180
323 3300049823 Ga0501044_0027638 Ga0501044_0027638_3980_4522 180
324 3300049823 Ga0501044_0037000 Ga0501044_0037000_3092_3646 180
325 3300049824 Ga0501045_0000009 Ga0501045_0000009_13078_13632 180
326 3300049824 Ga0501045_0171615 Ga0501045_0171615_690_1247 180
327 3300050507 nmdc:mga05p37_146597_c1 nmdc:mga05p37_146597_c1_1556_2098 180
328 3300050507 nmdc:mga05p37_213779_c1 nmdc:mga05p37_213779_c1_1318_1860 180
329 3300050507 nmdc:mga05p37_263711_c1 nmdc:mga05p37_263711_c1_550_1092 180
330 3300050507 nmdc:mga05p37_55790_c1 nmdc:mga05p37_55790_c1_1500_2042 180
331 3300050508 nmdc:mga09592_16120_c1 nmdc:mga09592_16120_c1_4435_4977 180
332 3300050508 nmdc:mga09592_57552_c1 nmdc:mga09592_57552_c1_590_1132 180
333 3300050508 nmdc:mga09592_62811_c1 nmdc:mga09592_62811_c1_1017_1559 180
334 3300050508 nmdc:mga09592_87843_c1 nmdc:mga09592_87843_c1_126_668 180
335 3300050509 nmdc:mga0qj67_1298_c2 nmdc:mga0qj67_1298_c2_199_741 180
336 3300050509 nmdc:mga0qj67_90105_c1 nmdc:mga0qj67_90105_c1_1542_2084 180
337 3300050510 nmdc:mga06r32_473666_c1 nmdc:mga06r32_473666_c1_349_891 180
338 3300050512 nmdc:mga0n895_121650_c1 nmdc:mga0n895_121650_c1_2059_2610 180
339 3300050512 nmdc:mga0n895_457207_c1 nmdc:mga0n895_457207_c1_93_635 180
340 3300050514 nmdc:mga08x19_359101_c1 nmdc:mga08x19_359101_c1_118_669 180
341 3300053093 Ga0500651_0224590 Ga0500651_0224590_495_1037 180
342 3300053119 Ga0500595_000731 Ga0500595_000731_14407_14949 180
343 3300053151 Ga0500604_0014821 Ga0500604_0014821_1014_1556 180
344 3300054114 Ga0501084_0005874 Ga0501084_0005874_1458_2012 180
345 3300054114 Ga0501084_0010706 Ga0501084_0010706_2936_3478 180
346 3300060353 Ga0501082_0000063 Ga0501082_0000063_66895_67449 180
347 3300060353 Ga0501082_0001543 Ga0501082_0001543_13067_13609 180
348 3300061734 Ga0530510_0000014 Ga0530510_0000014_92262_92816 180
349 iso_pu_bacteria 2512564039 2512732195 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

37

169

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.7968 1 167
8eq3-assembly1.cif.gz_A-2 escherichia coli pyruvate kinase a301t 0.7922 85 167
8eds-assembly1.cif.gz_B-2 escherichia coli pyruvate kinase (pykf) p70q 0.7912 85 167
4yng-assembly1.cif.gz_C twinned pyruvate kinase from e. coli in the t-state 0.7883 85 167
8eq0-assembly1.cif.gz_B escherichia coli pyruvate kinase g381a 0.7808 85 167
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7896 2 171 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7603 2 171 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7301 2 176 2.40.33.20
af_A1Z803_208_336_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7141 60 166 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7091 5 174 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A519GX66-F1-model_v4 MOSC domain-containing protein 0.9982 1 129 GO:0003824
GO:0030151
GO:0030170
AF-A0A6B2TSH5-F1-model_v4 deleted 0.9981 4 180
AF-A0A2W6C6V1-F1-model_v4 MOSC domain-containing protein 0.9966 1 180 GO:0003824
GO:0030151
GO:0030170
AF-A0A4Q3P7J3-F1-model_v4 deleted 0.9957 3 115
AF-A0A2U0TIR6-F1-model_v4 deleted 0.9944 1 180

Feature Viewer

pLDDT pTM Quality
94.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map