F416953

General Info

Members Datasets Scaffolds Average Seq Length
346 254 334 315

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_006833|Ga0590075_006833_344_1453
Length 369
Sequence MESVHLVKKVRRREKLFSPNFRGSLLQEKPRSFCRTLPRIFSGVRYKMTGHTPTPLPHDPAMPPVISIAGLTKTYGSGLHALKQIDLAIQRGEIFALLGPNGAGKTTLINIVCGIVTATAGRVQVDGHDHRRDYRAARAKIGLVPQELTTDTFETVWATVRFSRGLFGRAPDPAHLERVLRDLSLWEKRNEKIMTLSGGMKRRVLIAKALSHEPEILFLDEPTAGVDVELRRDMWALVRRLRLAGVTIILTTHYIDEAEEMADRIGVISKGELIIVENKVELMKKLGKKQLTLSLLKPLSAVPAALDGRRVLLKNNGSELEYTFEGTEEHTGIPSLLRQLSEMGIEFKDLNTRQSSLEDIFVDLVSDRR

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
3 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
4 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
7 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
8 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
9 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
10 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
11 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 0.58
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 0
Rhizoplane 3.47
Rhizosphere 85.84
Stem 0
Stem Tuber 0.29
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002061 3300001989 Bacteria 7694
2 JGI24737J22298_10011122 3300001990 Bacteria 2954
3 JGI24737J22298_10011900 3300001990 Bacteria 2842
4 JGI24735J21928_10018233 3300002067 Bacteria 2165
5 JGI25156J39149_1004766 3300002705 Bacteria 4059
6 JGI25157J39369_1002757 3300002741 Bacteria 4030
7 Ga0055537_1000053 3300003773 Bacteria 82599
8 Ga0055524_1000059 3300003775 Bacteria 138562
9 Ga0055534_1000017 3300003784 Bacteria 138670
10 Ga0055528_1000008 3300003790 Bacteria 226543
11 Ga0070658_10003310 3300005327 Bacteria 13293
12 Ga0070690_100001744 3300005330 Bacteria 11498
13 Ga0070670_100313758 3300005331 Bacteria 1373
14 Ga0070677_10039004 3300005333 Bacteria 1862
15 Ga0068869_100008044 3300005334 Bacteria 6773
16 Ga0070666_10126513 3300005335 Bacteria 1774
17 Ga0070680_100129842 3300005336 Bacteria 2108
18 Ga0070682_100038301 3300005337 Bacteria 2941
19 Ga0070692_10000790 3300005345 Bacteria 10457
20 Ga0070673_100170669 3300005364 Bacteria 1856
21 Ga0070667_100115106 3300005367 Bacteria 2335
22 Ga0070667_100140508 3300005367 Bacteria 2114
23 Ga0070714_100151229 3300005435 Bacteria 2092
24 Ga0070701_10000237 3300005438 Bacteria 17648
25 Ga0070700_100001319 3300005441 Bacteria 12306
26 Ga0070694_100125432 3300005444 Bacteria 1848
27 Ga0070662_100041426 3300005457 Bacteria 3285
28 Ga0068867_100001920 3300005459 Bacteria 14474
29 Ga0070707_100318794 3300005468 Bacteria 1511
30 Ga0070679_100122065 3300005530 Bacteria 2590
31 Ga0070686_100003753 3300005544 Bacteria 8347
32 Ga0070686_100073298 3300005544 Bacteria 2248
33 Ga0070695_100241072 3300005545 Bacteria 1312
34 Ga0070696_100017018 3300005546 Bacteria 4905
35 Ga0070696_100029347 3300005546 Bacteria 3759
36 Ga0070693_100004415 3300005547 Bacteria 6649
37 Ga0070693_100005421 3300005547 Bacteria 6124
38 Ga0070693_100020097 3300005547 Bacteria 3516
39 Ga0070665_100002805 3300005548 Bacteria 18872
40 Ga0068855_100010577 3300005563 Bacteria 11126
41 Ga0068855_100023917 3300005563 Bacteria 7316
42 Ga0068855_100432407 3300005563 Bacteria 1439
43 Ga0068854_100098173 3300005578 Bacteria 2191
44 Ga0068856_100000116 3300005614 Bacteria 79220
45 Ga0070702_100001083 3300005615 Bacteria 10869
46 Ga0068852_100005527 3300005616 Bacteria 9059
47 Ga0068852_100106006 3300005616 Bacteria 2547
48 Ga0068859_100061469 3300005617 Bacteria 3785
49 Ga0068859_100077460 3300005617 Bacteria 3366
50 Ga0068864_100016102 3300005618 Bacteria 6222
51 Ga0068866_10000969 3300005718 Bacteria 12617
52 Ga0068851_10005066 3300005834 Bacteria 5975
53 Ga0068870_10003993 3300005840 Bacteria 6298
54 Ga0068858_100026765 3300005842 Bacteria 5357
55 Ga0068860_100000192 3300005843 Bacteria 97363
56 Ga0068862_100004953 3300005844 Bacteria 11213
57 Ga0068862_100136168 3300005844 Bacteria 2176
58 Ga0081540_1079888 3300005983 Bacteria 1476
59 Ga0081540_1091058 3300005983 Bacteria 1341
60 Ga0075369_10007480 3300006186 Bacteria 4161
61 Ga0075366_10227940 3300006195 Bacteria 1135
62 Ga0097621_100020617 3300006237 Bacteria 5081
63 Ga0097621_100047439 3300006237 Bacteria 3481
64 Ga0097621_100111236 3300006237 Bacteria 2315
65 Ga0068871_100034022 3300006358 Bacteria 4040
66 Ga0068871_100041868 3300006358 Bacteria 3674
67 Ga0075428_100029188 3300006844 Bacteria 6103
68 Ga0075430_100000564 3300006846 Bacteria 28137
69 Ga0075430_100013954 3300006846 Bacteria 6847
70 Ga0075431_100014332 3300006847 Bacteria 8018
71 Ga0075431_100114894 3300006847 Bacteria 2778
72 Ga0075433_10008990 3300006852 Bacteria 7979
73 Ga0075433_10386887 3300006852 Bacteria 1234
74 Ga0075434_100003383 3300006871 Bacteria 14276
75 Ga0075434_100450900 3300006871 Bacteria 1308
76 Ga0075429_100016344 3300006880 Bacteria 6432
77 Ga0068865_100009258 3300006881 Bacteria 6100
78 Ga0097620_100061469 3300006931 Bacteria 3785
79 Ga0097620_100077458 3300006931 Bacteria 3366
80 Ga0075435_100052632 3300007076 Bacteria 3281
81 Ga0075435_100107650 3300007076 Bacteria 2315
82 Ga0105240_10000827 3300009093 Bacteria 55981
83 Ga0105240_10003405 3300009093 Bacteria 24740
84 Ga0111539_10002693 3300009094 Bacteria 23527
85 Ga0111539_10028635 3300009094 Bacteria 6795
86 Ga0111539_10070212 3300009094 Bacteria 4135
87 Ga0105245_10039597 3300009098 Bacteria 4196
88 Ga0105245_10163222 3300009098 Bacteria 2116
89 Ga0114129_10198788 3300009147 Bacteria 2717
90 Ga0114129_10534139 3300009147 Bacteria 1527
91 Ga0105243_10016492 3300009148 Bacteria 5584
92 Ga0105243_10328889 3300009148 Bacteria 1395
93 Ga0105242_10003173 3300009176 Bacteria 12824
94 Ga0105248_10010545 3300009177 Bacteria 10180
95 Ga0105248_10037563 3300009177 Bacteria 5418
96 Ga0105237_10000105 3300009545 Bacteria 118218
97 Ga0105238_10001013 3300009551 Bacteria 28671
98 Ga0105238_10006271 3300009551 Bacteria 11816
99 Ga0105238_10052076 3300009551 Bacteria 4116
100 Ga0105249_10025890 3300009553 Bacteria 5284
101 Ga0099796_10015736 3300010159 Bacteria 2218
102 Ga0157371_10020651 3300013102 Bacteria 4845
103 Ga0157371_10066390 3300013102 Bacteria 2554
104 Ga0157370_10010030 3300013104 Bacteria 10021
105 Ga0157369_10001365 3300013105 Bacteria 30097
106 Ga0157369_10010900 3300013105 Bacteria 10354
107 Ga0157369_10028710 3300013105 Bacteria 6153
108 Ga0157369_10159770 3300013105 Bacteria 2379
109 Ga0157378_10003346 3300013297 Bacteria 14262
110 Ga0157378_10173575 3300013297 Bacteria 2023
111 Ga0163162_10083353 3300013306 Bacteria 3271
112 Ga0157372_10181739 3300013307 Bacteria 2435
113 Ga0157375_10127126 3300013308 Bacteria 2665
114 Ga0157380_10034932 3300014326 Bacteria 3880
115 Ga0157379_10018299 3300014968 Bacteria 6175
116 Ga0157376_10277485 3300014969 Bacteria 1577
117 Ga0157376_10310755 3300014969 Bacteria 1495
118 Ga0183360_10002 3300015689 Bacteria 953821
119 Ga0206356_10363045 3300020070 Bacteria 2043
120 Ga0209026_1000111 3300025250 Bacteria 140599
121 Ga0209759_1010632 3300025256 Bacteria 2685
122 Ga0209565_1000001 3300025263 Bacteria 2950419
123 Ga0209455_1000211 3300025272 Bacteria 82660
124 Ga0209673_1000001 3300025273 Bacteria 3176258
125 Ga0209675_1000001 3300025291 Bacteria 2950293
126 Ga0209564_1000001 3300025295 Bacteria 3176258
127 Ga0209256_1000006 3300025299 Bacteria 1250310
128 Ga0207688_10086692 3300025901 Bacteria 1794
129 Ga0207647_10001049 3300025904 Bacteria 21361
130 Ga0207647_10018554 3300025904 Bacteria 4701
131 Ga0207645_10014322 3300025907 Bacteria 5311
132 Ga0207643_10095901 3300025908 Bacteria 1734
133 Ga0207654_10035046 3300025911 Bacteria 2793
134 Ga0207695_10000781 3300025913 Bacteria 60242
135 Ga0207695_10001623 3300025913 Bacteria 36467
136 Ga0207695_10024106 3300025913 Bacteria 6854
137 Ga0207671_10000092 3300025914 Bacteria 139546
138 Ga0207671_10004557 3300025914 Bacteria 13165
139 Ga0207660_10115833 3300025917 Bacteria 2023
140 Ga0207657_10134576 3300025919 Bacteria 2024
141 Ga0207652_10015960 3300025921 Bacteria 6123
142 Ga0207652_10074400 3300025921 Bacteria 2958
143 Ga0207646_10291094 3300025922 Bacteria 1476
144 Ga0207681_10069180 3300025923 Bacteria 2455
145 Ga0207694_10047412 3300025924 Bacteria 3324
146 Ga0207694_10053688 3300025924 Bacteria 3125
147 Ga0207659_10054311 3300025926 Bacteria 2861
148 Ga0207659_10064552 3300025926 Bacteria 2650
149 Ga0207687_10002573 3300025927 Bacteria 12323
150 Ga0207687_10114128 3300025927 Bacteria 2010
151 Ga0207644_10002804 3300025931 Bacteria 11234
152 Ga0207706_10047674 3300025933 Bacteria 3790
153 Ga0207706_10131171 3300025933 Bacteria 2204
154 Ga0207709_10110982 3300025935 Bacteria 1834
155 Ga0207704_10033159 3300025938 Bacteria 2933
156 Ga0207691_10003459 3300025940 Bacteria 15364
157 Ga0207711_10189573 3300025941 Bacteria 1873
158 Ga0207667_10233128 3300025949 Bacteria 1884
159 Ga0207667_10351833 3300025949 Bacteria 1502
160 Ga0207651_10059772 3300025960 Bacteria 2642
161 Ga0207651_10474408 3300025960 Bacteria 1077
162 Ga0207712_10200618 3300025961 Bacteria 1582
163 Ga0207640_10024243 3300025981 Bacteria 3658
164 Ga0207677_10050347 3300026023 Bacteria 2817
165 Ga0207678_10006028 3300026067 Bacteria 10782
166 Ga0207708_10000230 3300026075 Bacteria 44125
167 Ga0207708_10064001 3300026075 Bacteria 2809
168 Ga0207708_10302407 3300026075 Bacteria 1301
169 Ga0207702_10000170 3300026078 Bacteria 77504
170 Ga0207641_10432835 3300026088 Bacteria 1269
171 Ga0207648_10000484 3300026089 Bacteria 44276
172 Ga0207648_10030905 3300026089 Bacteria 4738
173 Ga0207676_10020657 3300026095 Bacteria 4821
174 Ga0207675_100000833 3300026118 Bacteria 30676
175 Ga0207683_10030967 3300026121 Bacteria 4640
176 Ga0207683_10184849 3300026121 Bacteria 1891
177 Ga0207698_10001914 3300026142 Bacteria 12198
178 Ga0209981_1004121 3300027378 Bacteria 1895
179 Ga0207428_10004110 3300027907 Bacteria 13948
180 Ga0207428_10010086 3300027907 Bacteria 8454
181 Ga0268265_10002769 3300028380 Bacteria 12933
182 Ga0268265_10039086 3300028380 Bacteria 3494
183 Ga0268264_10000018 3300028381 Bacteria 495324
184 Ga0265318_10000028 3300028577 Bacteria 149330
185 Ga0307511_10000216 3300030521 Bacteria 58288
186 Ga0307511_10011894 3300030521 Bacteria 8563
187 Ga0265330_10000021 3300031235 Bacteria 154495
188 Ga0265330_10029664 3300031235 Bacteria 2459
189 Ga0265332_10000109 3300031238 Bacteria 70186
190 Ga0265328_10001041 3300031239 Bacteria 12760
191 Ga0265328_10006140 3300031239 Bacteria 5110
192 Ga0265320_10000033 3300031240 Bacteria 141362
193 Ga0265325_10005857 3300031241 Bacteria 7531
194 Ga0265331_10000269 3300031250 Bacteria 58263
195 Ga0265316_10004308 3300031344 Bacteria 14215
196 Ga0307509_10329327 3300031507 Bacteria 1260
197 Ga0307408_100201441 3300031548 Bacteria 1611
198 Ga0265313_10000243 3300031595 Bacteria 59382
199 Ga0265313_10010860 3300031595 Bacteria 5715
200 Ga0316579_10018005 3300031691 Bacteria 3105
201 Ga0265314_10000407 3300031711 Bacteria 58254
202 Ga0265342_10027710 3300031712 Bacteria 3535
203 Ga0307516_10000949 3300031730 Bacteria 39979
204 Ga0316577_10029968 3300031733 Bacteria 3037
205 Ga0307413_10107551 3300031824 Bacteria 1859
206 Ga0307416_100011634 3300032002 Bacteria 5883
207 Ga0307416_100013732 3300032002 Bacteria 5516
208 Ga0307414_10112301 3300032004 Bacteria 2077
209 Ga0307414_10247375 3300032004 Bacteria 1480
210 Ga0307411_10084081 3300032005 Bacteria 2200
211 Ga0316583_10010034 3300032133 Bacteria 3412
212 Ga0316593_10005568 3300032168 Bacteria 3334
213 Ga0373936_0027681 3300035113 Bacteria 2224
214 Ga0373955_0034941 3300035172 Bacteria 2659
215 Ga0316574_0228164 3300035398 Bacteria 1192
216 Ga0316574_0253696 3300035398 Bacteria 1124
217 Ga0373927_0045519 3300035695 Bacteria 2838
218 Ga0373933_0022429 3300035724 Bacteria 3596
219 Ga0373947_0017469 3300035725 Bacteria 4126
220 Ga0373947_0041974 3300035725 Bacteria 2730
221 Ga0373937_0003365 3300036401 Bacteria 13418
222 Ga0316582_0097002 3300036647 Bacteria 1947
223 Ga0316582_0127614 3300036647 Bacteria 1706
224 Ga0316584_0028552 3300036712 Bacteria 4116
225 Ga0316584_0053246 3300036712 Bacteria 3028
226 Ga0316584_0057507 3300036712 Bacteria 2911
227 Ga0373925_0010548 3300037068 Bacteria 6701
228 Ga0395899_0012585 3300037312 Bacteria 6486
229 Ga0395900_0123800 3300037418 Bacteria 2652
230 Ga0395898_0156727 3300037466 Bacteria 2178
231 Ga0395905_0000953 3300037471 Bacteria 37129
232 Ga0395905_0017011 3300037471 Bacteria 6903
233 Ga0436364_1375783 3300037853 Bacteria 2011
234 Ga0395901_0147704 3300038443 Bacteria 2470
235 Ga0395901_0148534 3300038443 Bacteria 2463
236 Ga0400483_230141 3300039062 Bacteria 3504
237 Ga0451802_0228426 3300041460 Bacteria 5347
238 Ga0451806_377370 3300041462 Bacteria 2114
239 Ga0451807_0743353 3300041486 Bacteria 1577
240 Ga0439452_014735 3300042010 Bacteria 2164
241 Ga0439446_0046015 3300042156 Bacteria 1295
242 Ga0439464_0046315 3300042439 Bacteria 1250
243 Ga0450901_003361 3300042533 Bacteria 1674
244 Ga0453684_0279650 3300044712 Bacteria 1904
245 Ga0466957_0003426 3300044842 Bacteria 8707
246 Ga0466958_0100686 3300045836 Bacteria 1796
247 Ga0495651_0164192 3300046462 Bacteria 1588
248 Ga0495580_0019848 3300046472 Bacteria 4985
249 Ga0495582_0023119 3300046473 Bacteria 3400
250 Ga0495628_0261920 3300046516 Bacteria 1288
251 Ga0495643_0032108 3300046522 Bacteria 2917
252 Ga0495586_0093271 3300046535 Bacteria 1665
253 Ga0495611_0072137 3300046648 Bacteria 1580
254 Ga0495657_0122844 3300046675 Bacteria 1634
255 Ga0495623_0085616 3300046679 Bacteria 1943
256 Ga0495649_0000241 3300046694 Bacteria 48093
257 Ga0495649_0125041 3300046694 Bacteria 1358
258 Ga0495600_0160302 3300046809 Bacteria 1454
259 Ga0495674_0328367 3300047319 Bacteria 1245
260 Ga0495686_0012154 3300047472 Bacteria 6038
261 Ga0496101_0056049 3300048904 Bacteria 2849
262 Ga0496102_0048554 3300048905 Bacteria 3859
263 Ga0496102_0363350 3300048905 Bacteria 1363
264 Ga0496102_0470409 3300048905 Bacteria 1178
265 Ga0496105_0000391 3300048908 Bacteria 28829
266 Ga0496105_0130179 3300048908 Bacteria 2075
267 Ga0496109_0292975 3300048912 Bacteria 1534
268 Ga0496110_0103307 3300048913 Bacteria 2556
269 Ga0496112_0204578 3300048915 Bacteria 1932
270 Ga0496118_0008186 3300048921 Bacteria 10876
271 Ga0496122_0134095 3300048925 Bacteria 1565
272 Ga0496123_0012768 3300048926 Bacteria 7122
273 Ga0496125_0185339 3300048928 Bacteria 1381
274 Ga0501032_0000199 3300049569 Bacteria 50110
275 Ga0501033_0221690 3300049570 Bacteria 1346
276 Ga0501034_0000581 3300049571 Bacteria 57797
277 Ga0501034_0059367 3300049571 Bacteria 3842
278 Ga0501034_0135700 3300049571 Bacteria 2441
279 Ga0501037_0043193 3300049573 Bacteria 3313
280 Ga0501043_0045874 3300049579 Bacteria 3436
281 Ga0501046_0104843 3300049580 Bacteria 2166
282 Ga0501047_0020830 3300049581 Bacteria 6298
283 Ga0501047_0185899 3300049581 Bacteria 1943
284 Ga0501067_0000106 3300049583 Bacteria 47740
285 Ga0501068_0000780 3300049584 Bacteria 16438
286 Ga0501068_0020193 3300049584 Bacteria 3879
287 Ga0501069_0000981 3300049585 Bacteria 13586
288 Ga0501070_0001844 3300049586 Bacteria 18698
289 Ga0501072_0005732 3300049588 Bacteria 9458
290 Ga0501073_0000004 3300049589 Bacteria 261794
291 Ga0501073_0002180 3300049589 Bacteria 14631
292 Ga0501073_0011680 3300049589 Bacteria 6414
293 Ga0501073_0177133 3300049589 Bacteria 1476
294 Ga0501074_0000803 3300049590 Bacteria 19882
295 Ga0501074_0196830 3300049590 Bacteria 1436
296 Ga0501076_0133118 3300049592 Bacteria 2017
297 Ga0501077_0000001 3300049593 Bacteria 270489
298 Ga0501222_000021 3300049662 Bacteria 67031
299 Ga0501235_019392 3300049669 Bacteria 1509
300 Ga0501079_0008511 3300049741 Bacteria 7780
301 Ga0501080_0004992 3300049742 Bacteria 11817
302 Ga0501080_0017113 3300049742 Bacteria 6696
303 Ga0501080_0038396 3300049742 Bacteria 4470
304 Ga0501080_0187064 3300049742 Bacteria 1904
305 Ga0501083_0012968 3300049744 Bacteria 5823
306 Ga0501035_0233003 3300049822 Bacteria 1569
307 Ga0501044_0031662 3300049823 Bacteria 5565
308 Ga0501044_0046422 3300049823 Bacteria 4496
309 Ga0501044_0392423 3300049823 Bacteria 1302
310 nmdc:mga07m45_17039_c1 3300050496 Bacteria 3896
311 nmdc:mga07m45_58_c1 3300050496 Bacteria 45340
312 nmdc:mga05p37_641420_c1 3300050507 Bacteria 1191
313 nmdc:mga05p37_671435_c1 3300050507 Bacteria 1157
314 nmdc:mga05p37_86126_c1 3300050507 Bacteria 3472
315 nmdc:mga09592_85447_c1 3300050508 Bacteria 2692
316 nmdc:mga0qj67_188991_c1 3300050509 Bacteria 1674
317 nmdc:mga0qj67_423901_c1 3300050509 Bacteria 1073
318 nmdc:mga0qj67_44108_c1 3300050509 Bacteria 3513
319 nmdc:mga06r32_86910_c1 3300050510 Bacteria 3050
320 nmdc:mga08y16_14870_c1 3300050511 Bacteria 8184
321 nmdc:mga08y16_2351_c1 3300050511 Bacteria 19387
322 nmdc:mga08y16_35646_c1 3300050511 Bacteria 5225
323 nmdc:mga0n895_813_c1 3300050512 Bacteria 22347
324 nmdc:mga0rr50_126126_c1 3300050513 Bacteria 2044
325 nmdc:mga0rr50_301682_c1 3300050513 Bacteria 1340
326 nmdc:mga0rr50_65198_c1 3300050513 Bacteria 2758
327 nmdc:mga08x19_299779_c1 3300050514 Bacteria 1116
328 nmdc:mga0a205_4770_c1 3300050515 Bacteria 12180
329 nmdc:mga0sz30_7964_c1 3300050516 Bacteria 3987
330 Ga0495595_0045695 3300053084 Bacteria 2015
331 Ga0500616_0034798 3300053153 Bacteria 2743
332 Ga0590071_010792 3300059421 Bacteria 2137
333 Ga0590075_006833 3300059424 Bacteria 2701
334 Ga0466962_0169810 3300061719 Bacteria 1062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100016102 Ga0068864_1000161024 295
2 3300005335 Ga0070666_10126513 Ga0070666_101265132 298
3 3300005367 Ga0070667_100115106 Ga0070667_1001151063 298
4 3300041460 Ga0451802_0228426 Ga0451802_0228426_1248_2174 299
5 3300041462 Ga0451806_377370 Ga0451806_377370_289_1215 299
6 3300041486 Ga0451807_0743353 Ga0451807_0743353_518_1444 299
7 3300050507 nmdc:mga05p37_641420_c1 nmdc:mga05p37_641420_c1_177_1136 299
8 iso_pu_bacteria 651053060 651177951 300
9 iso_pu_bacteria 2738543020 2739289089 302
10 iso_pu_bacteria 2738543021 2739294401 302
11 3300005545 Ga0070695_100241072 Ga0070695_1002410722 303
12 3300005844 Ga0068862_100136168 Ga0068862_1001361682 303
13 3300009147 Ga0114129_10534139 Ga0114129_105341392 303
14 3300025901 Ga0207688_10086692 Ga0207688_100866922 303
15 3300025907 Ga0207645_10014322 Ga0207645_100143225 303
16 3300025960 Ga0207651_10474408 Ga0207651_104744081 303
17 3300026075 Ga0207708_10302407 Ga0207708_103024072 303
18 3300028380 Ga0268265_10039086 Ga0268265_100390862 303
19 3300031548 Ga0307408_100201441 Ga0307408_1002014412 303
20 3300032002 Ga0307416_100011634 Ga0307416_1000116344 303
21 3300032005 Ga0307411_10084081 Ga0307411_100840812 303
22 3300050508 nmdc:mga09592_85447_c1 nmdc:mga09592_85447_c1_838_1749 303
23 3300050509 nmdc:mga0qj67_423901_c1 nmdc:mga0qj67_423901_c1_25_936 303
24 iso_pu_bacteria 2582581279 2585148917 303
25 iso_pu_bacteria 2928972540 2928974096 303
26 iso_pu_bacteria 2977240413 2977240936 303
27 3300027378 Ga0209981_1004121 Ga0209981_10041212 304
28 3300044712 Ga0453684_0279650 Ga0453684_0279650_779_1705 304
29 iso_pu_bacteria 2919138771 2919140621 304
30 iso_pu_bacteria 2941485952 2941486222 304
31 iso_pu_bacteria 3007252601 3007256246 304
32 iso_pu_bacteria 3007315729 3007319571 304
33 3300005547 Ga0070693_100005421 Ga0070693_1000054213 305
34 3300006237 Ga0097621_100047439 Ga0097621_1000474392 305
35 3300006358 Ga0068871_100034022 Ga0068871_1000340226 305
36 3300006358 Ga0068871_100041868 Ga0068871_1000418682 305
37 3300009098 Ga0105245_10163222 Ga0105245_101632223 305
38 3300014969 Ga0157376_10277485 Ga0157376_102774852 305
39 3300014969 Ga0157376_10310755 Ga0157376_103107552 305
40 3300025927 Ga0207687_10114128 Ga0207687_101141283 305
41 3300026088 Ga0207641_10432835 Ga0207641_104328352 305
42 3300035172 Ga0373955_0034941 Ga0373955_0034941_1167_2084 305
43 3300035724 Ga0373933_0022429 Ga0373933_0022429_974_1891 305
44 3300036401 Ga0373937_0003365 Ga0373937_0003365_1885_2802 305
45 3300036647 Ga0316582_0127614 Ga0316582_0127614_637_1554 305
46 3300039062 Ga0400483_230141 Ga0400483_230141_1679_2620 305
47 3300046462 Ga0495651_0164192 Ga0495651_0164192_215_1132 305
48 3300046516 Ga0495628_0261920 Ga0495628_0261920_196_1113 305
49 3300046679 Ga0495623_0085616 Ga0495623_0085616_858_1775 305
50 3300046809 Ga0495600_0160302 Ga0495600_0160302_406_1323 305
51 3300048905 Ga0496102_0470409 Ga0496102_0470409_131_1048 305
52 3300053084 Ga0495595_0045695 Ga0495595_0045695_639_1556 305
53 iso_pu_bacteria 2885427238 2885428370 305
54 3300006846 Ga0075430_100013954 Ga0075430_1000139543 306
55 3300046694 Ga0495649_0000241 Ga0495649_0000241_22789_23709 306
56 3300046694 Ga0495649_0125041 Ga0495649_0125041_44_964 306
57 3300049570 Ga0501033_0221690 Ga0501033_0221690_322_1263 306
58 3300049823 Ga0501044_0392423 Ga0501044_0392423_27_947 306
59 3300050509 nmdc:mga0qj67_188991_c1 nmdc:mga0qj67_188991_c1_45_977 306
60 3300005331 Ga0070670_100313758 Ga0070670_1003137581 307
61 3300005548 Ga0070665_100002805 Ga0070665_10000280518 307
62 3300005843 Ga0068860_100000192 Ga0068860_10000019269 307
63 3300006186 Ga0075369_10007480 Ga0075369_100074805 307
64 3300006195 Ga0075366_10227940 Ga0075366_102279401 307
65 3300013102 Ga0157371_10066390 Ga0157371_100663902 307
66 3300013104 Ga0157370_10010030 Ga0157370_100100302 307
67 3300013105 Ga0157369_10028710 Ga0157369_100287102 307
68 3300026095 Ga0207676_10020657 Ga0207676_100206572 307
69 3300028380 Ga0268265_10002769 Ga0268265_1000276912 307
70 3300028381 Ga0268264_10000018 Ga0268264_1000001829 307
71 3300030521 Ga0307511_10000216 Ga0307511_1000021632 307
72 3300031507 Ga0307509_10329327 Ga0307509_103293272 307
73 3300031691 Ga0316579_10018005 Ga0316579_100180055 307
74 3300031730 Ga0307516_10000949 Ga0307516_1000094915 307
75 3300032002 Ga0307416_100013732 Ga0307416_1000137321 307
76 3300032004 Ga0307414_10112301 Ga0307414_101123012 307
77 3300032133 Ga0316583_10010034 Ga0316583_100100342 307
78 3300035398 Ga0316574_0253696 Ga0316574_0253696_156_1079 307
79 3300036647 Ga0316582_0097002 Ga0316582_0097002_742_1665 307
80 3300036712 Ga0316584_0028552 Ga0316584_0028552_2404_3327 307
81 3300036712 Ga0316584_0057507 Ga0316584_0057507_232_1155 307
82 3300037853 Ga0436364_1375783 Ga0436364_1375783_11_934 307
83 3300048905 Ga0496102_0363350 Ga0496102_0363350_320_1264 307
84 3300048908 Ga0496105_0000391 Ga0496105_0000391_149_1093 307
85 3300048925 Ga0496122_0134095 Ga0496122_0134095_211_1143 307
86 3300048926 Ga0496123_0012768 Ga0496123_0012768_3738_4670 307
87 3300050516 nmdc:mga0sz30_7964_c1 nmdc:mga0sz30_7964_c1_2864_3787 307
88 3300053153 Ga0500616_0034798 Ga0500616_0034798_376_1314 307
89 3300001989 JGI24739J22299_10002061 JGI24739J22299_100020618 308
90 3300001990 JGI24737J22298_10011122 JGI24737J22298_100111222 308
91 3300001990 JGI24737J22298_10011900 JGI24737J22298_100119003 308
92 3300002067 JGI24735J21928_10018233 JGI24735J21928_100182332 308
93 3300002705 JGI25156J39149_1004766 JGI25156J39149_10047661 308
94 3300002741 JGI25157J39369_1002757 JGI25157J39369_10027572 308
95 3300003773 Ga0055537_1000053 Ga0055537_100005367 308
96 3300003775 Ga0055524_1000059 Ga0055524_100005987 308
97 3300003784 Ga0055534_1000017 Ga0055534_100001758 308
98 3300003790 Ga0055528_1000008 Ga0055528_100000857 308
99 3300005327 Ga0070658_10003310 Ga0070658_100033102 308
100 3300005330 Ga0070690_100001744 Ga0070690_1000017443 308
101 3300005333 Ga0070677_10039004 Ga0070677_100390042 308
102 3300005334 Ga0068869_100008044 Ga0068869_1000080444 308
103 3300005336 Ga0070680_100129842 Ga0070680_1001298423 308
104 3300005337 Ga0070682_100038301 Ga0070682_1000383012 308
105 3300005345 Ga0070692_10000790 Ga0070692_100007905 308
106 3300005364 Ga0070673_100170669 Ga0070673_1001706692 308
107 3300005367 Ga0070667_100140508 Ga0070667_1001405082 308
108 3300005435 Ga0070714_100151229 Ga0070714_1001512292 308
109 3300005438 Ga0070701_10000237 Ga0070701_100002377 308
110 3300005441 Ga0070700_100001319 Ga0070700_1000013191 308
111 3300005444 Ga0070694_100125432 Ga0070694_1001254324 308
112 3300005457 Ga0070662_100041426 Ga0070662_1000414262 308
113 3300005459 Ga0068867_100001920 Ga0068867_1000019204 308
114 3300005468 Ga0070707_100318794 Ga0070707_1003187943 308
115 3300005530 Ga0070679_100122065 Ga0070679_1001220653 308
116 3300005544 Ga0070686_100003753 Ga0070686_1000037535 308
117 3300005544 Ga0070686_100073298 Ga0070686_1000732983 308
118 3300005546 Ga0070696_100017018 Ga0070696_1000170183 308
119 3300005546 Ga0070696_100029347 Ga0070696_1000293472 308
120 3300005547 Ga0070693_100004415 Ga0070693_1000044155 308
121 3300005547 Ga0070693_100020097 Ga0070693_1000200973 308
122 3300005563 Ga0068855_100010577 Ga0068855_1000105773 308
123 3300005563 Ga0068855_100023917 Ga0068855_1000239176 308
124 3300005563 Ga0068855_100432407 Ga0068855_1004324072 308
125 3300005578 Ga0068854_100098173 Ga0068854_1000981732 308
126 3300005614 Ga0068856_100000116 Ga0068856_10000011629 308
127 3300005615 Ga0070702_100001083 Ga0070702_1000010832 308
128 3300005616 Ga0068852_100005527 Ga0068852_1000055273 308
129 3300005616 Ga0068852_100106006 Ga0068852_1001060062 308
130 3300005617 Ga0068859_100061469 Ga0068859_1000614693 308
131 3300005617 Ga0068859_100077460 Ga0068859_1000774602 308
132 3300005718 Ga0068866_10000969 Ga0068866_100009694 308
133 3300005834 Ga0068851_10005066 Ga0068851_100050666 308
134 3300005840 Ga0068870_10003993 Ga0068870_100039934 308
135 3300005842 Ga0068858_100026765 Ga0068858_1000267653 308
136 3300005844 Ga0068862_100004953 Ga0068862_1000049536 308
137 3300005983 Ga0081540_1079888 Ga0081540_10798882 308
138 3300005983 Ga0081540_1091058 Ga0081540_10910582 308
139 3300006237 Ga0097621_100020617 Ga0097621_1000206173 308
140 3300006237 Ga0097621_100111236 Ga0097621_1001112362 308
141 3300006844 Ga0075428_100029188 Ga0075428_1000291886 308
142 3300006846 Ga0075430_100000564 Ga0075430_10000056425 308
143 3300006847 Ga0075431_100014332 Ga0075431_1000143327 308
144 3300006847 Ga0075431_100114894 Ga0075431_1001148943 308
145 3300006852 Ga0075433_10008990 Ga0075433_100089902 308
146 3300006852 Ga0075433_10386887 Ga0075433_103868871 308
147 3300006871 Ga0075434_100003383 Ga0075434_10000338312 308
148 3300006871 Ga0075434_100450900 Ga0075434_1004509001 308
149 3300006880 Ga0075429_100016344 Ga0075429_1000163444 308
150 3300006881 Ga0068865_100009258 Ga0068865_1000092584 308
151 3300006931 Ga0097620_100061469 Ga0097620_1000614693 308
152 3300006931 Ga0097620_100077458 Ga0097620_1000774582 308
153 3300007076 Ga0075435_100052632 Ga0075435_1000526322 308
154 3300007076 Ga0075435_100107650 Ga0075435_1001076502 308
155 3300009093 Ga0105240_10000827 Ga0105240_1000082711 308
156 3300009093 Ga0105240_10003405 Ga0105240_100034059 308
157 3300009094 Ga0111539_10002693 Ga0111539_100026935 308
158 3300009094 Ga0111539_10028635 Ga0111539_100286355 308
159 3300009094 Ga0111539_10070212 Ga0111539_100702121 308
160 3300009098 Ga0105245_10039597 Ga0105245_100395974 308
161 3300009147 Ga0114129_10198788 Ga0114129_101987882 308
162 3300009148 Ga0105243_10016492 Ga0105243_100164922 308
163 3300009148 Ga0105243_10328889 Ga0105243_103288892 308
164 3300009176 Ga0105242_10003173 Ga0105242_100031739 308
165 3300009177 Ga0105248_10010545 Ga0105248_100105451 308
166 3300009177 Ga0105248_10037563 Ga0105248_100375632 308
167 3300009545 Ga0105237_10000105 Ga0105237_1000010586 308
168 3300009551 Ga0105238_10001013 Ga0105238_1000101322 308
169 3300009551 Ga0105238_10006271 Ga0105238_100062713 308
170 3300009551 Ga0105238_10052076 Ga0105238_100520762 308
171 3300009553 Ga0105249_10025890 Ga0105249_100258903 308
172 3300010159 Ga0099796_10015736 Ga0099796_100157363 308
173 3300013102 Ga0157371_10020651 Ga0157371_100206514 308
174 3300013105 Ga0157369_10001365 Ga0157369_1000136522 308
175 3300013105 Ga0157369_10010900 Ga0157369_1001090016 308
176 3300013105 Ga0157369_10159770 Ga0157369_101597703 308
177 3300013297 Ga0157378_10003346 Ga0157378_100033466 308
178 3300013297 Ga0157378_10173575 Ga0157378_101735753 308
179 3300013306 Ga0163162_10083353 Ga0163162_100833533 308
180 3300013307 Ga0157372_10181739 Ga0157372_101817392 308
181 3300013308 Ga0157375_10127126 Ga0157375_101271262 308
182 3300014326 Ga0157380_10034932 Ga0157380_100349323 308
183 3300014968 Ga0157379_10018299 Ga0157379_100182992 308
184 3300015689 Ga0183360_10002 Ga0183360_10002568 308
185 3300020070 Ga0206356_10363045 Ga0206356_103630452 308
186 3300025250 Ga0209026_1000111 Ga0209026_100011131 308
187 3300025256 Ga0209759_1010632 Ga0209759_10106321 308
188 3300025263 Ga0209565_1000001 Ga0209565_1000001191 308
189 3300025272 Ga0209455_1000211 Ga0209455_100021117 308
190 3300025273 Ga0209673_1000001 Ga0209673_1000001191 308
191 3300025291 Ga0209675_1000001 Ga0209675_10000012341 308
192 3300025295 Ga0209564_1000001 Ga0209564_10000012503 308
193 3300025299 Ga0209256_1000006 Ga0209256_1000006939 308
194 3300025904 Ga0207647_10001049 Ga0207647_1000104913 308
195 3300025904 Ga0207647_10018554 Ga0207647_100185545 308
196 3300025908 Ga0207643_10095901 Ga0207643_100959011 308
197 3300025911 Ga0207654_10035046 Ga0207654_100350462 308
198 3300025913 Ga0207695_10000781 Ga0207695_1000078115 308
199 3300025913 Ga0207695_10001623 Ga0207695_1000162315 308
200 3300025913 Ga0207695_10024106 Ga0207695_100241062 308
201 3300025914 Ga0207671_10000092 Ga0207671_1000009279 308
202 3300025914 Ga0207671_10004557 Ga0207671_100045578 308
203 3300025917 Ga0207660_10115833 Ga0207660_101158332 308
204 3300025919 Ga0207657_10134576 Ga0207657_101345762 308
205 3300025921 Ga0207652_10015960 Ga0207652_100159605 308
206 3300025921 Ga0207652_10074400 Ga0207652_100744003 308
207 3300025922 Ga0207646_10291094 Ga0207646_102910942 308
208 3300025923 Ga0207681_10069180 Ga0207681_100691801 308
209 3300025924 Ga0207694_10047412 Ga0207694_100474123 308
210 3300025924 Ga0207694_10053688 Ga0207694_100536882 308
211 3300025926 Ga0207659_10054311 Ga0207659_100543114 308
212 3300025926 Ga0207659_10064552 Ga0207659_100645524 308
213 3300025927 Ga0207687_10002573 Ga0207687_100025737 308
214 3300025931 Ga0207644_10002804 Ga0207644_100028047 308
215 3300025933 Ga0207706_10047674 Ga0207706_100476744 308
216 3300025933 Ga0207706_10131171 Ga0207706_101311712 308
217 3300025935 Ga0207709_10110982 Ga0207709_101109822 308
218 3300025938 Ga0207704_10033159 Ga0207704_100331593 308
219 3300025940 Ga0207691_10003459 Ga0207691_100034595 308
220 3300025941 Ga0207711_10189573 Ga0207711_101895732 308
221 3300025949 Ga0207667_10233128 Ga0207667_102331281 308
222 3300025949 Ga0207667_10351833 Ga0207667_103518332 308
223 3300025960 Ga0207651_10059772 Ga0207651_100597722 308
224 3300025961 Ga0207712_10200618 Ga0207712_102006182 308
225 3300025981 Ga0207640_10024243 Ga0207640_100242435 308
226 3300026023 Ga0207677_10050347 Ga0207677_100503473 308
227 3300026067 Ga0207678_10006028 Ga0207678_1000602811 308
228 3300026075 Ga0207708_10000230 Ga0207708_1000023020 308
229 3300026075 Ga0207708_10064001 Ga0207708_100640012 308
230 3300026078 Ga0207702_10000170 Ga0207702_100001707 308
231 3300026089 Ga0207648_10000484 Ga0207648_1000048420 308
232 3300026089 Ga0207648_10030905 Ga0207648_100309054 308
233 3300026118 Ga0207675_100000833 Ga0207675_10000083313 308
234 3300026121 Ga0207683_10030967 Ga0207683_100309672 308
235 3300026121 Ga0207683_10184849 Ga0207683_101848492 308
236 3300026142 Ga0207698_10001914 Ga0207698_1000191412 308
237 3300027907 Ga0207428_10004110 Ga0207428_1000411013 308
238 3300027907 Ga0207428_10010086 Ga0207428_100100867 308
239 3300028577 Ga0265318_10000028 Ga0265318_1000002893 308
240 3300030521 Ga0307511_10011894 Ga0307511_100118945 308
241 3300031235 Ga0265330_10000021 Ga0265330_1000002198 308
242 3300031235 Ga0265330_10029664 Ga0265330_100296643 308
243 3300031238 Ga0265332_10000109 Ga0265332_1000010924 308
244 3300031239 Ga0265328_10001041 Ga0265328_100010417 308
245 3300031239 Ga0265328_10006140 Ga0265328_100061405 308
246 3300031240 Ga0265320_10000033 Ga0265320_1000003386 308
247 3300031241 Ga0265325_10005857 Ga0265325_100058576 308
248 3300031250 Ga0265331_10000269 Ga0265331_1000026939 308
249 3300031344 Ga0265316_10004308 Ga0265316_100043087 308
250 3300031595 Ga0265313_10000243 Ga0265313_1000024315 308
251 3300031595 Ga0265313_10010860 Ga0265313_100108606 308
252 3300031711 Ga0265314_10000407 Ga0265314_1000040739 308
253 3300031712 Ga0265342_10027710 Ga0265342_100277104 308
254 3300031733 Ga0316577_10029968 Ga0316577_100299682 308
255 3300031824 Ga0307413_10107551 Ga0307413_101075512 308
256 3300032004 Ga0307414_10247375 Ga0307414_102473752 308
257 3300032168 Ga0316593_10005568 Ga0316593_100055685 308
258 3300035113 Ga0373936_0027681 Ga0373936_0027681_1012_1944 308
259 3300035398 Ga0316574_0228164 Ga0316574_0228164_36_962 308
260 3300035695 Ga0373927_0045519 Ga0373927_0045519_960_1895 308
261 3300035725 Ga0373947_0017469 Ga0373947_0017469_1672_2715 308
262 3300035725 Ga0373947_0041974 Ga0373947_0041974_1337_2272 308
263 3300036712 Ga0316584_0053246 Ga0316584_0053246_1688_2662 308
264 3300037068 Ga0373925_0010548 Ga0373925_0010548_235_1278 308
265 3300037312 Ga0395899_0012585 Ga0395899_0012585_3775_4794 308
266 3300037418 Ga0395900_0123800 Ga0395900_0123800_845_1831 308
267 3300037466 Ga0395898_0156727 Ga0395898_0156727_592_1611 308
268 3300037471 Ga0395905_0000953 Ga0395905_0000953_776_1795 308
269 3300037471 Ga0395905_0017011 Ga0395905_0017011_2101_3087 308
270 3300038443 Ga0395901_0147704 Ga0395901_0147704_172_1104 308
271 3300038443 Ga0395901_0148534 Ga0395901_0148534_1220_2206 308
272 3300042010 Ga0439452_014735 Ga0439452_014735_131_1057 308
273 3300042156 Ga0439446_0046015 Ga0439446_0046015_121_1083 308
274 3300042439 Ga0439464_0046315 Ga0439464_0046315_166_1092 308
275 3300042533 Ga0450901_003361 Ga0450901_003361_109_1044 308
276 3300044842 Ga0466957_0003426 Ga0466957_0003426_6180_7109 308
277 3300045836 Ga0466958_0100686 Ga0466958_0100686_489_1418 308
278 3300046472 Ga0495580_0019848 Ga0495580_0019848_2039_3085 308
279 3300046473 Ga0495582_0023119 Ga0495582_0023119_2193_3239 308
280 3300046522 Ga0495643_0032108 Ga0495643_0032108_212_1153 308
281 3300046535 Ga0495586_0093271 Ga0495586_0093271_99_1100 308
282 3300046648 Ga0495611_0072137 Ga0495611_0072137_188_1114 308
283 3300046675 Ga0495657_0122844 Ga0495657_0122844_294_1340 308
284 3300047319 Ga0495674_0328367 Ga0495674_0328367_73_1089 308
285 3300047472 Ga0495686_0012154 Ga0495686_0012154_1093_2019 308
286 3300048904 Ga0496101_0056049 Ga0496101_0056049_1264_2286 308
287 3300048905 Ga0496102_0048554 Ga0496102_0048554_567_1544 308
288 3300048908 Ga0496105_0130179 Ga0496105_0130179_1114_2043 308
289 3300048912 Ga0496109_0292975 Ga0496109_0292975_340_1362 308
290 3300048913 Ga0496110_0103307 Ga0496110_0103307_553_1482 308
291 3300048915 Ga0496112_0204578 Ga0496112_0204578_718_1740 308
292 3300048921 Ga0496118_0008186 Ga0496118_0008186_1022_1969 308
293 3300048928 Ga0496125_0185339 Ga0496125_0185339_193_1164 308
294 3300049569 Ga0501032_0000199 Ga0501032_0000199_19527_20453 308
295 3300049571 Ga0501034_0000581 Ga0501034_0000581_40943_41878 308
296 3300049571 Ga0501034_0059367 Ga0501034_0059367_701_1639 308
297 3300049571 Ga0501034_0135700 Ga0501034_0135700_944_1870 308
298 3300049573 Ga0501037_0043193 Ga0501037_0043193_51_977 308
299 3300049579 Ga0501043_0045874 Ga0501043_0045874_27_953 308
300 3300049580 Ga0501046_0104843 Ga0501046_0104843_1068_2018 308
301 3300049581 Ga0501047_0020830 Ga0501047_0020830_3189_4193 308
302 3300049581 Ga0501047_0185899 Ga0501047_0185899_609_1577 308
303 3300049583 Ga0501067_0000106 Ga0501067_0000106_24478_25404 308
304 3300049584 Ga0501068_0000780 Ga0501068_0000780_3475_4401 308
305 3300049584 Ga0501068_0020193 Ga0501068_0020193_455_1528 308
306 3300049585 Ga0501069_0000981 Ga0501069_0000981_3604_4608 308
307 3300049586 Ga0501070_0001844 Ga0501070_0001844_9882_10886 308
308 3300049588 Ga0501072_0005732 Ga0501072_0005732_7762_8697 308
309 3300049589 Ga0501073_0000004 Ga0501073_0000004_238292_239218 308
310 3300049589 Ga0501073_0002180 Ga0501073_0002180_1831_2835 308
311 3300049589 Ga0501073_0011680 Ga0501073_0011680_5070_6038 308
312 3300049589 Ga0501073_0177133 Ga0501073_0177133_252_1199 308
313 3300049590 Ga0501074_0000803 Ga0501074_0000803_5676_6680 308
314 3300049590 Ga0501074_0196830 Ga0501074_0196830_371_1330 308
315 3300049592 Ga0501076_0133118 Ga0501076_0133118_811_1818 308
316 3300049593 Ga0501077_0000001 Ga0501077_0000001_26853_27779 308
317 3300049662 Ga0501222_000021 Ga0501222_000021_39163_40215 308
318 3300049669 Ga0501235_019392 Ga0501235_019392_222_1148 308
319 3300049741 Ga0501079_0008511 Ga0501079_0008511_4225_5229 308
320 3300049742 Ga0501080_0004992 Ga0501080_0004992_1474_2433 308
321 3300049742 Ga0501080_0017113 Ga0501080_0017113_1677_2603 308
322 3300049742 Ga0501080_0038396 Ga0501080_0038396_1123_2127 308
323 3300049742 Ga0501080_0187064 Ga0501080_0187064_284_1219 308
324 3300049744 Ga0501083_0012968 Ga0501083_0012968_614_1687 308
325 3300049822 Ga0501035_0233003 Ga0501035_0233003_267_1193 308
326 3300049823 Ga0501044_0031662 Ga0501044_0031662_4571_5521 308
327 3300049823 Ga0501044_0046422 Ga0501044_0046422_2927_3853 308
328 3300050496 nmdc:mga07m45_17039_c1 nmdc:mga07m45_17039_c1_151_1077 308
329 3300050496 nmdc:mga07m45_58_c1 nmdc:mga07m45_58_c1_38253_39227 308
330 3300050507 nmdc:mga05p37_671435_c1 nmdc:mga05p37_671435_c1_180_1118 308
331 3300050507 nmdc:mga05p37_86126_c1 nmdc:mga05p37_86126_c1_508_1500 308
332 3300050509 nmdc:mga0qj67_44108_c1 nmdc:mga0qj67_44108_c1_2464_3390 308
333 3300050510 nmdc:mga06r32_86910_c1 nmdc:mga06r32_86910_c1_1101_2027 308
334 3300050511 nmdc:mga08y16_14870_c1 nmdc:mga08y16_14870_c1_1297_2232 308
335 3300050511 nmdc:mga08y16_2351_c1 nmdc:mga08y16_2351_c1_3131_4084 308
336 3300050511 nmdc:mga08y16_35646_c1 nmdc:mga08y16_35646_c1_4038_5063 308
337 3300050512 nmdc:mga0n895_813_c1 nmdc:mga0n895_813_c1_17806_18732 308
338 3300050513 nmdc:mga0rr50_126126_c1 nmdc:mga0rr50_126126_c1_910_1836 308
339 3300050513 nmdc:mga0rr50_301682_c1 nmdc:mga0rr50_301682_c1_210_1136 308
340 3300050513 nmdc:mga0rr50_65198_c1 nmdc:mga0rr50_65198_c1_1633_2559 308
341 3300050514 nmdc:mga08x19_299779_c1 nmdc:mga08x19_299779_c1_52_1068 308
342 3300050515 nmdc:mga0a205_4770_c1 nmdc:mga0a205_4770_c1_6867_7793 308
343 3300059421 Ga0590071_010792 Ga0590071_010792_978_1904 308
344 3300059424 Ga0590075_006833 Ga0590075_006833_344_1453 308
345 3300061719 Ga0466962_0169810 Ga0466962_0169810_41_970 308
346 iso_pu_bacteria 2995948881 2995949414 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

82

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9381 1 223
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9329 3 218
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9196 1 225
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9183 1 222
5jsz-assembly1.cif.gz_A folate ecf transporter: apo state 0.9179 3 222
ID Description Score Start End Superfamily
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 1 222 3.40.50.300
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9457 3 222 3.40.50.300
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9454 3 222 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9426 3 225 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9417 20 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A352UF74-F1-model_v4 ABC transporter domain-containing protein 0.9555 1 168 GO:0005524
GO:0016887
AF-A0A7S2KT86-F1-model_v4 ABC transporter domain-containing protein 0.9551 3 141 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A060ZSW7-F1-model_v4 ABC transporter domain-containing protein 0.9548 1 182 GO:0005524
GO:0016020
GO:0016887
GO:0033700
GO:0043231
GO:0090554
GO:0090556
GO:0140359
AF-A0A0D1P4L1-F1-model_v4 deleted 0.954 1 222
AF-I0HK58-F1-model_v4 Sodium ABC transporter ATP-binding protein NatA 0.9526 5 222 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.06 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map