F417587

General Info

Members Datasets Scaffolds Average Seq Length
348 239 345 153

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100709460|Ga0307408_1007094602
Length 167
Sequence MYESVPGGIVTVKRMDNVGIVVEDIDAAVAFFSELGLTLEGRMPIEGEWAGRVTGLHGQRVEIAMMCTPDGHSRLELSRFDEPAIVSDHRTAPVNSLGYLRVMFTVDDIDDTLARLTELGATVVDEVVDYEDVYRLCYIRGPEGILIGLAQQLGQQTSRENPIERKR

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.29
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.29
Rhizoplane 2.87
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10172043 3300005289 Bacteria 1286
2 Ga0065707_10008856 3300005295 Bacteria 3805
3 Ga0070658_11443489 3300005327 Bacteria 597
4 Ga0070690_100018721 3300005330 Bacteria 4188
5 Ga0068869_100000209 3300005334 Bacteria 30398
6 Ga0070666_10726288 3300005335 Bacteria 729
7 Ga0070680_100009146 3300005336 Bacteria 7598
8 Ga0070680_100096631 3300005336 Bacteria 2449
9 Ga0070680_100559460 3300005336 Bacteria 980
10 Ga0070680_100873609 3300005336 Bacteria 775
11 Ga0068868_100997576 3300005338 Bacteria 766
12 Ga0068868_101576082 3300005338 Bacteria 616
13 Ga0070660_100865124 3300005339 Bacteria 761
14 Ga0070689_100000715 3300005340 Bacteria 20226
15 Ga0070689_100057082 3300005340 Bacteria 3029
16 Ga0070691_10002903 3300005341 Bacteria 7684
17 Ga0070687_100007507 3300005343 Bacteria 4551
18 Ga0070661_100273046 3300005344 Bacteria 1310
19 Ga0070661_100478153 3300005344 Bacteria 994
20 Ga0070675_100323106 3300005354 Bacteria 1363
21 Ga0070688_100052775 3300005365 Bacteria 2541
22 Ga0070667_100017185 3300005367 Bacteria 5991
23 Ga0070667_100396372 3300005367 Bacteria 1256
24 Ga0070701_10000474 3300005438 Bacteria 13761
25 Ga0070705_100008457 3300005440 Bacteria 5099
26 Ga0070694_100003366 3300005444 Bacteria 9577
27 Ga0070708_100138552 3300005445 Bacteria 2255
28 Ga0070678_100304346 3300005456 Bacteria 1356
29 Ga0070681_10077121 3300005458 Bacteria 3290
30 Ga0070681_10229751 3300005458 Bacteria 1770
31 Ga0070681_10402313 3300005458 Bacteria 1280
32 Ga0070681_10740297 3300005458 Bacteria 899
33 Ga0068867_101164653 3300005459 Bacteria 706
34 Ga0070685_10155531 3300005466 Bacteria 1453
35 Ga0070706_101738815 3300005467 Bacteria 567
36 Ga0070707_100449228 3300005468 Bacteria 1250
37 Ga0070698_100463412 3300005471 Bacteria 1203
38 Ga0070699_100001420 3300005518 Bacteria 22009
39 Ga0070699_100082244 3300005518 Bacteria 2807
40 Ga0070699_100101393 3300005518 Bacteria 2523
41 Ga0070679_100022460 3300005530 Bacteria 6166
42 Ga0070679_100929307 3300005530 Bacteria 813
43 Ga0070684_100071530 3300005535 Bacteria 3052
44 Ga0070684_100181390 3300005535 Bacteria 1914
45 Ga0070697_101539230 3300005536 Bacteria 594
46 Ga0068853_100056601 3300005539 Bacteria 3382
47 Ga0068853_100161822 3300005539 Bacteria 2020
48 Ga0068853_101378707 3300005539 Bacteria 682
49 Ga0070672_100637892 3300005543 Bacteria 930
50 Ga0070686_100000493 3300005544 Bacteria 23885
51 Ga0070686_100538689 3300005544 Bacteria 911
52 Ga0070695_100002310 3300005545 Bacteria 10933
53 Ga0070696_100000170 3300005546 Bacteria 37218
54 Ga0070693_100000171 3300005547 Bacteria 29969
55 Ga0070665_101173992 3300005548 Bacteria 779
56 Ga0070704_100002324 3300005549 Bacteria 10648
57 Ga0068855_100001801 3300005563 Bacteria 26787
58 Ga0070664_101054741 3300005564 Bacteria 765
59 Ga0068854_100000817 3300005578 Bacteria 18611
60 Ga0068856_100154385 3300005614 Bacteria 2305
61 Ga0068856_100895965 3300005614 Bacteria 906
62 Ga0070702_100007600 3300005615 Bacteria 5194
63 Ga0068859_100000935 3300005617 Bacteria 29960
64 Ga0068859_100362916 3300005617 Bacteria 1544
65 Ga0068866_10000239 3300005718 Bacteria 25871
66 Ga0068861_100000070 3300005719 Bacteria 49394
67 Ga0068861_100081606 3300005719 Bacteria 2532
68 Ga0068861_101310083 3300005719 Bacteria 704
69 Ga0068863_100198837 3300005841 Bacteria 1927
70 Ga0068858_100029840 3300005842 Bacteria 5066
71 Ga0068858_100102650 3300005842 Bacteria 2667
72 Ga0068858_100378271 3300005842 Bacteria 1359
73 Ga0068860_100063129 3300005843 Bacteria 3519
74 Ga0068862_100016181 3300005844 Bacteria 6203
75 Ga0068862_100094251 3300005844 Bacteria 2611
76 Ga0070715_10104649 3300006163 Bacteria 1326
77 Ga0097621_100043969 3300006237 Bacteria 3602
78 Ga0097621_100103882 3300006237 Bacteria 2394
79 Ga0068871_100011838 3300006358 Bacteria 6413
80 Ga0075430_100002158 3300006846 Bacteria 16291
81 Ga0075430_100280923 3300006846 Bacteria 1377
82 Ga0075431_100002260 3300006847 Bacteria 18464
83 Ga0075431_100145502 3300006847 Bacteria 2442
84 Ga0075433_10270349 3300006852 Bacteria 1506
85 Ga0075433_10387396 3300006852 Bacteria 1234
86 Ga0075434_100346628 3300006871 Bacteria 1506
87 Ga0075429_100010293 3300006880 Bacteria 8093
88 Ga0075429_100311275 3300006880 Bacteria 1378
89 Ga0068865_100000242 3300006881 Bacteria 30369
90 Ga0097620_100000935 3300006931 Bacteria 29960
91 Ga0097620_100209305 3300006931 Bacteria 2036
92 Ga0097620_100362897 3300006931 Bacteria 1544
93 Ga0075435_100250899 3300007076 Bacteria 1506
94 Ga0111539_10002380 3300009094 Bacteria 24972
95 Ga0111539_10242131 3300009094 Bacteria 2100
96 Ga0111539_11453295 3300009094 Unclassified 795
97 Ga0114129_10006657 3300009147 Bacteria 16407
98 Ga0114129_10543329 3300009147 Bacteria 1512
99 Ga0114129_10945857 3300009147 Bacteria 1089
100 Ga0105243_10001507 3300009148 Bacteria 20391
101 Ga0105241_10010156 3300009174 Bacteria 6914
102 Ga0105242_10000161 3300009176 Bacteria 50082
103 Ga0105237_10043869 3300009545 Bacteria 4503
104 Ga0105237_10147755 3300009545 Bacteria 2346
105 Ga0105249_10001161 3300009553 Bacteria 23275
106 Ga0105249_11073727 3300009553 Bacteria 875
107 Ga0099796_10186055 3300010159 Bacteria 836
108 Ga0099796_10325585 3300010159 Bacteria 657
109 Ga0105239_10035067 3300010375 Bacteria 5510
110 Ga0105239_10061047 3300010375 Bacteria 4137
111 Ga0105239_11350735 3300010375 Bacteria 822
112 Ga0157341_1022883 3300012494 Bacteria 628
113 Ga0157369_11497369 3300013105 Bacteria 686
114 Ga0157378_10015314 3300013297 Bacteria 6716
115 Ga0163162_10046381 3300013306 Bacteria 4355
116 Ga0163162_10621925 3300013306 Bacteria 1205
117 Ga0157375_10948720 3300013308 Bacteria 1002
118 Ga0163163_10497119 3300014325 Bacteria 1281
119 Ga0157380_10029643 3300014326 Bacteria 4184
120 Ga0182008_10116710 3300014497 Bacteria 1325
121 Ga0157379_11359920 3300014968 Bacteria 687
122 Ga0157379_11717787 3300014968 Bacteria 615
123 Ga0157376_12024039 3300014969 Bacteria 614
124 Ga0163161_10000551 3300017792 Bacteria 30373
125 Ga0206353_10980918 3300020082 Bacteria 1772
126 Ga0207656_10058185 3300025321 Bacteria 1688
127 Ga0207682_10132895 3300025893 Bacteria 1112
128 Ga0207692_10184383 3300025898 Bacteria 1218
129 Ga0207642_10000915 3300025899 Bacteria 9230
130 Ga0207642_10176067 3300025899 Bacteria 1161
131 Ga0207688_10098157 3300025901 Bacteria 1688
132 Ga0207688_10414277 3300025901 Bacteria 837
133 Ga0207647_10062020 3300025904 Bacteria 2279
134 Ga0207685_10253228 3300025905 Bacteria 852
135 Ga0207645_10023297 3300025907 Bacteria 4025
136 Ga0207705_10402897 3300025909 Bacteria 1058
137 Ga0207705_11202091 3300025909 Bacteria 581
138 Ga0207684_10036650 3300025910 Bacteria 4162
139 Ga0207654_10065617 3300025911 Bacteria 2138
140 Ga0207654_10152713 3300025911 Bacteria 1484
141 Ga0207707_10026803 3300025912 Bacteria 5037
142 Ga0207707_10030670 3300025912 Bacteria 4703
143 Ga0207707_10316390 3300025912 Bacteria 1348
144 Ga0207671_10008451 3300025914 Bacteria 8727
145 Ga0207660_10198725 3300025917 Bacteria 1565
146 Ga0207660_10905715 3300025917 Bacteria 720
147 Ga0207662_10000479 3300025918 Bacteria 17918
148 Ga0207662_10001816 3300025918 Bacteria 10480
149 Ga0207662_10045021 3300025918 Bacteria 2608
150 Ga0207657_10496775 3300025919 Bacteria 956
151 Ga0207649_10153335 3300025920 Bacteria 1589
152 Ga0207649_10595586 3300025920 Bacteria 850
153 Ga0207652_10033703 3300025921 Bacteria 4313
154 Ga0207652_11267320 3300025921 Bacteria 639
155 Ga0207646_10088713 3300025922 Bacteria 2767
156 Ga0207646_10397811 3300025922 Bacteria 1244
157 Ga0207659_10129952 3300025926 Bacteria 1942
158 Ga0207687_10000267 3300025927 Bacteria 35541
159 Ga0207687_10492791 3300025927 Bacteria 1022
160 Ga0207644_10511585 3300025931 Bacteria 991
161 Ga0207690_10346079 3300025932 Bacteria 1174
162 Ga0207686_10001798 3300025934 Bacteria 11920
163 Ga0207686_10022309 3300025934 Bacteria 3645
164 Ga0207709_10120930 3300025935 Bacteria 1768
165 Ga0207670_10000833 3300025936 Bacteria 16162
166 Ga0207670_10220498 3300025936 Bacteria 1451
167 Ga0207670_10560227 3300025936 Bacteria 935
168 Ga0207669_10045366 3300025937 Bacteria 2589
169 Ga0207704_10000603 3300025938 Bacteria 15864
170 Ga0207704_10025944 3300025938 Bacteria 3207
171 Ga0207665_10280062 3300025939 Bacteria 1241
172 Ga0207691_10001079 3300025940 Bacteria 27155
173 Ga0207711_10026903 3300025941 Bacteria 4828
174 Ga0207711_10145509 3300025941 Bacteria 2135
175 Ga0207689_10000200 3300025942 Bacteria 52703
176 Ga0207679_10103482 3300025945 Bacteria 2231
177 Ga0207679_10610212 3300025945 Bacteria 984
178 Ga0207667_10125325 3300025949 Bacteria 2645
179 Ga0207651_10035582 3300025960 Bacteria 3241
180 Ga0207712_10004385 3300025961 Bacteria 8914
181 Ga0207640_10008663 3300025981 Bacteria 5656
182 Ga0207658_10010508 3300025986 Bacteria 6288
183 Ga0207658_10123941 3300025986 Bacteria 2065
184 Ga0207658_10500767 3300025986 Bacteria 1082
185 Ga0207658_11226301 3300025986 Bacteria 686
186 Ga0207677_10045458 3300026023 Bacteria 2932
187 Ga0207677_10837385 3300026023 Bacteria 826
188 Ga0207677_10886685 3300026023 Bacteria 803
189 Ga0207703_10000937 3300026035 Bacteria 28276
190 Ga0207703_10001427 3300026035 Bacteria 21805
191 Ga0207703_10040147 3300026035 Bacteria 3744
192 Ga0207639_10143991 3300026041 Bacteria 1989
193 Ga0207678_10432116 3300026067 Bacteria 1143
194 Ga0207708_10203496 3300026075 Bacteria 1580
195 Ga0207702_11101345 3300026078 Bacteria 788
196 Ga0207641_10235761 3300026088 Bacteria 1703
197 Ga0207648_10000309 3300026089 Bacteria 53487
198 Ga0207674_11530816 3300026116 Bacteria 636
199 Ga0207675_100000089 3300026118 Bacteria 71258
200 Ga0207675_100093547 3300026118 Bacteria 2828
201 Ga0207683_10687065 3300026121 Bacteria 949
202 Ga0207698_10118592 3300026142 Bacteria 2235
203 Ga0207698_11003637 3300026142 Bacteria 845
204 Ga0209971_1046972 3300027682 Bacteria 1042
205 Ga0209998_10009431 3300027717 Bacteria 2027
206 Ga0209974_10114805 3300027876 Bacteria 950
207 Ga0207428_10028434 3300027907 Bacteria 4645
208 Ga0268266_10881927 3300028379 Bacteria 865
209 Ga0268265_10004854 3300028380 Bacteria 9267
210 Ga0268265_10034919 3300028380 Bacteria 3669
211 Ga0268264_10002468 3300028381 Bacteria 16258
212 Ga0307515_10178576 3300028794 Bacteria 2083
213 Ga0307515_10187388 3300028794 Bacteria 1993
214 Ga0307515_10248504 3300028794 Bacteria 1536
215 Ga0265331_10058702 3300031250 Bacteria 1821
216 Ga0265327_10059727 3300031251 Bacteria 1951
217 Ga0265327_10146820 3300031251 Bacteria 1098
218 Ga0307513_10323619 3300031456 Bacteria 1299
219 Ga0307513_10379778 3300031456 Bacteria 1153
220 Ga0307513_10789119 3300031456 Bacteria 655
221 Ga0307408_100709460 3300031548 Bacteria 905
222 Ga0307508_10006589 3300031616 Bacteria 10904
223 Ga0307516_10378211 3300031730 Bacteria 1078
224 Ga0307413_10311266 3300031824 Bacteria 1199
225 Ga0307410_10137489 3300031852 Bacteria 1803
226 Ga0307410_10977230 3300031852 Bacteria 729
227 Ga0307406_12015543 3300031901 Bacteria 516
228 Ga0307407_10837358 3300031903 Bacteria 702
229 Ga0307412_10469103 3300031911 Bacteria 1041
230 Ga0307412_10505491 3300031911 Bacteria 1007
231 Ga0307409_100708283 3300031995 Bacteria 1007
232 Ga0307409_100818788 3300031995 Bacteria 940
233 Ga0307416_100091362 3300032002 Bacteria 2615
234 Ga0307416_100557696 3300032002 Bacteria 1220
235 Ga0307416_100630087 3300032002 Bacteria 1155
236 Ga0307411_10082744 3300032005 Bacteria 2215
237 Ga0307411_10088089 3300032005 Bacteria 2158
238 Ga0307411_11392257 3300032005 Bacteria 642
239 Ga0307510_10009383 3300033180 Bacteria 11658
240 Ga0373930_0007414 3300034816 Bacteria 1888
241 Ga0373948_0006004 3300034817 Bacteria 1990
242 Ga0373958_0028376 3300034819 Bacteria 1083
243 Ga0373938_0034356 3300034957 Bacteria 1101
244 Ga0373928_0005706 3300035084 Bacteria 2380
245 Ga0373951_0020634 3300035091 Bacteria 1510
246 Ga0373932_0045276 3300035112 Bacteria 1286
247 Ga0373953_0302864 3300035117 Bacteria 698
248 Ga0373954_0344151 3300035118 Bacteria 736
249 Ga0373957_0095276 3300035120 Bacteria 1187
250 Ga0373955_0092511 3300035172 Bacteria 1725
251 Ga0373942_0140532 3300035207 Bacteria 768
252 Ga0373961_0009898 3300035241 Bacteria 2339
253 Ga0373962_0165536 3300035242 Bacteria 732
254 Ga0373931_0012070 3300035691 Bacteria 4182
255 Ga0373947_1002239 3300035725 Bacteria 570
256 Ga0373937_0507166 3300036401 Bacteria 1146
257 Ga0373925_1396440 3300037068 Bacteria 574
258 Ga0395899_0128530 3300037312 Bacteria 1811
259 Ga0395905_0000903 3300037471 Bacteria 38615
260 Ga0395905_0231226 3300037471 Bacteria 1729
261 Ga0395901_0067793 3300038443 Bacteria 3717
262 Ga0436361_0047415 3300039447 Bacteria 544
263 Ga0436363_0613261 3300039450 Bacteria 671
264 Ga0451798_0867454 3300041458 Bacteria 847
265 Ga0451800_1164648 3300041459 Bacteria 1657
266 Ga0451807_1203434 3300041486 Bacteria 2137
267 Ga0451845_0384025 3300041501 Bacteria 678
268 Ga0439432_157848 3300042006 Bacteria 664
269 Ga0439455_0075845 3300042012 Bacteria 909
270 Ga0450896_066923 3300042133 Bacteria 591
271 Ga0439458_0010319 3300042157 Bacteria 2082
272 Ga0439435_0138519 3300042436 Bacteria 774
273 Ga0439464_0099224 3300042439 Bacteria 883
274 Ga0451577_0800785 3300042876 Bacteria 851
275 Ga0453683_0043160 3300044673 Bacteria 2830
276 Ga0466963_0052684 3300044694 Bacteria 2700
277 Ga0453684_0041603 3300044712 Bacteria 6211
278 Ga0466957_0756418 3300044842 Bacteria 688
279 Ga0466960_0030466 3300044901 Bacteria 2483
280 Ga0466967_0658857 3300045976 Bacteria 1035
281 Ga0495583_0000739 3300046506 Bacteria 41524
282 Ga0495663_0011755 3300046525 Bacteria 2437
283 Ga0495621_0000214 3300046539 Bacteria 13505
284 Ga0495684_1074844 3300047471 Bacteria 506
285 Ga0496100_0041477 3300048903 Bacteria 2934
286 Ga0496102_0108774 3300048905 Bacteria 2582
287 Ga0496114_0000324 3300048917 Bacteria 34974
288 Ga0496114_0058783 3300048917 Bacteria 3211
289 Ga0496114_0673987 3300048917 Bacteria 908
290 Ga0496115_0035313 3300048918 Bacteria 3955
291 Ga0496115_0747354 3300048918 Bacteria 765
292 Ga0496119_0149923 3300048922 Bacteria 1251
293 Ga0496125_0014318 3300048928 Bacteria 7729
294 Ga0501033_0676418 3300049570 Bacteria 704
295 Ga0501040_0949814 3300049576 Bacteria 623
296 Ga0501042_0448836 3300049578 Bacteria 935
297 Ga0501042_1120075 3300049578 Bacteria 574
298 Ga0501043_0148040 3300049579 Bacteria 1838
299 Ga0501046_0753693 3300049580 Bacteria 684
300 Ga0501070_0038360 3300049586 Bacteria 3997
301 Ga0501070_0297203 3300049586 Bacteria 1316
302 Ga0501070_0594853 3300049586 Bacteria 882
303 Ga0501071_0000800 3300049587 Bacteria 16804
304 Ga0501071_0020118 3300049587 Bacteria 4638
305 Ga0501072_0002984 3300049588 Bacteria 12752
306 Ga0501072_0946736 3300049588 Bacteria 672
307 Ga0501073_0326875 3300049589 Bacteria 1059
308 Ga0501075_0024442 3300049591 Bacteria 4431
309 Ga0501075_0801385 3300049591 Bacteria 717
310 Ga0501076_0170645 3300049592 Bacteria 1773
311 Ga0501077_0102782 3300049593 Bacteria 1811
312 Ga0501077_0324386 3300049593 Bacteria 982
313 Ga0501077_0894670 3300049593 Bacteria 571
314 Ga0501249_063428 3300049679 Bacteria 858
315 Ga0501257_013559 3300049686 Bacteria 1870
316 Ga0501079_0112077 3300049741 Bacteria 2120
317 Ga0501080_0028834 3300049742 Bacteria 5167
318 Ga0501080_0350329 3300049742 Bacteria 1333
319 Ga0501080_0670571 3300049742 Bacteria 916
320 Ga0501080_0724340 3300049742 Bacteria 876
321 Ga0501081_0151003 3300049743 Bacteria 1669
322 Ga0501081_0176063 3300049743 Bacteria 1546
323 Ga0501083_0000507 3300049744 Bacteria 24796
324 Ga0501083_0049082 3300049744 Bacteria 2847
325 Ga0501083_0515817 3300049744 Bacteria 778
326 Ga0501044_0002665 3300049823 Bacteria 20304
327 nmdc:mga05p37_1738657_c1 3300050507 Bacteria 606
328 nmdc:mga05p37_43832_c1 3300050507 Bacteria 5505
329 nmdc:mga05p37_4765_c1 3300050507 Bacteria 15845
330 nmdc:mga0qj67_16933_c1 3300050509 Bacteria 5536
331 nmdc:mga0qj67_18224_c1 3300050509 Bacteria 5349
332 nmdc:mga0qj67_194372_c1 3300050509 Bacteria 1649
333 nmdc:mga0qj67_437540_c1 3300050509 Bacteria 1054
334 nmdc:mga06r32_243710_c1 3300050510 Bacteria 1785
335 nmdc:mga06r32_26430_c1 3300050510 Bacteria 5412
336 nmdc:mga08y16_5682_c1 3300050511 Bacteria 13068
337 nmdc:mga0n895_340282_c1 3300050512 Bacteria 1520
338 nmdc:mga0n895_726165_c1 3300050512 Bacteria 988
339 nmdc:mga0rr50_41009_c1 3300050513 Bacteria 3370
340 nmdc:mga08x19_2907_c2 3300050514 Bacteria 9456
341 nmdc:mga0a205_116101_c1 3300050515 Bacteria 2575
342 nmdc:mga0a205_287306_c1 3300050515 Bacteria 1520
343 Ga0495601_0761736 3300053077 Bacteria 616
344 Ga0590077_032510 3300059426 Bacteria 1143
345 Ga0501082_1830982 3300060353 Bacteria 529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10147755 Ga0105237_101477552 128
2 3300013105 Ga0157369_11497369 Ga0157369_114973691 130
3 3300049579 Ga0501043_0148040 Ga0501043_0148040_556_972 138
4 3300005336 Ga0070680_100096631 Ga0070680_1000966311 140
5 3300005344 Ga0070661_100478153 Ga0070661_1004781532 140
6 3300005535 Ga0070684_100071530 Ga0070684_1000715303 140
7 3300005535 Ga0070684_100181390 Ga0070684_1001813903 140
8 3300005614 Ga0068856_100895965 Ga0068856_1008959652 140
9 3300013308 Ga0157375_10948720 Ga0157375_109487202 140
10 3300020082 Ga0206353_10980918 Ga0206353_109809182 140
11 3300025909 Ga0207705_10402897 Ga0207705_104028972 140
12 3300025920 Ga0207649_10153335 Ga0207649_101533351 140
13 3300025945 Ga0207679_10610212 Ga0207679_106102122 140
14 3300026142 Ga0207698_10118592 Ga0207698_101185922 140
15 3300026142 Ga0207698_11003637 Ga0207698_110036371 140
16 3300039450 Ga0436363_0613261 Ga0436363_0613261_63_485 140
17 3300044694 Ga0466963_0052684 Ga0466963_0052684_1945_2367 140
18 3300044842 Ga0466957_0756418 Ga0466957_0756418_44_466 140
19 3300044901 Ga0466960_0030466 Ga0466960_0030466_695_1117 140
20 3300045976 Ga0466967_0658857 Ga0466967_0658857_473_895 140
21 3300048917 Ga0496114_0673987 Ga0496114_0673987_112_534 140
22 3300049586 Ga0501070_0297203 Ga0501070_0297203_218_670 140
23 3300049586 Ga0501070_0594853 Ga0501070_0594853_40_462 140
24 3300049588 Ga0501072_0002984 Ga0501072_0002984_9601_10023 140
25 3300049742 Ga0501080_0350329 Ga0501080_0350329_782_1204 140
26 3300049744 Ga0501083_0000507 Ga0501083_0000507_22110_22532 140
27 3300013297 Ga0157378_10015314 Ga0157378_1001531412 141
28 iso_pu_bacteria 2512047030 2512352691 141
29 iso_pu_bacteria 8002869464 8002870539 142
30 3300005617 Ga0068859_100362916 Ga0068859_1003629162 143
31 3300006931 Ga0097620_100362897 Ga0097620_1003628972 143
32 3300010375 Ga0105239_10035067 Ga0105239_100350674 143
33 3300042439 Ga0439464_0099224 Ga0439464_0099224_258_689 143
34 3300014325 Ga0163163_10497119 Ga0163163_104971192 144
35 3300025937 Ga0207669_10045366 Ga0207669_100453663 144
36 3300031911 Ga0307412_10469103 Ga0307412_104691031 144
37 3300049686 Ga0501257_013559 Ga0501257_013559_394_828 144
38 3300050509 nmdc:mga0qj67_437540_c1 nmdc:mga0qj67_437540_c1_565_999 144
39 iso_pu_bacteria 2643221695 2644528112 144
40 3300005295 Ga0065707_10008856 Ga0065707_100088562 145
41 3300005334 Ga0068869_100000209 Ga0068869_10000020917 145
42 3300005340 Ga0070689_100000715 Ga0070689_1000007157 145
43 3300005341 Ga0070691_10002903 Ga0070691_100029039 145
44 3300005354 Ga0070675_100323106 Ga0070675_1003231061 145
45 3300005438 Ga0070701_10000474 Ga0070701_100004744 145
46 3300005440 Ga0070705_100008457 Ga0070705_1000084573 145
47 3300005444 Ga0070694_100003366 Ga0070694_1000033662 145
48 3300005458 Ga0070681_10077121 Ga0070681_100771212 145
49 3300005544 Ga0070686_100000493 Ga0070686_1000004931 145
50 3300005546 Ga0070696_100000170 Ga0070696_1000001703 145
51 3300005547 Ga0070693_100000171 Ga0070693_10000017112 145
52 3300005615 Ga0070702_100007600 Ga0070702_1000076002 145
53 3300005719 Ga0068861_101310083 Ga0068861_1013100831 145
54 3300006358 Ga0068871_100011838 Ga0068871_1000118387 145
55 3300009094 Ga0111539_10242131 Ga0111539_102421311 145
56 3300009094 Ga0111539_11453295 Ga0111539_114532951 145
57 3300009148 Ga0105243_10001507 Ga0105243_1000150711 145
58 3300009174 Ga0105241_10010156 Ga0105241_1001015610 145
59 3300009176 Ga0105242_10000161 Ga0105242_1000016140 145
60 3300009553 Ga0105249_10001161 Ga0105249_1000116113 145
61 3300010159 Ga0099796_10186055 Ga0099796_101860551 145
62 3300010375 Ga0105239_10061047 Ga0105239_100610472 145
63 3300012494 Ga0157341_1022883 Ga0157341_10228831 145
64 3300013306 Ga0163162_10046381 Ga0163162_100463812 145
65 3300014326 Ga0157380_10029643 Ga0157380_100296432 145
66 3300014497 Ga0182008_10116710 Ga0182008_101167103 145
67 3300014968 Ga0157379_11359920 Ga0157379_113599201 145
68 3300025898 Ga0207692_10184383 Ga0207692_101843831 145
69 3300025912 Ga0207707_10316390 Ga0207707_103163902 145
70 3300025917 Ga0207660_10905715 Ga0207660_109057151 145
71 3300025941 Ga0207711_10145509 Ga0207711_101455091 145
72 3300026041 Ga0207639_10143991 Ga0207639_101439911 145
73 3300026078 Ga0207702_11101345 Ga0207702_111013451 145
74 3300032002 Ga0307416_100630087 Ga0307416_1006300872 145
75 3300034816 Ga0373930_0007414 Ga0373930_0007414_1002_1463 145
76 3300034817 Ga0373948_0006004 Ga0373948_0006004_1014_1475 145
77 3300034819 Ga0373958_0028376 Ga0373958_0028376_172_633 145
78 3300034957 Ga0373938_0034356 Ga0373938_0034356_60_521 145
79 3300035084 Ga0373928_0005706 Ga0373928_0005706_203_664 145
80 3300035091 Ga0373951_0020634 Ga0373951_0020634_300_761 145
81 3300035112 Ga0373932_0045276 Ga0373932_0045276_208_669 145
82 3300035117 Ga0373953_0302864 Ga0373953_0302864_230_667 145
83 3300035118 Ga0373954_0344151 Ga0373954_0344151_147_608 145
84 3300035120 Ga0373957_0095276 Ga0373957_0095276_344_805 145
85 3300035172 Ga0373955_0092511 Ga0373955_0092511_51_512 145
86 3300035207 Ga0373942_0140532 Ga0373942_0140532_208_669 145
87 3300035241 Ga0373961_0009898 Ga0373961_0009898_794_1255 145
88 3300035242 Ga0373962_0165536 Ga0373962_0165536_74_535 145
89 3300035691 Ga0373931_0012070 Ga0373931_0012070_3450_3911 145
90 3300037068 Ga0373925_1396440 Ga0373925_1396440_28_489 145
91 3300037471 Ga0395905_0231226 Ga0395905_0231226_1179_1640 145
92 3300039447 Ga0436361_0047415 Ga0436361_0047415_73_510 145
93 3300042012 Ga0439455_0075845 Ga0439455_0075845_176_613 145
94 3300042133 Ga0450896_066923 Ga0450896_066923_14_475 145
95 3300042436 Ga0439435_0138519 Ga0439435_0138519_189_650 145
96 3300042876 Ga0451577_0800785 Ga0451577_0800785_96_557 145
97 3300044673 Ga0453683_0043160 Ga0453683_0043160_2003_2464 145
98 3300048905 Ga0496102_0108774 Ga0496102_0108774_396_857 145
99 3300048917 Ga0496114_0058783 Ga0496114_0058783_776_1237 145
100 3300048918 Ga0496115_0747354 Ga0496115_0747354_131_571 145
101 3300048922 Ga0496119_0149923 Ga0496119_0149923_546_983 145
102 3300049576 Ga0501040_0949814 Ga0501040_0949814_109_570 145
103 3300049578 Ga0501042_0448836 Ga0501042_0448836_463_924 145
104 3300049580 Ga0501046_0753693 Ga0501046_0753693_82_543 145
105 3300049586 Ga0501070_0038360 Ga0501070_0038360_2283_2765 145
106 3300049587 Ga0501071_0000800 Ga0501071_0000800_14353_14811 145
107 3300049587 Ga0501071_0020118 Ga0501071_0020118_1253_1690 145
108 3300049589 Ga0501073_0326875 Ga0501073_0326875_439_876 145
109 3300049591 Ga0501075_0024442 Ga0501075_0024442_3765_4223 145
110 3300049592 Ga0501076_0170645 Ga0501076_0170645_717_1175 145
111 3300049593 Ga0501077_0102782 Ga0501077_0102782_1114_1575 145
112 3300049593 Ga0501077_0324386 Ga0501077_0324386_40_522 145
113 3300049593 Ga0501077_0894670 Ga0501077_0894670_95_556 145
114 3300049741 Ga0501079_0112077 Ga0501079_0112077_44_502 145
115 3300049742 Ga0501080_0028834 Ga0501080_0028834_1079_1537 145
116 3300049742 Ga0501080_0670571 Ga0501080_0670571_17_454 145
117 3300049743 Ga0501081_0151003 Ga0501081_0151003_236_673 145
118 3300049743 Ga0501081_0176063 Ga0501081_0176063_1065_1526 145
119 3300049823 Ga0501044_0002665 Ga0501044_0002665_17303_17740 145
120 3300050507 nmdc:mga05p37_1738657_c1 nmdc:mga05p37_1738657_c1_107_568 145
121 3300050509 nmdc:mga0qj67_16933_c1 nmdc:mga0qj67_16933_c1_53_514 145
122 3300050510 nmdc:mga06r32_243710_c1 nmdc:mga06r32_243710_c1_16_477 145
123 3300050511 nmdc:mga08y16_5682_c1 nmdc:mga08y16_5682_c1_1022_1483 145
124 3300059426 Ga0590077_032510 Ga0590077_032510_300_761 145
125 3300060353 Ga0501082_1830982 Ga0501082_1830982_33_494 145
126 3300005327 Ga0070658_11443489 Ga0070658_114434891 146
127 3300005335 Ga0070666_10726288 Ga0070666_107262881 146
128 3300005344 Ga0070661_100273046 Ga0070661_1002730461 146
129 3300005456 Ga0070678_100304346 Ga0070678_1003043461 146
130 3300025926 Ga0207659_10129952 Ga0207659_101299522 146
131 3300028794 Ga0307515_10248504 Ga0307515_102485041 146
132 3300041486 Ga0451807_1203434 Ga0451807_1203434_84_527 147
133 3300005543 Ga0070672_100637892 Ga0070672_1006378922 148
134 3300005719 Ga0068861_100081606 Ga0068861_1000816062 148
135 3300009545 Ga0105237_10043869 Ga0105237_100438695 148
136 3300009553 Ga0105249_11073727 Ga0105249_110737272 148
137 3300010375 Ga0105239_11350735 Ga0105239_113507351 148
138 3300025914 Ga0207671_10008451 Ga0207671_100084515 148
139 3300026118 Ga0207675_100093547 Ga0207675_1000935472 148
140 3300031852 Ga0307410_10977230 Ga0307410_109772301 148
141 3300032002 Ga0307416_100557696 Ga0307416_1005576962 148
142 3300042006 Ga0439432_157848 Ga0439432_157848_193_639 148
143 3300049679 Ga0501249_063428 Ga0501249_063428_128_574 148
144 3300049744 Ga0501083_0515817 Ga0501083_0515817_254_700 148
145 3300005445 Ga0070708_100138552 Ga0070708_1001385521 149
146 3300005467 Ga0070706_101738815 Ga0070706_1017388151 149
147 3300005471 Ga0070698_100463412 Ga0070698_1004634122 149
148 3300005518 Ga0070699_100101393 Ga0070699_1001013933 149
149 3300005536 Ga0070697_101539230 Ga0070697_1015392301 149
150 3300006846 Ga0075430_100002158 Ga0075430_1000021582 149
151 3300006847 Ga0075431_100002260 Ga0075431_10000226018 149
152 3300006852 Ga0075433_10270349 Ga0075433_102703493 149
153 3300006871 Ga0075434_100346628 Ga0075434_1003466281 149
154 3300006880 Ga0075429_100010293 Ga0075429_10001029310 149
155 3300007076 Ga0075435_100250899 Ga0075435_1002508993 149
156 3300009147 Ga0114129_10006657 Ga0114129_100066572 149
157 3300009147 Ga0114129_10543329 Ga0114129_105433292 149
158 3300025910 Ga0207684_10036650 Ga0207684_100366501 149
159 3300025922 Ga0207646_10088713 Ga0207646_100887134 149
160 3300025939 Ga0207665_10280062 Ga0207665_102800622 149
161 3300031824 Ga0307413_10311266 Ga0307413_103112662 149
162 3300031901 Ga0307406_12015543 Ga0307406_120155431 149
163 3300031911 Ga0307412_10505491 Ga0307412_105054912 149
164 3300049578 Ga0501042_1120075 Ga0501042_1120075_59_508 149
165 3300050507 nmdc:mga05p37_43832_c1 nmdc:mga05p37_43832_c1_243_692 149
166 3300050507 nmdc:mga05p37_4765_c1 nmdc:mga05p37_4765_c1_88_537 149
167 3300050509 nmdc:mga0qj67_194372_c1 nmdc:mga0qj67_194372_c1_190_639 149
168 3300050510 nmdc:mga06r32_26430_c1 nmdc:mga06r32_26430_c1_2816_3265 149
169 3300050512 nmdc:mga0n895_340282_c1 nmdc:mga0n895_340282_c1_243_692 149
170 3300050513 nmdc:mga0rr50_41009_c1 nmdc:mga0rr50_41009_c1_829_1278 149
171 3300050514 nmdc:mga08x19_2907_c2 nmdc:mga08x19_2907_c2_4815_5264 149
172 3300050515 nmdc:mga0a205_287306_c1 nmdc:mga0a205_287306_c1_829_1278 149
173 3300005289 Ga0065704_10172043 Ga0065704_101720431 150
174 3300005330 Ga0070690_100018721 Ga0070690_1000187212 150
175 3300005336 Ga0070680_100009146 Ga0070680_10000914614 150
176 3300005336 Ga0070680_100559460 Ga0070680_1005594602 150
177 3300005336 Ga0070680_100873609 Ga0070680_1008736091 150
178 3300005338 Ga0068868_100997576 Ga0068868_1009975761 150
179 3300005338 Ga0068868_101576082 Ga0068868_1015760821 150
180 3300005339 Ga0070660_100865124 Ga0070660_1008651242 150
181 3300005340 Ga0070689_100057082 Ga0070689_1000570825 150
182 3300005343 Ga0070687_100007507 Ga0070687_1000075071 150
183 3300005365 Ga0070688_100052775 Ga0070688_1000527754 150
184 3300005367 Ga0070667_100017185 Ga0070667_1000171855 150
185 3300005367 Ga0070667_100396372 Ga0070667_1003963722 150
186 3300005458 Ga0070681_10229751 Ga0070681_102297514 150
187 3300005458 Ga0070681_10402313 Ga0070681_104023131 150
188 3300005458 Ga0070681_10740297 Ga0070681_107402972 150
189 3300005459 Ga0068867_101164653 Ga0068867_1011646531 150
190 3300005466 Ga0070685_10155531 Ga0070685_101555312 150
191 3300005468 Ga0070707_100449228 Ga0070707_1004492281 150
192 3300005518 Ga0070699_100001420 Ga0070699_1000014206 150
193 3300005518 Ga0070699_100082244 Ga0070699_1000822444 150
194 3300005530 Ga0070679_100022460 Ga0070679_10002246011 150
195 3300005530 Ga0070679_100929307 Ga0070679_1009293072 150
196 3300005539 Ga0068853_100056601 Ga0068853_1000566013 150
197 3300005539 Ga0068853_100161822 Ga0068853_1001618223 150
198 3300005539 Ga0068853_101378707 Ga0068853_1013787071 150
199 3300005544 Ga0070686_100538689 Ga0070686_1005386892 150
200 3300005545 Ga0070695_100002310 Ga0070695_1000023102 150
201 3300005548 Ga0070665_101173992 Ga0070665_1011739922 150
202 3300005549 Ga0070704_100002324 Ga0070704_1000023241 150
203 3300005563 Ga0068855_100001801 Ga0068855_1000018016 150
204 3300005564 Ga0070664_101054741 Ga0070664_1010547411 150
205 3300005578 Ga0068854_100000817 Ga0068854_1000008176 150
206 3300005614 Ga0068856_100154385 Ga0068856_1001543852 150
207 3300005617 Ga0068859_100000935 Ga0068859_10000093512 150
208 3300005718 Ga0068866_10000239 Ga0068866_1000023917 150
209 3300005719 Ga0068861_100000070 Ga0068861_10000007012 150
210 3300005841 Ga0068863_100198837 Ga0068863_1001988372 150
211 3300005842 Ga0068858_100029840 Ga0068858_1000298407 150
212 3300005842 Ga0068858_100102650 Ga0068858_1001026505 150
213 3300005842 Ga0068858_100378271 Ga0068858_1003782711 150
214 3300005843 Ga0068860_100063129 Ga0068860_1000631296 150
215 3300005844 Ga0068862_100016181 Ga0068862_1000161812 150
216 3300005844 Ga0068862_100094251 Ga0068862_1000942514 150
217 3300006163 Ga0070715_10104649 Ga0070715_101046492 150
218 3300006237 Ga0097621_100043969 Ga0097621_1000439691 150
219 3300006237 Ga0097621_100103882 Ga0097621_1001038822 150
220 3300006846 Ga0075430_100280923 Ga0075430_1002809233 150
221 3300006847 Ga0075431_100145502 Ga0075431_1001455023 150
222 3300006852 Ga0075433_10387396 Ga0075433_103873962 150
223 3300006880 Ga0075429_100311275 Ga0075429_1003112752 150
224 3300006881 Ga0068865_100000242 Ga0068865_10000024217 150
225 3300006931 Ga0097620_100000935 Ga0097620_10000093517 150
226 3300006931 Ga0097620_100209305 Ga0097620_1002093052 150
227 3300009094 Ga0111539_10002380 Ga0111539_100023809 150
228 3300009147 Ga0114129_10945857 Ga0114129_109458572 150
229 3300010159 Ga0099796_10325585 Ga0099796_103255851 150
230 3300013306 Ga0163162_10621925 Ga0163162_106219253 150
231 3300014968 Ga0157379_11717787 Ga0157379_117177871 150
232 3300014969 Ga0157376_12024039 Ga0157376_120240391 150
233 3300017792 Ga0163161_10000551 Ga0163161_1000055118 150
234 3300025321 Ga0207656_10058185 Ga0207656_100581853 150
235 3300025893 Ga0207682_10132895 Ga0207682_101328952 150
236 3300025899 Ga0207642_10000915 Ga0207642_100009152 150
237 3300025899 Ga0207642_10176067 Ga0207642_101760672 150
238 3300025901 Ga0207688_10098157 Ga0207688_100981573 150
239 3300025901 Ga0207688_10414277 Ga0207688_104142772 150
240 3300025904 Ga0207647_10062020 Ga0207647_100620202 150
241 3300025905 Ga0207685_10253228 Ga0207685_102532282 150
242 3300025907 Ga0207645_10023297 Ga0207645_100232974 150
243 3300025909 Ga0207705_11202091 Ga0207705_112020911 150
244 3300025911 Ga0207654_10065617 Ga0207654_100656173 150
245 3300025911 Ga0207654_10152713 Ga0207654_101527133 150
246 3300025912 Ga0207707_10026803 Ga0207707_100268035 150
247 3300025912 Ga0207707_10030670 Ga0207707_100306707 150
248 3300025917 Ga0207660_10198725 Ga0207660_101987253 150
249 3300025918 Ga0207662_10000479 Ga0207662_1000047926 150
250 3300025918 Ga0207662_10001816 Ga0207662_1000181616 150
251 3300025918 Ga0207662_10045021 Ga0207662_100450212 150
252 3300025919 Ga0207657_10496775 Ga0207657_104967752 150
253 3300025920 Ga0207649_10595586 Ga0207649_105955862 150
254 3300025921 Ga0207652_10033703 Ga0207652_100337037 150
255 3300025921 Ga0207652_11267320 Ga0207652_112673201 150
256 3300025922 Ga0207646_10397811 Ga0207646_103978112 150
257 3300025927 Ga0207687_10000267 Ga0207687_100002673 150
258 3300025927 Ga0207687_10492791 Ga0207687_104927912 150
259 3300025931 Ga0207644_10511585 Ga0207644_105115851 150
260 3300025932 Ga0207690_10346079 Ga0207690_103460792 150
261 3300025934 Ga0207686_10001798 Ga0207686_100017984 150
262 3300025934 Ga0207686_10022309 Ga0207686_100223097 150
263 3300025935 Ga0207709_10120930 Ga0207709_101209303 150
264 3300025936 Ga0207670_10000833 Ga0207670_100008337 150
265 3300025936 Ga0207670_10220498 Ga0207670_102204982 150
266 3300025936 Ga0207670_10560227 Ga0207670_105602272 150
267 3300025938 Ga0207704_10000603 Ga0207704_100006037 150
268 3300025938 Ga0207704_10025944 Ga0207704_100259445 150
269 3300025940 Ga0207691_10001079 Ga0207691_1000107947 150
270 3300025941 Ga0207711_10026903 Ga0207711_100269032 150
271 3300025942 Ga0207689_10000200 Ga0207689_1000020042 150
272 3300025945 Ga0207679_10103482 Ga0207679_101034824 150
273 3300025949 Ga0207667_10125325 Ga0207667_101253255 150
274 3300025960 Ga0207651_10035582 Ga0207651_100355822 150
275 3300025961 Ga0207712_10004385 Ga0207712_100043853 150
276 3300025981 Ga0207640_10008663 Ga0207640_1000866310 150
277 3300025986 Ga0207658_10010508 Ga0207658_100105089 150
278 3300025986 Ga0207658_10123941 Ga0207658_101239412 150
279 3300025986 Ga0207658_10500767 Ga0207658_105007671 150
280 3300025986 Ga0207658_11226301 Ga0207658_112263011 150
281 3300026023 Ga0207677_10045458 Ga0207677_100454585 150
282 3300026023 Ga0207677_10837385 Ga0207677_108373851 150
283 3300026023 Ga0207677_10886685 Ga0207677_108866851 150
284 3300026035 Ga0207703_10000937 Ga0207703_100009376 150
285 3300026035 Ga0207703_10001427 Ga0207703_1000142712 150
286 3300026035 Ga0207703_10040147 Ga0207703_100401477 150
287 3300026067 Ga0207678_10432116 Ga0207678_104321162 150
288 3300026075 Ga0207708_10203496 Ga0207708_102034962 150
289 3300026088 Ga0207641_10235761 Ga0207641_102357613 150
290 3300026089 Ga0207648_10000309 Ga0207648_1000030943 150
291 3300026116 Ga0207674_11530816 Ga0207674_115308162 150
292 3300026118 Ga0207675_100000089 Ga0207675_10000008943 150
293 3300026121 Ga0207683_10687065 Ga0207683_106870652 150
294 3300027682 Ga0209971_1046972 Ga0209971_10469721 150
295 3300027717 Ga0209998_10009431 Ga0209998_100094312 150
296 3300027876 Ga0209974_10114805 Ga0209974_101148052 150
297 3300027907 Ga0207428_10028434 Ga0207428_100284348 150
298 3300028379 Ga0268266_10881927 Ga0268266_108819272 150
299 3300028380 Ga0268265_10004854 Ga0268265_1000485414 150
300 3300028380 Ga0268265_10034919 Ga0268265_100349193 150
301 3300028381 Ga0268264_10002468 Ga0268264_100024687 150
302 3300028794 Ga0307515_10178576 Ga0307515_101785762 150
303 3300028794 Ga0307515_10187388 Ga0307515_101873881 150
304 3300031250 Ga0265331_10058702 Ga0265331_100587024 150
305 3300031251 Ga0265327_10059727 Ga0265327_100597273 150
306 3300031251 Ga0265327_10146820 Ga0265327_101468201 150
307 3300031456 Ga0307513_10323619 Ga0307513_103236192 150
308 3300031456 Ga0307513_10379778 Ga0307513_103797781 150
309 3300031456 Ga0307513_10789119 Ga0307513_107891191 150
310 3300031548 Ga0307408_100709460 Ga0307408_1007094602 150
311 3300031616 Ga0307508_10006589 Ga0307508_100065893 150
312 3300031730 Ga0307516_10378211 Ga0307516_103782112 150
313 3300031852 Ga0307410_10137489 Ga0307410_101374892 150
314 3300031903 Ga0307407_10837358 Ga0307407_108373581 150
315 3300031995 Ga0307409_100708283 Ga0307409_1007082831 150
316 3300031995 Ga0307409_100818788 Ga0307409_1008187882 150
317 3300032002 Ga0307416_100091362 Ga0307416_1000913624 150
318 3300032005 Ga0307411_10082744 Ga0307411_100827442 150
319 3300032005 Ga0307411_10088089 Ga0307411_100880891 150
320 3300032005 Ga0307411_11392257 Ga0307411_113922571 150
321 3300033180 Ga0307510_10009383 Ga0307510_100093834 150
322 3300035725 Ga0373947_1002239 Ga0373947_1002239_24_500 150
323 3300036401 Ga0373937_0507166 Ga0373937_0507166_394_870 150
324 3300037312 Ga0395899_0128530 Ga0395899_0128530_586_1038 150
325 3300037471 Ga0395905_0000903 Ga0395905_0000903_7131_7595 150
326 3300038443 Ga0395901_0067793 Ga0395901_0067793_2803_3255 150
327 3300041458 Ga0451798_0867454 Ga0451798_0867454_306_764 150
328 3300041459 Ga0451800_1164648 Ga0451800_1164648_436_912 150
329 3300041501 Ga0451845_0384025 Ga0451845_0384025_36_512 150
330 3300042157 Ga0439458_0010319 Ga0439458_0010319_1474_1956 150
331 3300044712 Ga0453684_0041603 Ga0453684_0041603_247_723 150
332 3300046506 Ga0495583_0000739 Ga0495583_0000739_29523_29975 150
333 3300046525 Ga0495663_0011755 Ga0495663_0011755_1800_2252 150
334 3300046539 Ga0495621_0000214 Ga0495621_0000214_5635_6087 150
335 3300047471 Ga0495684_1074844 Ga0495684_1074844_12_488 150
336 3300048903 Ga0496100_0041477 Ga0496100_0041477_1909_2385 150
337 3300048917 Ga0496114_0000324 Ga0496114_0000324_30894_31370 150
338 3300048918 Ga0496115_0035313 Ga0496115_0035313_1731_2207 150
339 3300048928 Ga0496125_0014318 Ga0496125_0014318_5595_6047 150
340 3300049570 Ga0501033_0676418 Ga0501033_0676418_195_671 150
341 3300049588 Ga0501072_0946736 Ga0501072_0946736_177_653 150
342 3300049591 Ga0501075_0801385 Ga0501075_0801385_235_705 150
343 3300049742 Ga0501080_0724340 Ga0501080_0724340_247_723 150
344 3300049744 Ga0501083_0049082 Ga0501083_0049082_1028_1498 150
345 3300050509 nmdc:mga0qj67_18224_c1 nmdc:mga0qj67_18224_c1_1768_2268 150
346 3300050512 nmdc:mga0n895_726165_c1 nmdc:mga0n895_726165_c1_345_821 150
347 3300050515 nmdc:mga0a205_116101_c1 nmdc:mga0a205_116101_c1_1668_2144 150
348 3300053077 Ga0495601_0761736 Ga0495601_0761736_59_535 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

149

0.84

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

138

0.82

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

14

55

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

17

149

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9494 5 145
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8944 5 145
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.8294 112 143
4bpc-assembly1.cif.gz_A structure of the catalytic domain of protein tyrosine phosphatase sigma in the sulfenic acid form 0.7839 112 145
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7743 5 143
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9325 6 145 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.901 6 145 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8669 9 143 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8524 9 143 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.851 90 144 3.30.720.110
ID Description Score Start End GO Terms
AF-B5I170-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9591 90 145 GO:0051213
AF-A0A529P2B6-F1-model_v4 VOC family protein 0.9551 88 144
AF-A0A0S2FWJ6-F1-model_v4 deleted 0.9544 57 145
AF-A0A346XUA4-F1-model_v4 Glyoxalase family protein 0.9542 6 145 GO:0004493
GO:0046491
AF-A0A858RR96-F1-model_v4 VOC family protein 0.9536 6 145

Feature Viewer

pLDDT pTM Quality
85.47 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map