F416572

General Info

Members Datasets Scaffolds Average Seq Length
345 265 690 142

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0002196|Ga0500556_0002196_5628_6134
Length 168
Sequence MASRLQDSDDIAETHEINVTPFIDVMLVLLIIFMVAAPLSTVDIPVELPVSQAAPAAKPDKPLYVTLKGDLSLAVGNDMVLWGGLASALDAQTSSDRNKRLFLRADKTVPYGELMRLMDTLRAAGYLKVALVGLEGPPGSASAAAGPAPAFVPASTDSLPSPGGTTTP

Samples

Sample ID Description Type Environment
1 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
89 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
242 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
246 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
247 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
248 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
249 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
250 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
251 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
252 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
253 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
254 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
255 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
256 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
257 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
258 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
259 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
260 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
261 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
262 2932401849 Devosia sp. 2618 Isolate Rhizosphere
263 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
264 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
265 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0.87
Isolates 6.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.62
Nodule 1.74
Rhizoplane 4.35
Rhizosphere 72.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500556_0002196 3300053104 Bacteria 6549
2 JGI25153J46596_10007063 3300003215 Bacteria 5582
3 rootH2_10063305 3300003320 Bacteria 2224
4 Ga0070658_10003974 3300005327 Bacteria 12118
5 Ga0070658_10281199 3300005327 Bacteria 1416
6 Ga0070683_100159942 3300005329 Bacteria 2137
7 Ga0070683_100965804 3300005329 Bacteria 818
8 Ga0070680_100015434 3300005336 Bacteria 5987
9 Ga0070680_100207967 3300005336 Bacteria 1651
10 Ga0070680_100305689 3300005336 Bacteria 1349
11 Ga0068868_100528635 3300005338 Bacteria 1036
12 Ga0070660_100030716 3300005339 Bacteria 4031
13 Ga0070660_100266752 3300005339 Bacteria 1399
14 Ga0070692_10834915 3300005345 Bacteria 632
15 Ga0070688_100221253 3300005365 Bacteria 1334
16 Ga0070667_101687790 3300005367 Bacteria 596
17 Ga0070709_10010755 3300005434 Bacteria 5077
18 Ga0070709_10022843 3300005434 Bacteria 3665
19 Ga0070714_100004681 3300005435 Bacteria 10339
20 Ga0070714_100552161 3300005435 Bacteria 1103
21 Ga0070713_100082158 3300005436 Bacteria 2750
22 Ga0070710_10003057 3300005437 Bacteria 7954
23 Ga0070710_10276539 3300005437 Bacteria 1088
24 Ga0070711_100009285 3300005439 Bacteria 6050
25 Ga0070705_100629415 3300005440 Bacteria 834
26 Ga0070681_10350042 3300005458 Bacteria 1388
27 Ga0070685_10183778 3300005466 Bacteria 1348
28 Ga0070706_100513964 3300005467 Bacteria 1114
29 Ga0070698_100308556 3300005471 Bacteria 1513
30 Ga0070679_100509222 3300005530 Bacteria 1148
31 Ga0070679_100720007 3300005530 Bacteria 941
32 Ga0070684_100438146 3300005535 Bacteria 1207
33 Ga0068853_100420712 3300005539 Bacteria 1253
34 Ga0068853_100963255 3300005539 Bacteria 821
35 Ga0070665_100965064 3300005548 Bacteria 865
36 Ga0070704_101281178 3300005549 Bacteria 670
37 Ga0068855_100013780 3300005563 Bacteria 9746
38 Ga0068855_100055712 3300005563 Bacteria 4642
39 Ga0068857_100561598 3300005577 Bacteria 1076
40 Ga0068852_100101832 3300005616 Bacteria 2594
41 Ga0068852_100315308 3300005616 Bacteria 1517
42 Ga0068870_10556946 3300005840 Bacteria 773
43 Ga0068860_101849200 3300005843 Bacteria 626
44 Ga0081455_10053117 3300005937 Bacteria 3464
45 Ga0075365_10043401 3300006038 Bacteria 2944
46 Ga0075365_10068981 3300006038 Bacteria 2376
47 Ga0075365_10392133 3300006038 Bacteria 980
48 Ga0075365_10707479 3300006038 Bacteria 712
49 Ga0075364_10169231 3300006051 Bacteria 1477
50 Ga0075364_10387855 3300006051 Bacteria 953
51 Ga0070716_100002722 3300006173 Bacteria 8191
52 Ga0070716_100087531 3300006173 Bacteria 1877
53 Ga0070712_100018409 3300006175 Bacteria 4537
54 Ga0070712_100020811 3300006175 Bacteria 4297
55 Ga0075362_10023615 3300006177 Bacteria 2602
56 Ga0075367_10061594 3300006178 Bacteria 2239
57 Ga0075367_10368255 3300006178 Bacteria 907
58 Ga0075369_10020628 3300006186 Bacteria 2699
59 Ga0075369_10183597 3300006186 Bacteria 963
60 Ga0097621_101240337 3300006237 Bacteria 703
61 Ga0075370_10260347 3300006353 Bacteria 1029
62 Ga0068871_100715719 3300006358 Bacteria 918
63 Ga0068865_100440959 3300006881 Bacteria 1075
64 Ga0105247_10049377 3300009101 Bacteria 2587
65 Ga0105247_10471607 3300009101 Bacteria 909
66 Ga0105248_10011904 3300009177 Bacteria 9598
67 Ga0105237_10186250 3300009545 Bacteria 2076
68 Ga0105238_10183127 3300009551 Bacteria 2071
69 Ga0105035_107113 3300009988 Bacteria 936
70 Ga0105239_10148445 3300010375 Bacteria 2616
71 Ga0105239_12150970 3300010375 Bacteria 649
72 Ga0157373_10392419 3300013100 Bacteria 994
73 Ga0163162_10148920 3300013306 Bacteria 2457
74 Ga0163162_10894884 3300013306 Bacteria 1001
75 Ga0157515_127152 3300013875 Bacteria 803
76 Ga0157377_10191863 3300014745 Bacteria 1292
77 Ga0157379_10029971 3300014968 Bacteria 4839
78 Ga0157376_11378014 3300014969 Bacteria 736
79 Ga0163161_10933898 3300017792 Bacteria 737
80 Ga0206354_11042157 3300020081 Bacteria 689
81 Ga0206353_11373468 3300020082 Bacteria 775
82 Ga0206353_11409650 3300020082 Bacteria 656
83 Ga0209677_101234 3300025253 Bacteria 11590
84 Ga0209677_106095 3300025253 Bacteria 2956
85 Ga0209758_1000158 3300025297 Bacteria 156129
86 Ga0209758_1111999 3300025297 Bacteria 753
87 Ga0207692_10002834 3300025898 Bacteria 6699
88 Ga0207692_10024230 3300025898 Bacteria 2819
89 Ga0207710_10134850 3300025900 Bacteria 1188
90 Ga0207710_10303408 3300025900 Bacteria 807
91 Ga0207685_10004413 3300025905 Bacteria 3572
92 Ga0207685_10459858 3300025905 Bacteria 663
93 Ga0207699_10002223 3300025906 Bacteria 9155
94 Ga0207699_10083722 3300025906 Bacteria 1985
95 Ga0207699_10688792 3300025906 Bacteria 748
96 Ga0207705_10057461 3300025909 Bacteria 2806
97 Ga0207684_10689431 3300025910 Bacteria 869
98 Ga0207707_10330059 3300025912 Bacteria 1316
99 Ga0207693_10058208 3300025915 Bacteria 3028
100 Ga0207663_10030134 3300025916 Bacteria 3196
101 Ga0207660_10016935 3300025917 Bacteria 4836
102 Ga0207657_10013745 3300025919 Bacteria 7925
103 Ga0207649_10350813 3300025920 Bacteria 1092
104 Ga0207652_10232823 3300025921 Bacteria 1660
105 Ga0207652_10911427 3300025921 Bacteria 776
106 Ga0207700_10040694 3300025928 Bacteria 3394
107 Ga0207664_10009480 3300025929 Bacteria 6835
108 Ga0207686_10447432 3300025934 Bacteria 993
109 Ga0207670_10098684 3300025936 Bacteria 2082
110 Ga0207665_10077147 3300025939 Bacteria 2286
111 Ga0207665_10087664 3300025939 Bacteria 2151
112 Ga0207711_10022017 3300025941 Bacteria 5325
113 Ga0207661_10373081 3300025944 Bacteria 1290
114 Ga0207667_10051166 3300025949 Bacteria 4356
115 Ga0207667_10056329 3300025949 Bacteria 4130
116 Ga0207667_10326717 3300025949 Bacteria 1566
117 Ga0207668_10449529 3300025972 Bacteria 1099
118 Ga0207639_10258514 3300026041 Bacteria 1522
119 Ga0207639_10330452 3300026041 Bacteria 1356
120 Ga0207702_10497609 3300026078 Bacteria 1188
121 Ga0207698_10538817 3300026142 Bacteria 1142
122 Ga0207698_10540681 3300026142 Bacteria 1140
123 Ga0268265_11303770 3300028380 Bacteria 726
124 Ga0268264_10445279 3300028381 Bacteria 1254
125 Ga0265337_1021556 3300028556 Bacteria 2006
126 Ga0265326_10022110 3300028558 Bacteria 1822
127 Ga0265319_1002854 3300028563 Bacteria 9237
128 Ga0265334_10008153 3300028573 Bacteria 4461
129 Ga0265318_10002559 3300028577 Bacteria 9642
130 Ga0265323_10000744 3300028653 Bacteria 17485
131 Ga0265322_10068486 3300028654 Bacteria 1007
132 Ga0265336_10000228 3300028666 Bacteria 39886
133 Ga0265338_10000116 3300028800 Bacteria 146839
134 Ga0265324_10039073 3300029957 Bacteria 1646
135 Ga0265330_10021245 3300031235 Bacteria 2964
136 Ga0265325_10134902 3300031241 Bacteria 1179
137 Ga0265340_10009234 3300031247 Bacteria 5300
138 Ga0265340_10080974 3300031247 Bacteria 1529
139 Ga0265339_10072030 3300031249 Bacteria 1839
140 Ga0265339_10277505 3300031249 Bacteria 804
141 Ga0307513_10003349 3300031456 Bacteria 21769
142 Ga0307513_11002152 3300031456 Bacteria 545
143 Ga0265314_10220474 3300031711 Bacteria 1107
144 Ga0265342_10002657 3300031712 Bacteria 15264
145 Ga0265342_10262600 3300031712 Bacteria 918
146 Ga0307516_10019612 3300031730 Bacteria 7000
147 Ga0307412_11370733 3300031911 Bacteria 639
148 Ga0307416_100480899 3300032002 Bacteria 1302
149 Ga0307415_101324705 3300032126 Bacteria 683
150 Ga0307507_10006193 3300033179 Bacteria 18653
151 Ga0316215_1005708 3300033544 Bacteria 1203
152 Ga0373926_0032082 3300035083 Bacteria 1853
153 Ga0373929_0013923 3300035085 Bacteria 1548
154 Ga0373944_0036791 3300035089 Bacteria 1497
155 Ga0373949_0031040 3300035090 Bacteria 1273
156 Ga0373952_0067051 3300035092 Bacteria 890
157 Ga0373923_0083097 3300035111 Bacteria 1391
158 Ga0373939_0011492 3300035114 Bacteria 2236
159 Ga0373945_0005870 3300035116 Bacteria 3941
160 Ga0373945_0066236 3300035116 Bacteria 1358
161 Ga0373954_0027609 3300035118 Bacteria 2607
162 Ga0373946_0000788 3300035171 Bacteria 10802
163 Ga0373955_0019258 3300035172 Bacteria 3408
164 Ga0373942_0146244 3300035207 Bacteria 756
165 Ga0373924_0078206 3300035410 Bacteria 1404
166 Ga0373931_0162124 3300035691 Bacteria 1311
167 Ga0373935_0000529 3300035692 Bacteria 19900
168 Ga0373935_0106915 3300035692 Bacteria 1852
169 Ga0373927_0000564 3300035695 Bacteria 28279
170 Ga0373927_0010915 3300035695 Bacteria 6047
171 Ga0373933_0011931 3300035724 Bacteria 4797
172 Ga0373947_0002584 3300035725 Bacteria 10871
173 Ga0373947_0243149 3300035725 Bacteria 1188
174 Ga0373937_0231532 3300036401 Bacteria 1740
175 Ga0373925_0001217 3300037068 Bacteria 22723
176 Ga0373925_0042509 3300037068 Bacteria 3371
177 Ga0395899_0325791 3300037312 Bacteria 1033
178 Ga0395900_0010221 3300037418 Bacteria 9597
179 Ga0395900_0973290 3300037418 Bacteria 769
180 Ga0395898_0008581 3300037466 Bacteria 10784
181 Ga0395898_0011431 3300037466 Bacteria 9219
182 Ga0395905_0508286 3300037471 Bacteria 1105
183 Ga0395901_0149764 3300038443 Bacteria 2452
184 Ga0395901_1188605 3300038443 Bacteria 729
185 Ga0436365_0249760 3300039437 Bacteria 951
186 Ga0436363_1623591 3300039450 Bacteria 564
187 Ga0439447_072276 3300041407 Bacteria 801
188 Ga0439465_0205858 3300041413 Bacteria 718
189 Ga0439465_0238070 3300041413 Bacteria 671
190 Ga0439445_0279902 3300042004 Bacteria 501
191 Ga0450923_043374 3300042125 Bacteria 951
192 Ga0466963_1147490 3300044694 Bacteria 546
193 Ga0466971_0136027 3300044719 Bacteria 1143
194 Ga0466960_0117658 3300044901 Bacteria 1388
195 Ga0466967_0366713 3300045976 Bacteria 1396
196 Ga0466967_1356870 3300045976 Bacteria 708
197 Ga0495592_0113629 3300046454 Bacteria 1913
198 Ga0495603_0000072 3300046455 Bacteria 44178
199 Ga0495629_0000255 3300046459 Bacteria 46524
200 Ga0495629_0750118 3300046459 Bacteria 646
201 Ga0495638_0104615 3300046460 Bacteria 1688
202 Ga0495641_0001701 3300046461 Bacteria 18384
203 Ga0495653_0279694 3300046463 Bacteria 1096
204 Ga0495580_0006476 3300046472 Bacteria 9530
205 Ga0495582_0000015 3300046473 Bacteria 101848
206 Ga0495639_0000025 3300046475 Bacteria 68702
207 Ga0495662_0000508 3300046476 Bacteria 17697
208 Ga0495664_0009412 3300046477 Bacteria 5467
209 Ga0495664_0692908 3300046477 Bacteria 602
210 Ga0495584_0047996 3300046491 Bacteria 2153
211 Ga0495585_0117065 3300046492 Bacteria 1413
212 Ga0495594_0000156 3300046499 Bacteria 32566
213 Ga0495628_0018498 3300046516 Bacteria 5770
214 Ga0495630_0005885 3300046517 Bacteria 8673
215 Ga0495663_0004091 3300046525 Bacteria 4131
216 Ga0495666_0069214 3300046526 Bacteria 1679
217 Ga0495652_0044723 3300046529 Bacteria 3812
218 Ga0495665_0000194 3300046531 Bacteria 31352
219 Ga0495640_0012719 3300046533 Bacteria 6425
220 Ga0495622_0051552 3300046557 Bacteria 1909
221 Ga0495667_0114079 3300046559 Bacteria 1746
222 Ga0495634_0000723 3300046642 Bacteria 31979
223 Ga0495635_0000143 3300046663 Bacteria 43594
224 Ga0495588_0004720 3300046674 Bacteria 6025
225 Ga0495657_0126773 3300046675 Bacteria 1603
226 Ga0495599_0085183 3300046678 Bacteria 1974
227 Ga0495623_0228009 3300046679 Bacteria 1058
228 Ga0495647_0003863 3300046681 Bacteria 4828
229 Ga0495658_0002239 3300046683 Bacteria 9784
230 Ga0495613_0004768 3300046689 Bacteria 10176
231 Ga0495624_0000331 3300046690 Bacteria 37420
232 Ga0495600_0038579 3300046809 Bacteria 3109
233 Ga0495581_0000056 3300047315 Bacteria 42968
234 Ga0495604_0346867 3300047317 Bacteria 987
235 Ga0495674_0000332 3300047319 Bacteria 41530
236 Ga0495676_0090236 3300047321 Bacteria 2294
237 Ga0495684_0035875 3300047471 Bacteria 3802
238 Ga0495593_0000848 3300047673 Bacteria 17762
239 Ga0495614_0166968 3300048089 Bacteria 986
240 Ga0496100_0058244 3300048903 Bacteria 2534
241 Ga0496101_0019176 3300048904 Bacteria 4665
242 Ga0496102_0523546 3300048905 Bacteria 1108
243 Ga0496103_0427676 3300048906 Bacteria 850
244 Ga0496104_0066221 3300048907 Bacteria 3429
245 Ga0496105_0011759 3300048908 Bacteria 6926
246 Ga0496106_0042008 3300048909 Bacteria 3428
247 Ga0496107_0009095 3300048910 Bacteria 6887
248 Ga0496109_0030784 3300048912 Bacteria 4810
249 Ga0496110_0486927 3300048913 Bacteria 1123
250 Ga0496112_0122377 3300048915 Bacteria 2572
251 Ga0496112_0214272 3300048915 Bacteria 1883
252 Ga0496114_0022167 3300048917 Bacteria 5173
253 Ga0496115_0017378 3300048918 Bacteria 5498
254 Ga0496115_0283018 3300048918 Bacteria 1361
255 Ga0496118_0138248 3300048921 Bacteria 1550
256 Ga0496118_0191852 3300048921 Bacteria 1221
257 Ga0496118_0244065 3300048921 Bacteria 1026
258 Ga0496121_0104031 3300048924 Bacteria 2183
259 Ga0496123_0372423 3300048926 Bacteria 658
260 Ga0496124_0030168 3300048927 Bacteria 4817
261 Ga0496124_0264568 3300048927 Bacteria 1263
262 Ga0496125_0382290 3300048928 Bacteria 829
263 Ga0496125_0599818 3300048928 Bacteria 601
264 Ga0496126_0044825 3300048929 Bacteria 4070
265 Ga0501033_0370580 3300049570 Bacteria 1001
266 Ga0501034_0006481 3300049571 Bacteria 12599
267 Ga0501034_0285015 3300049571 Bacteria 1591
268 Ga0501034_0489326 3300049571 Bacteria 1145
269 Ga0501036_0138460 3300049572 Bacteria 2054
270 Ga0501038_0002932 3300049574 Bacteria 15916
271 Ga0501042_0631039 3300049578 Bacteria 779
272 Ga0501043_0000698 3300049579 Bacteria 29682
273 Ga0501043_0651826 3300049579 Bacteria 773
274 Ga0501046_0052759 3300049580 Bacteria 3204
275 Ga0501046_0912058 3300049580 Bacteria 612
276 Ga0501047_0084470 3300049581 Bacteria 3051
277 Ga0501047_0169971 3300049581 Bacteria 2049
278 Ga0501047_0751292 3300049581 Bacteria 791
279 Ga0501047_0894042 3300049581 Bacteria 701
280 Ga0501069_0153904 3300049585 Bacteria 1322
281 Ga0501071_0890419 3300049587 Bacteria 687
282 Ga0501073_0213177 3300049589 Bacteria 1334
283 Ga0501074_0395819 3300049590 Bacteria 980
284 Ga0501077_0691766 3300049593 Bacteria 655
285 Ga0501083_0017685 3300049744 Bacteria 4970
286 Ga0501035_0008347 3300049822 Bacteria 9641
287 Ga0501044_0113318 3300049823 Bacteria 2719
288 Ga0501044_0420530 3300049823 Bacteria 1246
289 Ga0501044_0824103 3300049823 Bacteria 806
290 Ga0501044_0861430 3300049823 Bacteria 782
291 nmdc:mga03683_275345_c1 3300050489 Bacteria 786
292 nmdc:mga00v17_232780_c1 3300050491 Bacteria 1194
293 nmdc:mga00v17_275453_c1 3300050491 Bacteria 1092
294 nmdc:mga0yw44_36059_c1 3300050492 Bacteria 2912
295 nmdc:mga0k408_167503_c1 3300050493 Bacteria 1309
296 nmdc:mga06z11_288023_c1 3300050494 Bacteria 974
297 nmdc:mga06z11_325271_c1 3300050494 Bacteria 918
298 nmdc:mga06z11_94378_c1 3300050494 Bacteria 1630
299 nmdc:mga07m45_236110_c1 3300050496 Bacteria 1064
300 nmdc:mga08x19_433650_c1 3300050514 Bacteria 924
301 nmdc:mga0sz30_63070_c1 3300050516 Bacteria 1586
302 Ga0495601_0455728 3300053077 Bacteria 827
303 Ga0500651_0276797 3300053093 Bacteria 969
304 Ga0500566_0089364 3300053094 Bacteria 1704
305 Ga0500555_040753 3300053103 Bacteria 1293
306 Ga0500556_0000511 3300053104 Bacteria 26561
307 Ga0500556_0001461 3300053104 Bacteria 9937
308 Ga0500572_000304 3300053111 Bacteria 17452
309 Ga0500595_005313 3300053119 Bacteria 5640
310 Ga0500559_0000438 3300053136 Bacteria 29552
311 Ga0500559_0265543 3300053136 Bacteria 808
312 Ga0500559_0319219 3300053136 Bacteria 728
313 Ga0500590_067945 3300053148 Bacteria 1777
314 Ga0500590_129446 3300053148 Bacteria 1170
315 Ga0500636_0063746 3300053177 Bacteria 2147
316 Ga0500636_0078560 3300053177 Bacteria 1904
317 Ga0500636_0095117 3300053177 Bacteria 1701
318 Ga0500637_0211343 3300053178 Bacteria 1100
319 Ga0500645_035443 3300053730 Bacteria 1486
320 Ga0500552_003438 3300053733 Bacteria 1609
321 Ga0500596_009030 3300053735 Bacteria 1568
322 Ga0501084_0234507 3300054114 Bacteria 1549
323 Ga0501082_0111099 3300060353 Bacteria 2372
324 2513893239 2513237141 Bacteria 8496279
325 2523104455 2522572158 Bacteria 6514390
326 2523467054 2523231067 Bacteria 5230452
327 2585155619 2582581280 Bacteria 5994497
328 2599103613 2597490356 Bacteria 7030811
329 2739348537 2738543031 Bacteria 5769731
330 2837681951 2837678835 Bacteria 5252418
331 2846957297 2846952575 Bacteria 6587527
332 2848863362 2848858292 Bacteria 7391279
333 2854683615 2854681122 Bacteria 4548679
334 2861694145 2861691609 Bacteria 5628931
335 2861695953 2861691609 Bacteria 5628931
336 2881159716 2881155292 Bacteria 6461656
337 2881859029 2881853255 Bacteria 6698367
338 2883579855 2883577096 Bacteria 4709178
339 2885348219 2885342637 Bacteria 7011821
340 2885356025 2885350715 Bacteria 6787678
341 2891636500 2891633521 Bacteria 4602265
342 2932402996 2932401849 Bacteria 4262978
343 2961129020 2961127735 Bacteria 7196641
344 2977986599 2977986579 Bacteria 6581278
345 8054006852 8054002106 Bacteria 7987183
346 Ga0500556_0002196
347 JGI25153J46596_10007063
348 rootH2_10063305
349 Ga0070658_10003974
350 Ga0070658_10281199
351 Ga0070683_100159942
352 Ga0070683_100965804
353 Ga0070680_100015434
354 Ga0070680_100207967
355 Ga0070680_100305689
356 Ga0068868_100528635
357 Ga0070660_100030716
358 Ga0070660_100266752
359 Ga0070692_10834915
360 Ga0070688_100221253
361 Ga0070667_101687790
362 Ga0070709_10010755
363 Ga0070709_10022843
364 Ga0070714_100004681
365 Ga0070714_100552161
366 Ga0070713_100082158
367 Ga0070710_10003057
368 Ga0070710_10276539
369 Ga0070711_100009285
370 Ga0070705_100629415
371 Ga0070681_10350042
372 Ga0070685_10183778
373 Ga0070706_100513964
374 Ga0070698_100308556
375 Ga0070679_100509222
376 Ga0070679_100720007
377 Ga0070684_100438146
378 Ga0068853_100420712
379 Ga0068853_100963255
380 Ga0070665_100965064
381 Ga0070704_101281178
382 Ga0068855_100013780
383 Ga0068855_100055712
384 Ga0068857_100561598
385 Ga0068852_100101832
386 Ga0068852_100315308
387 Ga0068870_10556946
388 Ga0068860_101849200
389 Ga0081455_10053117
390 Ga0075365_10043401
391 Ga0075365_10068981
392 Ga0075365_10392133
393 Ga0075365_10707479
394 Ga0075364_10169231
395 Ga0075364_10387855
396 Ga0070716_100002722
397 Ga0070716_100087531
398 Ga0070712_100018409
399 Ga0070712_100020811
400 Ga0075362_10023615
401 Ga0075367_10061594
402 Ga0075367_10368255
403 Ga0075369_10020628
404 Ga0075369_10183597
405 Ga0097621_101240337
406 Ga0075370_10260347
407 Ga0068871_100715719
408 Ga0068865_100440959
409 Ga0105247_10049377
410 Ga0105247_10471607
411 Ga0105248_10011904
412 Ga0105237_10186250
413 Ga0105238_10183127
414 Ga0105035_107113
415 Ga0105239_10148445
416 Ga0105239_12150970
417 Ga0157373_10392419
418 Ga0163162_10148920
419 Ga0163162_10894884
420 Ga0157515_127152
421 Ga0157377_10191863
422 Ga0157379_10029971
423 Ga0157376_11378014
424 Ga0163161_10933898
425 Ga0206354_11042157
426 Ga0206353_11373468
427 Ga0206353_11409650
428 Ga0209677_101234
429 Ga0209677_106095
430 Ga0209758_1000158
431 Ga0209758_1111999
432 Ga0207692_10002834
433 Ga0207692_10024230
434 Ga0207710_10134850
435 Ga0207710_10303408
436 Ga0207685_10004413
437 Ga0207685_10459858
438 Ga0207699_10002223
439 Ga0207699_10083722
440 Ga0207699_10688792
441 Ga0207705_10057461
442 Ga0207684_10689431
443 Ga0207707_10330059
444 Ga0207693_10058208
445 Ga0207663_10030134
446 Ga0207660_10016935
447 Ga0207657_10013745
448 Ga0207649_10350813
449 Ga0207652_10232823
450 Ga0207652_10911427
451 Ga0207700_10040694
452 Ga0207664_10009480
453 Ga0207686_10447432
454 Ga0207670_10098684
455 Ga0207665_10077147
456 Ga0207665_10087664
457 Ga0207711_10022017
458 Ga0207661_10373081
459 Ga0207667_10051166
460 Ga0207667_10056329
461 Ga0207667_10326717
462 Ga0207668_10449529
463 Ga0207639_10258514
464 Ga0207639_10330452
465 Ga0207702_10497609
466 Ga0207698_10538817
467 Ga0207698_10540681
468 Ga0268265_11303770
469 Ga0268264_10445279
470 Ga0265337_1021556
471 Ga0265326_10022110
472 Ga0265319_1002854
473 Ga0265334_10008153
474 Ga0265318_10002559
475 Ga0265323_10000744
476 Ga0265322_10068486
477 Ga0265336_10000228
478 Ga0265338_10000116
479 Ga0265324_10039073
480 Ga0265330_10021245
481 Ga0265325_10134902
482 Ga0265340_10009234
483 Ga0265340_10080974
484 Ga0265339_10072030
485 Ga0265339_10277505
486 Ga0307513_10003349
487 Ga0307513_11002152
488 Ga0265314_10220474
489 Ga0265342_10002657
490 Ga0265342_10262600
491 Ga0307516_10019612
492 Ga0307412_11370733
493 Ga0307416_100480899
494 Ga0307415_101324705
495 Ga0307507_10006193
496 Ga0316215_1005708
497 Ga0373926_0032082
498 Ga0373929_0013923
499 Ga0373944_0036791
500 Ga0373949_0031040
501 Ga0373952_0067051
502 Ga0373923_0083097
503 Ga0373939_0011492
504 Ga0373945_0005870
505 Ga0373945_0066236
506 Ga0373954_0027609
507 Ga0373946_0000788
508 Ga0373955_0019258
509 Ga0373942_0146244
510 Ga0373924_0078206
511 Ga0373931_0162124
512 Ga0373935_0000529
513 Ga0373935_0106915
514 Ga0373927_0000564
515 Ga0373927_0010915
516 Ga0373933_0011931
517 Ga0373947_0002584
518 Ga0373947_0243149
519 Ga0373937_0231532
520 Ga0373925_0001217
521 Ga0373925_0042509
522 Ga0395899_0325791
523 Ga0395900_0010221
524 Ga0395900_0973290
525 Ga0395898_0008581
526 Ga0395898_0011431
527 Ga0395905_0508286
528 Ga0395901_0149764
529 Ga0395901_1188605
530 Ga0436365_0249760
531 Ga0436363_1623591
532 Ga0439447_072276
533 Ga0439465_0205858
534 Ga0439465_0238070
535 Ga0439445_0279902
536 Ga0450923_043374
537 Ga0466963_1147490
538 Ga0466971_0136027
539 Ga0466960_0117658
540 Ga0466967_0366713
541 Ga0466967_1356870
542 Ga0495592_0113629
543 Ga0495603_0000072
544 Ga0495629_0000255
545 Ga0495629_0750118
546 Ga0495638_0104615
547 Ga0495641_0001701
548 Ga0495653_0279694
549 Ga0495580_0006476
550 Ga0495582_0000015
551 Ga0495639_0000025
552 Ga0495662_0000508
553 Ga0495664_0009412
554 Ga0495664_0692908
555 Ga0495584_0047996
556 Ga0495585_0117065
557 Ga0495594_0000156
558 Ga0495628_0018498
559 Ga0495630_0005885
560 Ga0495663_0004091
561 Ga0495666_0069214
562 Ga0495652_0044723
563 Ga0495665_0000194
564 Ga0495640_0012719
565 Ga0495622_0051552
566 Ga0495667_0114079
567 Ga0495634_0000723
568 Ga0495635_0000143
569 Ga0495588_0004720
570 Ga0495657_0126773
571 Ga0495599_0085183
572 Ga0495623_0228009
573 Ga0495647_0003863
574 Ga0495658_0002239
575 Ga0495613_0004768
576 Ga0495624_0000331
577 Ga0495600_0038579
578 Ga0495581_0000056
579 Ga0495604_0346867
580 Ga0495674_0000332
581 Ga0495676_0090236
582 Ga0495684_0035875
583 Ga0495593_0000848
584 Ga0495614_0166968
585 Ga0496100_0058244
586 Ga0496101_0019176
587 Ga0496102_0523546
588 Ga0496103_0427676
589 Ga0496104_0066221
590 Ga0496105_0011759
591 Ga0496106_0042008
592 Ga0496107_0009095
593 Ga0496109_0030784
594 Ga0496110_0486927
595 Ga0496112_0122377
596 Ga0496112_0214272
597 Ga0496114_0022167
598 Ga0496115_0017378
599 Ga0496115_0283018
600 Ga0496118_0138248
601 Ga0496118_0191852
602 Ga0496118_0244065
603 Ga0496121_0104031
604 Ga0496123_0372423
605 Ga0496124_0030168
606 Ga0496124_0264568
607 Ga0496125_0382290
608 Ga0496125_0599818
609 Ga0496126_0044825
610 Ga0501033_0370580
611 Ga0501034_0006481
612 Ga0501034_0285015
613 Ga0501034_0489326
614 Ga0501036_0138460
615 Ga0501038_0002932
616 Ga0501042_0631039
617 Ga0501043_0000698
618 Ga0501043_0651826
619 Ga0501046_0052759
620 Ga0501046_0912058
621 Ga0501047_0084470
622 Ga0501047_0169971
623 Ga0501047_0751292
624 Ga0501047_0894042
625 Ga0501069_0153904
626 Ga0501071_0890419
627 Ga0501073_0213177
628 Ga0501074_0395819
629 Ga0501077_0691766
630 Ga0501083_0017685
631 Ga0501035_0008347
632 Ga0501044_0113318
633 Ga0501044_0420530
634 Ga0501044_0824103
635 Ga0501044_0861430
636 nmdc:mga03683_275345_c1
637 nmdc:mga00v17_232780_c1
638 nmdc:mga00v17_275453_c1
639 nmdc:mga0yw44_36059_c1
640 nmdc:mga0k408_167503_c1
641 nmdc:mga06z11_288023_c1
642 nmdc:mga06z11_325271_c1
643 nmdc:mga06z11_94378_c1
644 nmdc:mga07m45_236110_c1
645 nmdc:mga08x19_433650_c1
646 nmdc:mga0sz30_63070_c1
647 Ga0495601_0455728
648 Ga0500651_0276797
649 Ga0500566_0089364
650 Ga0500555_040753
651 Ga0500556_0000511
652 Ga0500556_0001461
653 Ga0500572_000304
654 Ga0500595_005313
655 Ga0500559_0000438
656 Ga0500559_0265543
657 Ga0500559_0319219
658 Ga0500590_067945
659 Ga0500590_129446
660 Ga0500636_0063746
661 Ga0500636_0078560
662 Ga0500636_0095117
663 Ga0500637_0211343
664 Ga0500645_035443
665 Ga0500552_003438
666 Ga0500596_009030
667 Ga0501084_0234507
668 Ga0501082_0111099
669 2513893239
670 2523104455
671 2523467054
672 2585155619
673 2599103613
674 2739348537
675 2837681951
676 2846957297
677 2848863362
678 2854683615
679 2861694145
680 2861695953
681 2881159716
682 2881859029
683 2883579855
684 2885348219
685 2885356025
686 2891636500
687 2932402996
688 2961129020
689 2977986599
690 8054006852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

11

135

0.98

Map