F416545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 192 | 337 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0032905|Ga0501033_0032905_2119_2817 |
| Length | 232 |
| Sequence | MSPAAQSPASQSIVIAVDGTAASGKGTLAKRLAAHFGFAHLDSGALYRLTALAVVEAGGDPRSEQDAVRGAHAIDLSMAGDPAIRTDKIGQAASHVAAIGAVRAALLDFQRAFLAHPPGGSPGAVMDGRDIGTVICPTATAKLYVDARPELRANRRWRELAGMGIHRDEAELLKELMARDAADKARPISPLVQAPDAALLDTSDLGIEPAFAAALALVSPKVQSALKDRHRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 2 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 3 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 4 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 5 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 6 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 7 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 110 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 119 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 120 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 126 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 127 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 136 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 137 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 143 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 144 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 145 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 146 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 147 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 174 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 184 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 185 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 186 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 187 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 188 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 189 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 192 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.39 |
| Metatranscriptomes | 0.29 |
| Isolates | 2.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.83 |
| Nodule | 0 |
| Rhizoplane | 0.29 |
| Rhizosphere | 85.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 2 | JGI25165J46597_1008072 | 3300003214 | Bacteria | 1684 |
| 3 | rootH2_10055130 | 3300003320 | Bacteria | 1308 |
| 4 | Ga0070680_100188054 | 3300005336 | Bacteria | 1740 |
| 5 | Ga0070680_100214171 | 3300005336 | Bacteria | 1625 |
| 6 | Ga0070682_100005242 | 3300005337 | Bacteria | 7210 |
| 7 | Ga0070691_10050735 | 3300005341 | Bacteria | 1980 |
| 8 | Ga0070673_100881342 | 3300005364 | Bacteria | 829 |
| 9 | Ga0070659_100682333 | 3300005366 | Bacteria | 887 |
| 10 | Ga0070709_10000892 | 3300005434 | Bacteria | 16688 |
| 11 | Ga0070709_10194783 | 3300005434 | Bacteria | 1432 |
| 12 | Ga0070714_100015160 | 3300005435 | Bacteria | 6198 |
| 13 | Ga0070714_100196044 | 3300005435 | Bacteria | 1845 |
| 14 | Ga0070713_100000003 | 3300005436 | Bacteria | 245840 |
| 15 | Ga0070713_100061601 | 3300005436 | Bacteria | 3139 |
| 16 | Ga0070710_10045250 | 3300005437 | Bacteria | 2446 |
| 17 | Ga0070710_10109281 | 3300005437 | Bacteria | 1659 |
| 18 | Ga0070711_100021753 | 3300005439 | Bacteria | 4150 |
| 19 | Ga0070711_100150758 | 3300005439 | Bacteria | 1753 |
| 20 | Ga0070711_100908533 | 3300005439 | Bacteria | 752 |
| 21 | Ga0070663_100166180 | 3300005455 | Bacteria | 1702 |
| 22 | Ga0070681_10003737 | 3300005458 | Bacteria | 14283 |
| 23 | Ga0070706_100095277 | 3300005467 | Bacteria | 2762 |
| 24 | Ga0070699_100091745 | 3300005518 | Bacteria | 2656 |
| 25 | Ga0070679_100000734 | 3300005530 | Bacteria | 28346 |
| 26 | Ga0070679_100056201 | 3300005530 | Bacteria | 3922 |
| 27 | Ga0070679_100388807 | 3300005530 | Bacteria | 1341 |
| 28 | Ga0068853_100001764 | 3300005539 | Bacteria | 15895 |
| 29 | Ga0068853_100018389 | 3300005539 | Bacteria | 5784 |
| 30 | Ga0070695_100079773 | 3300005545 | Bacteria | 2162 |
| 31 | Ga0070693_100035371 | 3300005547 | Bacteria | 2770 |
| 32 | Ga0070704_100002514 | 3300005549 | Bacteria | 10315 |
| 33 | Ga0068855_100010524 | 3300005563 | Bacteria | 11157 |
| 34 | Ga0068855_100062780 | 3300005563 | Bacteria | 4336 |
| 35 | Ga0068857_100002420 | 3300005577 | Bacteria | 15228 |
| 36 | Ga0068854_100091304 | 3300005578 | Bacteria | 2266 |
| 37 | Ga0068856_100000719 | 3300005614 | Bacteria | 36011 |
| 38 | Ga0068856_100003762 | 3300005614 | Bacteria | 15216 |
| 39 | Ga0068858_100568906 | 3300005842 | Bacteria | 1098 |
| 40 | Ga0068860_100063329 | 3300005843 | Bacteria | 3513 |
| 41 | Ga0081455_10028005 | 3300005937 | Bacteria | 5154 |
| 42 | Ga0081455_10366220 | 3300005937 | Bacteria | 1012 |
| 43 | Ga0081455_10450545 | 3300005937 | Bacteria | 879 |
| 44 | Ga0081540_1135479 | 3300005983 | Bacteria | 998 |
| 45 | Ga0081539_10299881 | 3300005985 | Bacteria | 691 |
| 46 | Ga0075368_10019610 | 3300006042 | Bacteria | 2553 |
| 47 | Ga0070715_10170708 | 3300006163 | Bacteria | 1083 |
| 48 | Ga0070712_100000169 | 3300006175 | Bacteria | 35660 |
| 49 | Ga0070712_100313887 | 3300006175 | Bacteria | 1273 |
| 50 | Ga0075362_10038436 | 3300006177 | Bacteria | 2102 |
| 51 | Ga0075362_10166429 | 3300006177 | Bacteria | 1063 |
| 52 | Ga0075369_10093190 | 3300006186 | Bacteria | 1345 |
| 53 | Ga0075366_10044179 | 3300006195 | Bacteria | 2640 |
| 54 | Ga0075366_10181441 | 3300006195 | Bacteria | 1279 |
| 55 | Ga0075428_101252670 | 3300006844 | Bacteria | 781 |
| 56 | Ga0075430_100097849 | 3300006846 | Bacteria | 2451 |
| 57 | Ga0075436_100000038 | 3300006914 | Bacteria | 82918 |
| 58 | Ga0105240_10089159 | 3300009093 | Bacteria | 3773 |
| 59 | Ga0105240_10182050 | 3300009093 | Bacteria | 2479 |
| 60 | Ga0105240_10331707 | 3300009093 | Bacteria | 1731 |
| 61 | Ga0105240_10431870 | 3300009093 | Bacteria | 1478 |
| 62 | Ga0111539_10165244 | 3300009094 | Bacteria | 2588 |
| 63 | Ga0105241_10017676 | 3300009174 | Bacteria | 5243 |
| 64 | Ga0105237_10011891 | 3300009545 | Bacteria | 9205 |
| 65 | Ga0105238_10003588 | 3300009551 | Bacteria | 15470 |
| 66 | Ga0105238_10067682 | 3300009551 | Bacteria | 3572 |
| 67 | Ga0105249_10007085 | 3300009553 | Bacteria | 9787 |
| 68 | Ga0105239_10066970 | 3300010375 | Bacteria | 3945 |
| 69 | Ga0105239_10141205 | 3300010375 | Bacteria | 2684 |
| 70 | Ga0105246_10710609 | 3300011119 | Bacteria | 882 |
| 71 | Ga0105246_10926273 | 3300011119 | Bacteria | 783 |
| 72 | Ga0157373_10007365 | 3300013100 | Bacteria | 8191 |
| 73 | Ga0157373_10026943 | 3300013100 | Bacteria | 4148 |
| 74 | Ga0157370_10005041 | 3300013104 | Bacteria | 14920 |
| 75 | Ga0157369_10004747 | 3300013105 | Bacteria | 15970 |
| 76 | Ga0157372_10101565 | 3300013307 | Bacteria | 3283 |
| 77 | Ga0157380_10433191 | 3300014326 | Bacteria | 1258 |
| 78 | Ga0157379_10132174 | 3300014968 | Bacteria | 2247 |
| 79 | Ga0213876_10071448 | 3300021384 | Bacteria | 1833 |
| 80 | Ga0213871_10005835 | 3300021441 | Bacteria | 2572 |
| 81 | Ga0209677_102065 | 3300025253 | Bacteria | 7934 |
| 82 | Ga0209148_1004251 | 3300025254 | Bacteria | 3581 |
| 83 | Ga0209148_1014105 | 3300025254 | Bacteria | 1418 |
| 84 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 85 | Ga0209233_1001782 | 3300025261 | Bacteria | 8294 |
| 86 | Ga0209455_1003489 | 3300025272 | Bacteria | 5539 |
| 87 | Ga0207692_10356210 | 3300025898 | Bacteria | 903 |
| 88 | Ga0207685_10055194 | 3300025905 | Bacteria | 1550 |
| 89 | Ga0207699_10000676 | 3300025906 | Bacteria | 16381 |
| 90 | Ga0207684_10285358 | 3300025910 | Bacteria | 1423 |
| 91 | Ga0207707_10026797 | 3300025912 | Bacteria | 5037 |
| 92 | Ga0207695_10162274 | 3300025913 | Bacteria | 2166 |
| 93 | Ga0207695_10226027 | 3300025913 | Bacteria | 1778 |
| 94 | Ga0207695_10757945 | 3300025913 | Bacteria | 851 |
| 95 | Ga0207693_10000408 | 3300025915 | Bacteria | 39093 |
| 96 | Ga0207693_10152350 | 3300025915 | Bacteria | 1819 |
| 97 | Ga0207693_10233266 | 3300025915 | Bacteria | 1445 |
| 98 | Ga0207693_10280267 | 3300025915 | Bacteria | 1306 |
| 99 | Ga0207652_10064813 | 3300025921 | Bacteria | 3162 |
| 100 | Ga0207652_10093449 | 3300025921 | Bacteria | 2647 |
| 101 | Ga0207652_10390211 | 3300025921 | Bacteria | 1256 |
| 102 | Ga0207652_10410999 | 3300025921 | Bacteria | 1221 |
| 103 | Ga0207694_10038193 | 3300025924 | Bacteria | 3691 |
| 104 | Ga0207700_10000083 | 3300025928 | Bacteria | 58710 |
| 105 | Ga0207664_10011315 | 3300025929 | Bacteria | 6331 |
| 106 | Ga0207664_10055611 | 3300025929 | Bacteria | 3141 |
| 107 | Ga0207690_10024420 | 3300025932 | Bacteria | 3786 |
| 108 | Ga0207665_10296218 | 3300025939 | Bacteria | 1208 |
| 109 | Ga0207691_10992077 | 3300025940 | Bacteria | 701 |
| 110 | Ga0207679_10072771 | 3300025945 | Bacteria | 2597 |
| 111 | Ga0207667_10044809 | 3300025949 | Bacteria | 4686 |
| 112 | Ga0207651_11210353 | 3300025960 | Bacteria | 678 |
| 113 | Ga0207712_10001203 | 3300025961 | Bacteria | 17887 |
| 114 | Ga0207640_10070475 | 3300025981 | Bacteria | 2351 |
| 115 | Ga0207703_10660856 | 3300026035 | Bacteria | 992 |
| 116 | Ga0207639_10034312 | 3300026041 | Bacteria | 3749 |
| 117 | Ga0207639_10197974 | 3300026041 | Bacteria | 1721 |
| 118 | Ga0207639_10217060 | 3300026041 | Bacteria | 1650 |
| 119 | Ga0207702_10000045 | 3300026078 | Bacteria | 144714 |
| 120 | Ga0207702_10002929 | 3300026078 | Bacteria | 15968 |
| 121 | Ga0207674_10000026 | 3300026116 | Bacteria | 151359 |
| 122 | Ga0207675_101301894 | 3300026118 | Bacteria | 747 |
| 123 | Ga0209813_10021795 | 3300027866 | Bacteria | 1805 |
| 124 | Ga0268264_10044797 | 3300028381 | Bacteria | 3671 |
| 125 | Ga0265334_10160072 | 3300028573 | Bacteria | 792 |
| 126 | Ga0265336_10000235 | 3300028666 | Bacteria | 39578 |
| 127 | Ga0265338_10596978 | 3300028800 | Bacteria | 769 |
| 128 | Ga0265330_10016975 | 3300031235 | Bacteria | 3356 |
| 129 | Ga0265330_10137182 | 3300031235 | Bacteria | 1040 |
| 130 | Ga0265332_10111476 | 3300031238 | Bacteria | 1152 |
| 131 | Ga0265328_10000044 | 3300031239 | Bacteria | 84452 |
| 132 | Ga0265328_10000201 | 3300031239 | Bacteria | 27939 |
| 133 | Ga0265328_10002263 | 3300031239 | Bacteria | 8682 |
| 134 | Ga0265328_10003469 | 3300031239 | Bacteria | 6963 |
| 135 | Ga0265328_10016816 | 3300031239 | Bacteria | 2840 |
| 136 | Ga0265325_10051734 | 3300031241 | Bacteria | 2111 |
| 137 | Ga0265329_10012208 | 3300031242 | Bacteria | 3095 |
| 138 | Ga0265340_10000262 | 3300031247 | Bacteria | 27248 |
| 139 | Ga0265339_10089296 | 3300031249 | Bacteria | 1617 |
| 140 | Ga0265339_10092453 | 3300031249 | Bacteria | 1584 |
| 141 | Ga0265331_10000210 | 3300031250 | Bacteria | 70529 |
| 142 | Ga0265331_10000630 | 3300031250 | Bacteria | 30634 |
| 143 | Ga0265331_10049033 | 3300031250 | Bacteria | 2029 |
| 144 | Ga0265331_10155343 | 3300031250 | Bacteria | 1038 |
| 145 | Ga0265327_10018206 | 3300031251 | Bacteria | 4365 |
| 146 | Ga0265327_10056806 | 3300031251 | Bacteria | 2015 |
| 147 | Ga0265316_10000414 | 3300031344 | Bacteria | 48841 |
| 148 | Ga0265316_10076345 | 3300031344 | Bacteria | 2574 |
| 149 | Ga0265316_10324675 | 3300031344 | Bacteria | 1117 |
| 150 | Ga0265313_10041083 | 3300031595 | Bacteria | 2281 |
| 151 | Ga0265313_10124947 | 3300031595 | Bacteria | 1119 |
| 152 | Ga0265342_10060329 | 3300031712 | Bacteria | 2237 |
| 153 | Ga0316593_10047030 | 3300032168 | Bacteria | 1450 |
| 154 | Ga0373926_0371583 | 3300035083 | Bacteria | 562 |
| 155 | Ga0373923_0071454 | 3300035111 | Bacteria | 1491 |
| 156 | Ga0373939_0160997 | 3300035114 | Bacteria | 824 |
| 157 | Ga0373955_0207549 | 3300035172 | Bacteria | 1167 |
| 158 | Ga0373931_0155567 | 3300035691 | Bacteria | 1336 |
| 159 | Ga0373927_0082431 | 3300035695 | Bacteria | 2085 |
| 160 | Ga0373933_0008797 | 3300035724 | Bacteria | 5507 |
| 161 | Ga0373933_0178446 | 3300035724 | Bacteria | 1354 |
| 162 | Ga0373947_0122573 | 3300035725 | Bacteria | 1653 |
| 163 | Ga0373937_0016703 | 3300036401 | Bacteria | 6522 |
| 164 | Ga0316582_0215127 | 3300036647 | Bacteria | 1313 |
| 165 | Ga0316584_0345316 | 3300036712 | Bacteria | 1069 |
| 166 | Ga0373925_0141469 | 3300037068 | Bacteria | 1883 |
| 167 | Ga0373925_0276236 | 3300037068 | Bacteria | 1352 |
| 168 | Ga0436364_0597463 | 3300037853 | Bacteria | 1172 |
| 169 | Ga0436364_0877737 | 3300037853 | Bacteria | 1813 |
| 170 | Ga0436365_1104873 | 3300039437 | Bacteria | 14597 |
| 171 | Ga0436365_1524500 | 3300039437 | Bacteria | 1563 |
| 172 | Ga0436365_1744096 | 3300039437 | Bacteria | 5144 |
| 173 | Ga0436360_0632186 | 3300039438 | Bacteria | 2928 |
| 174 | Ga0436361_0031744 | 3300039447 | Bacteria | 4981 |
| 175 | Ga0436361_0088019 | 3300039447 | Bacteria | 746 |
| 176 | Ga0436361_0669471 | 3300039447 | Bacteria | 2996 |
| 177 | Ga0436361_0974578 | 3300039447 | Bacteria | 4075 |
| 178 | Ga0436363_0021631 | 3300039450 | Bacteria | 4908 |
| 179 | Ga0436363_0060563 | 3300039450 | Bacteria | 947 |
| 180 | Ga0436363_1417541 | 3300039450 | Bacteria | 2613 |
| 181 | Ga0439448_0082402 | 3300042005 | Bacteria | 1081 |
| 182 | Ga0450923_008233 | 3300042125 | Bacteria | 1788 |
| 183 | Ga0466966_0157593 | 3300044684 | Bacteria | 1383 |
| 184 | Ga0466961_0051386 | 3300044693 | Bacteria | 2633 |
| 185 | Ga0453684_0012470 | 3300044712 | Bacteria | 14005 |
| 186 | Ga0466970_0342765 | 3300044765 | Bacteria | 847 |
| 187 | Ga0466957_0161998 | 3300044842 | Bacteria | 1453 |
| 188 | Ga0466957_0203963 | 3300044842 | Bacteria | 1300 |
| 189 | Ga0466957_0274441 | 3300044842 | Bacteria | 1127 |
| 190 | Ga0466959_0010726 | 3300045049 | Bacteria | 6563 |
| 191 | Ga0466959_0124055 | 3300045049 | Bacteria | 1834 |
| 192 | Ga0451576_0007419 | 3300045051 | Bacteria | 13115 |
| 193 | Ga0466958_0077943 | 3300045836 | Bacteria | 2036 |
| 194 | Ga0466958_0270621 | 3300045836 | Bacteria | 1088 |
| 195 | Ga0466967_0598718 | 3300045976 | Bacteria | 1088 |
| 196 | Ga0495650_0055653 | 3300046471 | Bacteria | 1609 |
| 197 | Ga0495580_0075354 | 3300046472 | Bacteria | 2354 |
| 198 | Ga0495580_0090456 | 3300046472 | Bacteria | 2131 |
| 199 | Ga0495652_0342421 | 3300046529 | Bacteria | 1074 |
| 200 | Ga0495672_0185008 | 3300047320 | Bacteria | 1052 |
| 201 | Ga0496100_0065934 | 3300048903 | Bacteria | 2401 |
| 202 | Ga0496117_0083383 | 3300048920 | Bacteria | 2090 |
| 203 | Ga0496118_0016852 | 3300048921 | Bacteria | 6676 |
| 204 | Ga0496119_0164727 | 3300048922 | Bacteria | 1175 |
| 205 | Ga0496119_0429788 | 3300048922 | Bacteria | 625 |
| 206 | Ga0496121_0005644 | 3300048924 | Bacteria | 15919 |
| 207 | Ga0496121_0016228 | 3300048924 | Bacteria | 7706 |
| 208 | Ga0496126_0113864 | 3300048929 | Bacteria | 2354 |
| 209 | Ga0496126_0375169 | 3300048929 | Bacteria | 1159 |
| 210 | Ga0501031_0000905 | 3300049568 | Bacteria | 17854 |
| 211 | Ga0501031_0021638 | 3300049568 | Bacteria | 4192 |
| 212 | Ga0501031_0059896 | 3300049568 | Bacteria | 2481 |
| 213 | Ga0501032_0013547 | 3300049569 | Bacteria | 5796 |
| 214 | Ga0501032_0061102 | 3300049569 | Bacteria | 2526 |
| 215 | Ga0501032_0080778 | 3300049569 | Bacteria | 2163 |
| 216 | Ga0501032_0094635 | 3300049569 | Bacteria | 1981 |
| 217 | Ga0501032_0109596 | 3300049569 | Bacteria | 1828 |
| 218 | Ga0501032_0244928 | 3300049569 | Bacteria | 1164 |
| 219 | Ga0501033_0015585 | 3300049570 | Bacteria | 5764 |
| 220 | Ga0501033_0017686 | 3300049570 | Bacteria | 5384 |
| 221 | Ga0501033_0032905 | 3300049570 | Bacteria | 3893 |
| 222 | Ga0501033_0043008 | 3300049570 | Bacteria | 3365 |
| 223 | Ga0501033_0106910 | 3300049570 | Bacteria | 2038 |
| 224 | Ga0501033_0124494 | 3300049570 | Bacteria | 1869 |
| 225 | Ga0501033_0152532 | 3300049570 | Bacteria | 1666 |
| 226 | Ga0501034_0005434 | 3300049571 | Bacteria | 13930 |
| 227 | Ga0501034_0011560 | 3300049571 | Bacteria | 9142 |
| 228 | Ga0501034_0062415 | 3300049571 | Bacteria | 3741 |
| 229 | Ga0501034_0100250 | 3300049571 | Bacteria | 2890 |
| 230 | Ga0501034_0268640 | 3300049571 | Bacteria | 1647 |
| 231 | Ga0501036_0005195 | 3300049572 | Bacteria | 10531 |
| 232 | Ga0501036_0043574 | 3300049572 | Bacteria | 3801 |
| 233 | Ga0501036_0111952 | 3300049572 | Bacteria | 2306 |
| 234 | Ga0501036_0527825 | 3300049572 | Bacteria | 981 |
| 235 | Ga0501037_0009933 | 3300049573 | Bacteria | 6979 |
| 236 | Ga0501037_0071786 | 3300049573 | Bacteria | 2518 |
| 237 | Ga0501037_0083183 | 3300049573 | Bacteria | 2319 |
| 238 | Ga0501037_0319858 | 3300049573 | Bacteria | 1074 |
| 239 | Ga0501038_0021444 | 3300049574 | Bacteria | 5797 |
| 240 | Ga0501038_0046444 | 3300049574 | Bacteria | 3765 |
| 241 | Ga0501038_0122438 | 3300049574 | Bacteria | 2143 |
| 242 | Ga0501038_0188750 | 3300049574 | Bacteria | 1659 |
| 243 | Ga0501038_0201829 | 3300049574 | Bacteria | 1595 |
| 244 | Ga0501038_0256789 | 3300049574 | Bacteria | 1382 |
| 245 | Ga0501038_0257339 | 3300049574 | Bacteria | 1381 |
| 246 | Ga0501039_0004629 | 3300049575 | Bacteria | 10399 |
| 247 | Ga0501039_0067788 | 3300049575 | Bacteria | 2771 |
| 248 | Ga0501039_0311606 | 3300049575 | Bacteria | 1237 |
| 249 | Ga0501043_0038415 | 3300049579 | Bacteria | 3764 |
| 250 | Ga0501043_0067749 | 3300049579 | Bacteria | 2803 |
| 251 | Ga0501043_0210866 | 3300049579 | Bacteria | 1505 |
| 252 | Ga0501043_0254690 | 3300049579 | Bacteria | 1351 |
| 253 | Ga0501046_0154045 | 3300049580 | Bacteria | 1733 |
| 254 | Ga0501047_0006073 | 3300049581 | Bacteria | 11352 |
| 255 | Ga0501047_0007555 | 3300049581 | Bacteria | 10231 |
| 256 | Ga0501047_0008129 | 3300049581 | Bacteria | 9901 |
| 257 | Ga0501047_0012359 | 3300049581 | Bacteria | 8083 |
| 258 | Ga0501047_0032107 | 3300049581 | Bacteria | 5067 |
| 259 | Ga0501047_0050725 | 3300049581 | Bacteria | 4007 |
| 260 | Ga0501047_0132792 | 3300049581 | Bacteria | 2369 |
| 261 | Ga0501047_0133539 | 3300049581 | Bacteria | 2362 |
| 262 | Ga0501047_0167509 | 3300049581 | Bacteria | 2067 |
| 263 | Ga0501047_0169559 | 3300049581 | Bacteria | 2052 |
| 264 | Ga0501047_0176115 | 3300049581 | Bacteria | 2006 |
| 265 | Ga0501047_0207009 | 3300049581 | Bacteria | 1821 |
| 266 | Ga0501047_0324341 | 3300049581 | Bacteria | 1379 |
| 267 | Ga0501048_0157857 | 3300049582 | Bacteria | 1604 |
| 268 | Ga0501067_0007529 | 3300049583 | Bacteria | 6051 |
| 269 | Ga0501067_0024813 | 3300049583 | Bacteria | 3324 |
| 270 | Ga0501068_0077780 | 3300049584 | Bacteria | 2032 |
| 271 | Ga0501068_0114768 | 3300049584 | Bacteria | 1677 |
| 272 | Ga0501068_0128202 | 3300049584 | Bacteria | 1585 |
| 273 | Ga0501069_0350635 | 3300049585 | Unclassified | 870 |
| 274 | Ga0501070_0000015 | 3300049586 | Bacteria | 179449 |
| 275 | Ga0501070_0016752 | 3300049586 | Bacteria | 6152 |
| 276 | Ga0501070_0023675 | 3300049586 | Bacteria | 5145 |
| 277 | Ga0501070_0157264 | 3300049586 | Bacteria | 1874 |
| 278 | Ga0501071_0442958 | 3300049587 | Bacteria | 994 |
| 279 | Ga0501072_0060783 | 3300049588 | Bacteria | 2979 |
| 280 | Ga0501073_0017576 | 3300049589 | Bacteria | 5178 |
| 281 | Ga0501073_0038342 | 3300049589 | Bacteria | 3399 |
| 282 | Ga0501074_0022111 | 3300049590 | Bacteria | 4620 |
| 283 | Ga0501074_0058303 | 3300049590 | Bacteria | 2781 |
| 284 | Ga0501079_0003370 | 3300049741 | Bacteria | 11724 |
| 285 | Ga0501080_0004107 | 3300049742 | Bacteria | 12902 |
| 286 | Ga0501080_0019722 | 3300049742 | Bacteria | 6244 |
| 287 | Ga0501080_0025146 | 3300049742 | Bacteria | 5526 |
| 288 | Ga0501080_0073326 | 3300049742 | Bacteria | 3185 |
| 289 | Ga0501080_0463244 | 3300049742 | Bacteria | 1135 |
| 290 | Ga0501083_0122669 | 3300049744 | Bacteria | 1704 |
| 291 | Ga0501083_0193202 | 3300049744 | Bacteria | 1328 |
| 292 | Ga0501083_0366854 | 3300049744 | Bacteria | 936 |
| 293 | Ga0501035_0007878 | 3300049822 | Bacteria | 9954 |
| 294 | Ga0501035_0013061 | 3300049822 | Bacteria | 7664 |
| 295 | Ga0501035_0078735 | 3300049822 | Bacteria | 2911 |
| 296 | Ga0501035_0094721 | 3300049822 | Bacteria | 2625 |
| 297 | Ga0501035_0173493 | 3300049822 | Bacteria | 1862 |
| 298 | Ga0501035_0179911 | 3300049822 | Bacteria | 1822 |
| 299 | Ga0501035_0298832 | 3300049822 | Bacteria | 1357 |
| 300 | Ga0501035_0710505 | 3300049822 | Bacteria | 810 |
| 301 | Ga0501044_0000530 | 3300049823 | Bacteria | 46371 |
| 302 | Ga0501044_0007031 | 3300049823 | Bacteria | 12383 |
| 303 | Ga0501044_0063947 | 3300049823 | Bacteria | 3757 |
| 304 | Ga0501044_0090428 | 3300049823 | Bacteria | 3088 |
| 305 | Ga0501044_0139184 | 3300049823 | Bacteria | 2416 |
| 306 | Ga0501044_0162545 | 3300049823 | Bacteria | 2208 |
| 307 | Ga0501044_0176523 | 3300049823 | Bacteria | 2105 |
| 308 | Ga0501044_0184864 | 3300049823 | Bacteria | 2049 |
| 309 | Ga0501044_0232134 | 3300049823 | Bacteria | 1792 |
| 310 | Ga0501044_0250012 | 3300049823 | Bacteria | 1714 |
| 311 | Ga0501044_0315496 | 3300049823 | Bacteria | 1489 |
| 312 | Ga0501044_0499770 | 3300049823 | Bacteria | 1117 |
| 313 | Ga0501044_0936998 | 3300049823 | Bacteria | 740 |
| 314 | Ga0501045_0332317 | 3300049824 | Bacteria | 1131 |
| 315 | nmdc:mga03683_75385_c1 | 3300050489 | Bacteria | 1448 |
| 316 | nmdc:mga00v17_119366_c1 | 3300050491 | Bacteria | 1678 |
| 317 | nmdc:mga0yw44_122212_c1 | 3300050492 | Bacteria | 1678 |
| 318 | nmdc:mga0k408_215399_c1 | 3300050493 | Bacteria | 1147 |
| 319 | nmdc:mga0k408_25133_c2 | 3300050493 | Bacteria | 1513 |
| 320 | nmdc:mga04h51_8945_c1 | 3300050495 | Bacteria | 2694 |
| 321 | nmdc:mga06r32_450329_c1 | 3300050510 | Bacteria | 1267 |
| 322 | nmdc:mga08y16_497914_c1 | 3300050511 | Bacteria | 1238 |
| 323 | nmdc:mga08y16_62054_c1 | 3300050511 | Bacteria | 3903 |
| 324 | nmdc:mga0rr50_61750_c1 | 3300050513 | Bacteria | 2824 |
| 325 | nmdc:mga08x19_615396_c1 | 3300050514 | Bacteria | 770 |
| 326 | nmdc:mga08x19_95_c1 | 3300050514 | Bacteria | 78182 |
| 327 | Ga0495601_0324928 | 3300053077 | Bacteria | 1002 |
| 328 | Ga0500641_0153660 | 3300053096 | Bacteria | 993 |
| 329 | Ga0500650_0086067 | 3300053098 | Bacteria | 1471 |
| 330 | Ga0500642_0081854 | 3300053130 | Bacteria | 1484 |
| 331 | Ga0500616_0003430 | 3300053153 | Bacteria | 12111 |
| 332 | Ga0500637_0245024 | 3300053178 | Bacteria | 1003 |
| 333 | Ga0500552_001043 | 3300053733 | Bacteria | 2617 |
| 334 | Ga0501084_0016689 | 3300054114 | Bacteria | 6098 |
| 335 | Ga0501082_0004309 | 3300060353 | Bacteria | 12443 |
| 336 | Ga0501082_0202214 | 3300060353 | Bacteria | 1728 |
| 337 | Ga0466962_0139930 | 3300061719 | Bacteria | 1172 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_497914_c1 | nmdc:mga08y16_497914_c1_716_1228 | 170 |
| 2 | 3300035083 | Ga0373926_0371583 | Ga0373926_0371583_12_536 | 174 |
| 3 | 3300048922 | Ga0496119_0429788 | Ga0496119_0429788_78_605 | 175 |
| 4 | 3300049571 | Ga0501034_0062415 | Ga0501034_0062415_705_1328 | 187 |
| 5 | 3300049574 | Ga0501038_0046444 | Ga0501038_0046444_3079_3702 | 187 |
| 6 | 3300049581 | Ga0501047_0007555 | Ga0501047_0007555_2203_2826 | 187 |
| 7 | 3300049584 | Ga0501068_0114768 | Ga0501068_0114768_87_710 | 187 |
| 8 | 3300006846 | Ga0075430_100097849 | Ga0075430_1000978492 | 189 |
| 9 | 3300049568 | Ga0501031_0021638 | Ga0501031_0021638_2372_2992 | 189 |
| 10 | 3300049569 | Ga0501032_0061102 | Ga0501032_0061102_867_1487 | 189 |
| 11 | 3300049570 | Ga0501033_0043008 | Ga0501033_0043008_1224_1844 | 189 |
| 12 | 3300049571 | Ga0501034_0100250 | Ga0501034_0100250_1222_1842 | 189 |
| 13 | 3300049572 | Ga0501036_0111952 | Ga0501036_0111952_767_1387 | 189 |
| 14 | 3300049574 | Ga0501038_0122438 | Ga0501038_0122438_909_1529 | 189 |
| 15 | 3300049575 | Ga0501039_0067788 | Ga0501039_0067788_945_1565 | 189 |
| 16 | 3300049579 | Ga0501043_0254690 | Ga0501043_0254690_187_807 | 189 |
| 17 | 3300049581 | Ga0501047_0132792 | Ga0501047_0132792_944_1564 | 189 |
| 18 | 3300049586 | Ga0501070_0157264 | Ga0501070_0157264_631_1251 | 189 |
| 19 | 3300049823 | Ga0501044_0184864 | Ga0501044_0184864_800_1420 | 189 |
| 20 | 3300050510 | nmdc:mga06r32_450329_c1 | nmdc:mga06r32_450329_c1_556_1179 | 189 |
| 21 | 3300049575 | Ga0501039_0311606 | Ga0501039_0311606_509_1132 | 190 |
| 22 | 3300049823 | Ga0501044_0139184 | Ga0501044_0139184_781_1401 | 191 |
| 23 | 3300006844 | Ga0075428_101252670 | Ga0075428_1012526702 | 194 |
| 24 | 3300049581 | Ga0501047_0324341 | Ga0501047_0324341_269_895 | 194 |
| 25 | 3300005530 | Ga0070679_100388807 | Ga0070679_1003888072 | 195 |
| 26 | 3300025921 | Ga0207652_10390211 | Ga0207652_103902112 | 195 |
| 27 | 3300025921 | Ga0207652_10410999 | Ga0207652_104109992 | 195 |
| 28 | 3300049570 | Ga0501033_0124494 | Ga0501033_0124494_864_1490 | 195 |
| 29 | 3300049573 | Ga0501037_0071786 | Ga0501037_0071786_138_764 | 195 |
| 30 | 3300039447 | Ga0436361_0974578 | Ga0436361_0974578_2786_3430 | 196 |
| 31 | 3300039450 | Ga0436363_0021631 | Ga0436363_0021631_700_1344 | 196 |
| 32 | 3300031239 | Ga0265328_10016816 | Ga0265328_100168163 | 197 |
| 33 | 3300049822 | Ga0501035_0179911 | Ga0501035_0179911_739_1407 | 197 |
| 34 | 3300049823 | Ga0501044_0176523 | Ga0501044_0176523_1035_1703 | 197 |
| 35 | 3300049581 | Ga0501047_0169559 | Ga0501047_0169559_427_1101 | 199 |
| 36 | 3300049744 | Ga0501083_0366854 | Ga0501083_0366854_10_642 | 199 |
| 37 | 3300039447 | Ga0436361_0088019 | Ga0436361_0088019_94_732 | 200 |
| 38 | 3300049585 | Ga0501069_0350635 | Ga0501069_0350635_30_647 | 203 |
| 39 | 3300037068 | Ga0373925_0276236 | Ga0373925_0276236_710_1327 | 205 |
| 40 | 3300049569 | Ga0501032_0244928 | Ga0501032_0244928_409_1032 | 206 |
| 41 | 3300049572 | Ga0501036_0527825 | Ga0501036_0527825_317_937 | 206 |
| 42 | 3300049573 | Ga0501037_0319858 | Ga0501037_0319858_257_877 | 206 |
| 43 | 3300049581 | Ga0501047_0008129 | Ga0501047_0008129_3636_4259 | 206 |
| 44 | 3300049581 | Ga0501047_0176115 | Ga0501047_0176115_1191_1811 | 206 |
| 45 | 3300049742 | Ga0501080_0025146 | Ga0501080_0025146_2385_3008 | 206 |
| 46 | 3300049822 | Ga0501035_0710505 | Ga0501035_0710505_93_716 | 206 |
| 47 | 3300049823 | Ga0501044_0090428 | Ga0501044_0090428_107_730 | 206 |
| 48 | 3300049823 | Ga0501044_0499770 | Ga0501044_0499770_452_1072 | 206 |
| 49 | iso_pu_bacteria | 2738541281 | 2738745755 | 206 |
| 50 | iso_pu_bacteria | 2738543032 | 2739354985 | 206 |
| 51 | iso_pu_bacteria | 2842698319 | 2842701852 | 206 |
| 52 | iso_pu_bacteria | 2842775625 | 2842777341 | 206 |
| 53 | iso_pu_bacteria | 2891048133 | 2891048302 | 206 |
| 54 | iso_pu_bacteria | 8002060224 | 8002062608 | 206 |
| 55 | 3300005364 | Ga0070673_100881342 | Ga0070673_1008813422 | 207 |
| 56 | 3300011119 | Ga0105246_10926273 | Ga0105246_109262731 | 207 |
| 57 | 3300014326 | Ga0157380_10433191 | Ga0157380_104331912 | 207 |
| 58 | 3300025940 | Ga0207691_10992077 | Ga0207691_109920771 | 207 |
| 59 | 3300025960 | Ga0207651_11210353 | Ga0207651_112103531 | 207 |
| 60 | 3300026118 | Ga0207675_101301894 | Ga0207675_1013018941 | 207 |
| 61 | iso_pu_bacteria | 2883577096 | 2883579024 | 207 |
| 62 | 3300005467 | Ga0070706_100095277 | Ga0070706_1000952772 | 208 |
| 63 | 3300006042 | Ga0075368_10019610 | Ga0075368_100196103 | 208 |
| 64 | 3300006163 | Ga0070715_10170708 | Ga0070715_101707081 | 208 |
| 65 | 3300006177 | Ga0075362_10038436 | Ga0075362_100384362 | 208 |
| 66 | 3300006177 | Ga0075362_10166429 | Ga0075362_101664292 | 208 |
| 67 | 3300006186 | Ga0075369_10093190 | Ga0075369_100931902 | 208 |
| 68 | 3300006195 | Ga0075366_10181441 | Ga0075366_101814411 | 208 |
| 69 | 3300009093 | Ga0105240_10331707 | Ga0105240_103317071 | 208 |
| 70 | 3300009551 | Ga0105238_10067682 | Ga0105238_100676825 | 208 |
| 71 | 3300025905 | Ga0207685_10055194 | Ga0207685_100551942 | 208 |
| 72 | 3300025910 | Ga0207684_10285358 | Ga0207684_102853582 | 208 |
| 73 | 3300025913 | Ga0207695_10757945 | Ga0207695_107579451 | 208 |
| 74 | 3300025915 | Ga0207693_10233266 | Ga0207693_102332662 | 208 |
| 75 | 3300026041 | Ga0207639_10197974 | Ga0207639_101979742 | 208 |
| 76 | 3300027866 | Ga0209813_10021795 | Ga0209813_100217952 | 208 |
| 77 | 3300028573 | Ga0265334_10160072 | Ga0265334_101600721 | 208 |
| 78 | 3300031344 | Ga0265316_10324675 | Ga0265316_103246751 | 208 |
| 79 | 3300035111 | Ga0373923_0071454 | Ga0373923_0071454_796_1446 | 208 |
| 80 | 3300035172 | Ga0373955_0207549 | Ga0373955_0207549_21_671 | 208 |
| 81 | 3300035691 | Ga0373931_0155567 | Ga0373931_0155567_568_1200 | 208 |
| 82 | 3300035695 | Ga0373927_0082431 | Ga0373927_0082431_149_784 | 208 |
| 83 | 3300035724 | Ga0373933_0178446 | Ga0373933_0178446_617_1267 | 208 |
| 84 | 3300035725 | Ga0373947_0122573 | Ga0373947_0122573_885_1520 | 208 |
| 85 | 3300037068 | Ga0373925_0141469 | Ga0373925_0141469_522_1157 | 208 |
| 86 | 3300039450 | Ga0436363_0060563 | Ga0436363_0060563_257_883 | 208 |
| 87 | 3300045836 | Ga0466958_0270621 | Ga0466958_0270621_366_992 | 208 |
| 88 | 3300046472 | Ga0495580_0090456 | Ga0495580_0090456_620_1270 | 208 |
| 89 | 3300046529 | Ga0495652_0342421 | Ga0495652_0342421_379_1029 | 208 |
| 90 | 3300048929 | Ga0496126_0375169 | Ga0496126_0375169_412_1062 | 208 |
| 91 | 3300050489 | nmdc:mga03683_75385_c1 | nmdc:mga03683_75385_c1_742_1380 | 208 |
| 92 | 3300050491 | nmdc:mga00v17_119366_c1 | nmdc:mga00v17_119366_c1_719_1351 | 208 |
| 93 | 3300050492 | nmdc:mga0yw44_122212_c1 | nmdc:mga0yw44_122212_c1_806_1444 | 208 |
| 94 | 3300050493 | nmdc:mga0k408_25133_c2 | nmdc:mga0k408_25133_c2_426_1058 | 208 |
| 95 | 3300050495 | nmdc:mga04h51_8945_c1 | nmdc:mga04h51_8945_c1_983_1657 | 208 |
| 96 | 3300050514 | nmdc:mga08x19_615396_c1 | nmdc:mga08x19_615396_c1_106_747 | 208 |
| 97 | 3300053098 | Ga0500650_0086067 | Ga0500650_0086067_672_1310 | 208 |
| 98 | 3300053130 | Ga0500642_0081854 | Ga0500642_0081854_44_682 | 208 |
| 99 | 3300053153 | Ga0500616_0003430 | Ga0500616_0003430_879_1517 | 208 |
| 100 | 3300053178 | Ga0500637_0245024 | Ga0500637_0245024_261_890 | 208 |
| 101 | 3300053733 | Ga0500552_001043 | Ga0500552_001043_746_1378 | 208 |
| 102 | 3300005336 | Ga0070680_100214171 | Ga0070680_1002141712 | 209 |
| 103 | 3300005985 | Ga0081539_10299881 | Ga0081539_102998811 | 209 |
| 104 | 3300006195 | Ga0075366_10044179 | Ga0075366_100441793 | 209 |
| 105 | 3300021441 | Ga0213871_10005835 | Ga0213871_100058352 | 209 |
| 106 | 3300025913 | Ga0207695_10226027 | Ga0207695_102260272 | 209 |
| 107 | 3300031235 | Ga0265330_10137182 | Ga0265330_101371822 | 209 |
| 108 | 3300031239 | Ga0265328_10000044 | Ga0265328_1000004466 | 209 |
| 109 | 3300031239 | Ga0265328_10000201 | Ga0265328_1000020126 | 209 |
| 110 | 3300031242 | Ga0265329_10012208 | Ga0265329_100122081 | 209 |
| 111 | 3300031250 | Ga0265331_10000210 | Ga0265331_1000021048 | 209 |
| 112 | 3300031250 | Ga0265331_10155343 | Ga0265331_101553432 | 209 |
| 113 | 3300031251 | Ga0265327_10056806 | Ga0265327_100568062 | 209 |
| 114 | 3300031344 | Ga0265316_10000414 | Ga0265316_1000041429 | 209 |
| 115 | 3300039438 | Ga0436360_0632186 | Ga0436360_0632186_1745_2377 | 209 |
| 116 | 3300039447 | Ga0436361_0669471 | Ga0436361_0669471_1882_2511 | 209 |
| 117 | 3300044712 | Ga0453684_0012470 | Ga0453684_0012470_8849_9505 | 209 |
| 118 | 3300049581 | Ga0501047_0207009 | Ga0501047_0207009_180_809 | 209 |
| 119 | 3300049742 | Ga0501080_0463244 | Ga0501080_0463244_60_689 | 209 |
| 120 | 3300050493 | nmdc:mga0k408_215399_c1 | nmdc:mga0k408_215399_c1_144_773 | 209 |
| 121 | 3300009093 | Ga0105240_10431870 | Ga0105240_104318702 | 210 |
| 122 | 3300009094 | Ga0111539_10165244 | Ga0111539_101652442 | 210 |
| 123 | 3300011119 | Ga0105246_10710609 | Ga0105246_107106092 | 210 |
| 124 | 3300031239 | Ga0265328_10002263 | Ga0265328_100022632 | 210 |
| 125 | 3300031239 | Ga0265328_10003469 | Ga0265328_100034696 | 210 |
| 126 | 3300031250 | Ga0265331_10000630 | Ga0265331_1000063021 | 210 |
| 127 | 3300031251 | Ga0265327_10018206 | Ga0265327_100182066 | 210 |
| 128 | 3300032168 | Ga0316593_10047030 | Ga0316593_100470302 | 210 |
| 129 | 3300036647 | Ga0316582_0215127 | Ga0316582_0215127_607_1245 | 210 |
| 130 | 3300036712 | Ga0316584_0345316 | Ga0316584_0345316_196_834 | 210 |
| 131 | 3300050511 | nmdc:mga08y16_62054_c1 | nmdc:mga08y16_62054_c1_1271_1903 | 210 |
| 132 | iso_pu_bacteria | 2861691609 | 2861692111 | 210 |
| 133 | 3300042125 | Ga0450923_008233 | Ga0450923_008233_869_1504 | 211 |
| 134 | 3300044693 | Ga0466961_0051386 | Ga0466961_0051386_90_728 | 211 |
| 135 | 3300044842 | Ga0466957_0274441 | Ga0466957_0274441_124_762 | 211 |
| 136 | 3300045049 | Ga0466959_0010726 | Ga0466959_0010726_1903_2541 | 211 |
| 137 | 3300045836 | Ga0466958_0077943 | Ga0466958_0077943_808_1446 | 211 |
| 138 | 3300061719 | Ga0466962_0139930 | Ga0466962_0139930_213_851 | 211 |
| 139 | 3300003214 | JGI25165J46597_1008072 | JGI25165J46597_10080722 | 212 |
| 140 | 3300005337 | Ga0070682_100005242 | Ga0070682_1000052429 | 212 |
| 141 | 3300005341 | Ga0070691_10050735 | Ga0070691_100507352 | 212 |
| 142 | 3300005366 | Ga0070659_100682333 | Ga0070659_1006823332 | 212 |
| 143 | 3300005435 | Ga0070714_100196044 | Ga0070714_1001960443 | 212 |
| 144 | 3300005436 | Ga0070713_100061601 | Ga0070713_1000616014 | 212 |
| 145 | 3300005437 | Ga0070710_10109281 | Ga0070710_101092812 | 212 |
| 146 | 3300005439 | Ga0070711_100021753 | Ga0070711_1000217533 | 212 |
| 147 | 3300005455 | Ga0070663_100166180 | Ga0070663_1001661802 | 212 |
| 148 | 3300005458 | Ga0070681_10003737 | Ga0070681_1000373718 | 212 |
| 149 | 3300005530 | Ga0070679_100000734 | Ga0070679_10000073425 | 212 |
| 150 | 3300005539 | Ga0068853_100001764 | Ga0068853_10000176418 | 212 |
| 151 | 3300005549 | Ga0070704_100002514 | Ga0070704_10000251411 | 212 |
| 152 | 3300005563 | Ga0068855_100010524 | Ga0068855_10001052410 | 212 |
| 153 | 3300005937 | Ga0081455_10028005 | Ga0081455_100280055 | 212 |
| 154 | 3300005937 | Ga0081455_10366220 | Ga0081455_103662201 | 212 |
| 155 | 3300005983 | Ga0081540_1135479 | Ga0081540_11354791 | 212 |
| 156 | 3300009093 | Ga0105240_10182050 | Ga0105240_101820502 | 212 |
| 157 | 3300009553 | Ga0105249_10007085 | Ga0105249_100070857 | 212 |
| 158 | 3300010375 | Ga0105239_10066970 | Ga0105239_100669703 | 212 |
| 159 | 3300013100 | Ga0157373_10026943 | Ga0157373_100269432 | 212 |
| 160 | 3300013307 | Ga0157372_10101565 | Ga0157372_101015652 | 212 |
| 161 | 3300021384 | Ga0213876_10071448 | Ga0213876_100714482 | 212 |
| 162 | 3300025253 | Ga0209677_102065 | Ga0209677_1020652 | 212 |
| 163 | 3300025254 | Ga0209148_1004251 | Ga0209148_10042512 | 212 |
| 164 | 3300025254 | Ga0209148_1014105 | Ga0209148_10141052 | 212 |
| 165 | 3300025261 | Ga0209233_1001782 | Ga0209233_10017828 | 212 |
| 166 | 3300025272 | Ga0209455_1003489 | Ga0209455_10034892 | 212 |
| 167 | 3300025898 | Ga0207692_10356210 | Ga0207692_103562102 | 212 |
| 168 | 3300025912 | Ga0207707_10026797 | Ga0207707_100267975 | 212 |
| 169 | 3300025915 | Ga0207693_10280267 | Ga0207693_102802672 | 212 |
| 170 | 3300025921 | Ga0207652_10064813 | Ga0207652_100648132 | 212 |
| 171 | 3300025929 | Ga0207664_10055611 | Ga0207664_100556113 | 212 |
| 172 | 3300025932 | Ga0207690_10024420 | Ga0207690_100244202 | 212 |
| 173 | 3300025939 | Ga0207665_10296218 | Ga0207665_102962183 | 212 |
| 174 | 3300025961 | Ga0207712_10001203 | Ga0207712_1000120315 | 212 |
| 175 | 3300026041 | Ga0207639_10034312 | Ga0207639_100343122 | 212 |
| 176 | 3300028666 | Ga0265336_10000235 | Ga0265336_1000023532 | 212 |
| 177 | 3300035114 | Ga0373939_0160997 | Ga0373939_0160997_165_803 | 212 |
| 178 | 3300037853 | Ga0436364_0877737 | Ga0436364_0877737_560_1204 | 212 |
| 179 | 3300039437 | Ga0436365_1524500 | Ga0436365_1524500_557_1195 | 212 |
| 180 | 3300039437 | Ga0436365_1744096 | Ga0436365_1744096_703_1341 | 212 |
| 181 | 3300039450 | Ga0436363_1417541 | Ga0436363_1417541_1619_2257 | 212 |
| 182 | 3300042005 | Ga0439448_0082402 | Ga0439448_0082402_338_976 | 212 |
| 183 | 3300044684 | Ga0466966_0157593 | Ga0466966_0157593_303_941 | 212 |
| 184 | 3300044765 | Ga0466970_0342765 | Ga0466970_0342765_142_780 | 212 |
| 185 | 3300044842 | Ga0466957_0161998 | Ga0466957_0161998_381_1019 | 212 |
| 186 | 3300044842 | Ga0466957_0203963 | Ga0466957_0203963_633_1271 | 212 |
| 187 | 3300045049 | Ga0466959_0124055 | Ga0466959_0124055_656_1294 | 212 |
| 188 | 3300048903 | Ga0496100_0065934 | Ga0496100_0065934_431_1069 | 212 |
| 189 | 3300048920 | Ga0496117_0083383 | Ga0496117_0083383_501_1139 | 212 |
| 190 | 3300048921 | Ga0496118_0016852 | Ga0496118_0016852_5303_5941 | 212 |
| 191 | 3300048922 | Ga0496119_0164727 | Ga0496119_0164727_423_1061 | 212 |
| 192 | 3300048924 | Ga0496121_0016228 | Ga0496121_0016228_1387_2025 | 212 |
| 193 | 3300049569 | Ga0501032_0080778 | Ga0501032_0080778_595_1233 | 212 |
| 194 | 3300049570 | Ga0501033_0106910 | Ga0501033_0106910_522_1172 | 212 |
| 195 | 3300049571 | Ga0501034_0011560 | Ga0501034_0011560_810_1448 | 212 |
| 196 | 3300049572 | Ga0501036_0005195 | Ga0501036_0005195_7328_7966 | 212 |
| 197 | 3300049572 | Ga0501036_0043574 | Ga0501036_0043574_1024_1674 | 212 |
| 198 | 3300049574 | Ga0501038_0021444 | Ga0501038_0021444_1343_1981 | 212 |
| 199 | 3300049574 | Ga0501038_0256789 | Ga0501038_0256789_84_734 | 212 |
| 200 | 3300049579 | Ga0501043_0038415 | Ga0501043_0038415_850_1488 | 212 |
| 201 | 3300049580 | Ga0501046_0154045 | Ga0501046_0154045_307_945 | 212 |
| 202 | 3300049581 | Ga0501047_0006073 | Ga0501047_0006073_7143_7781 | 212 |
| 203 | 3300049581 | Ga0501047_0032107 | Ga0501047_0032107_3525_4163 | 212 |
| 204 | 3300049583 | Ga0501067_0024813 | Ga0501067_0024813_2662_3300 | 212 |
| 205 | 3300049584 | Ga0501068_0128202 | Ga0501068_0128202_290_928 | 212 |
| 206 | 3300049586 | Ga0501070_0016752 | Ga0501070_0016752_4213_4851 | 212 |
| 207 | 3300049589 | Ga0501073_0038342 | Ga0501073_0038342_612_1250 | 212 |
| 208 | 3300049590 | Ga0501074_0058303 | Ga0501074_0058303_830_1468 | 212 |
| 209 | 3300049742 | Ga0501080_0019722 | Ga0501080_0019722_4271_4909 | 212 |
| 210 | 3300049744 | Ga0501083_0122669 | Ga0501083_0122669_929_1567 | 212 |
| 211 | 3300049823 | Ga0501044_0162545 | Ga0501044_0162545_754_1392 | 212 |
| 212 | 3300049823 | Ga0501044_0936998 | Ga0501044_0936998_51_701 | 212 |
| 213 | 3300053077 | Ga0495601_0324928 | Ga0495601_0324928_177_815 | 212 |
| 214 | 3300060353 | Ga0501082_0202214 | Ga0501082_0202214_462_1100 | 212 |
| 215 | 3300039447 | Ga0436361_0031744 | Ga0436361_0031744_691_1332 | 213 |
| 216 | 3300049581 | Ga0501047_0012359 | Ga0501047_0012359_825_1505 | 213 |
| 217 | 3300045051 | Ga0451576_0007419 | Ga0451576_0007419_5550_6200 | 214 |
| 218 | 3300045976 | Ga0466967_0598718 | Ga0466967_0598718_272_916 | 214 |
| 219 | 3300047320 | Ga0495672_0185008 | Ga0495672_0185008_41_715 | 214 |
| 220 | 3300049568 | Ga0501031_0059896 | Ga0501031_0059896_1115_1765 | 214 |
| 221 | 3300049581 | Ga0501047_0133539 | Ga0501047_0133539_787_1434 | 215 |
| 222 | 3300049587 | Ga0501071_0442958 | Ga0501071_0442958_207_863 | 215 |
| 223 | 3300037853 | Ga0436364_0597463 | Ga0436364_0597463_108_767 | 216 |
| 224 | 3300005843 | Ga0068860_100063329 | Ga0068860_1000633292 | 218 |
| 225 | 3300028381 | Ga0268264_10044797 | Ga0268264_100447971 | 218 |
| 226 | 3300028800 | Ga0265338_10596978 | Ga0265338_105969781 | 218 |
| 227 | 3300031235 | Ga0265330_10016975 | Ga0265330_100169752 | 218 |
| 228 | 3300031238 | Ga0265332_10111476 | Ga0265332_101114762 | 218 |
| 229 | 3300031241 | Ga0265325_10051734 | Ga0265325_100517342 | 218 |
| 230 | 3300031247 | Ga0265340_10000262 | Ga0265340_1000026223 | 218 |
| 231 | 3300031249 | Ga0265339_10089296 | Ga0265339_100892962 | 218 |
| 232 | 3300031250 | Ga0265331_10049033 | Ga0265331_100490332 | 218 |
| 233 | 3300031344 | Ga0265316_10076345 | Ga0265316_100763453 | 218 |
| 234 | 3300031595 | Ga0265313_10041083 | Ga0265313_100410832 | 218 |
| 235 | 3300049574 | Ga0501038_0257339 | Ga0501038_0257339_387_1055 | 220 |
| 236 | 3300049586 | Ga0501070_0000015 | Ga0501070_0000015_71630_72298 | 220 |
| 237 | 3300049742 | Ga0501080_0004107 | Ga0501080_0004107_12174_12842 | 220 |
| 238 | 3300049822 | Ga0501035_0013061 | Ga0501035_0013061_1984_2652 | 220 |
| 239 | 3300049823 | Ga0501044_0007031 | Ga0501044_0007031_2262_2930 | 220 |
| 240 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_1000013321 | 222 |
| 241 | 3300003320 | rootH2_10055130 | rootH2_100551302 | 222 |
| 242 | 3300005336 | Ga0070680_100188054 | Ga0070680_1001880542 | 222 |
| 243 | 3300005434 | Ga0070709_10000892 | Ga0070709_1000089213 | 222 |
| 244 | 3300005434 | Ga0070709_10194783 | Ga0070709_101947832 | 222 |
| 245 | 3300005435 | Ga0070714_100015160 | Ga0070714_1000151602 | 222 |
| 246 | 3300005436 | Ga0070713_100000003 | Ga0070713_10000000329 | 222 |
| 247 | 3300005437 | Ga0070710_10045250 | Ga0070710_100452501 | 222 |
| 248 | 3300005439 | Ga0070711_100150758 | Ga0070711_1001507581 | 222 |
| 249 | 3300005439 | Ga0070711_100908533 | Ga0070711_1009085331 | 222 |
| 250 | 3300005518 | Ga0070699_100091745 | Ga0070699_1000917452 | 222 |
| 251 | 3300005530 | Ga0070679_100056201 | Ga0070679_1000562012 | 222 |
| 252 | 3300005539 | Ga0068853_100018389 | Ga0068853_1000183895 | 222 |
| 253 | 3300005545 | Ga0070695_100079773 | Ga0070695_1000797731 | 222 |
| 254 | 3300005547 | Ga0070693_100035371 | Ga0070693_1000353712 | 222 |
| 255 | 3300005563 | Ga0068855_100062780 | Ga0068855_1000627802 | 222 |
| 256 | 3300005577 | Ga0068857_100002420 | Ga0068857_10000242014 | 222 |
| 257 | 3300005578 | Ga0068854_100091304 | Ga0068854_1000913042 | 222 |
| 258 | 3300005614 | Ga0068856_100000719 | Ga0068856_10000071923 | 222 |
| 259 | 3300005614 | Ga0068856_100003762 | Ga0068856_1000037626 | 222 |
| 260 | 3300005842 | Ga0068858_100568906 | Ga0068858_1005689062 | 222 |
| 261 | 3300005937 | Ga0081455_10450545 | Ga0081455_104505451 | 222 |
| 262 | 3300006175 | Ga0070712_100000169 | Ga0070712_1000001696 | 222 |
| 263 | 3300006175 | Ga0070712_100313887 | Ga0070712_1003138872 | 222 |
| 264 | 3300006914 | Ga0075436_100000038 | Ga0075436_10000003887 | 222 |
| 265 | 3300009093 | Ga0105240_10089159 | Ga0105240_100891594 | 222 |
| 266 | 3300009174 | Ga0105241_10017676 | Ga0105241_100176762 | 222 |
| 267 | 3300009545 | Ga0105237_10011891 | Ga0105237_1001189110 | 222 |
| 268 | 3300009551 | Ga0105238_10003588 | Ga0105238_100035889 | 222 |
| 269 | 3300010375 | Ga0105239_10141205 | Ga0105239_101412052 | 222 |
| 270 | 3300013100 | Ga0157373_10007365 | Ga0157373_100073659 | 222 |
| 271 | 3300013104 | Ga0157370_10005041 | Ga0157370_1000504114 | 222 |
| 272 | 3300013105 | Ga0157369_10004747 | Ga0157369_1000474714 | 222 |
| 273 | 3300014968 | Ga0157379_10132174 | Ga0157379_101321742 | 222 |
| 274 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013568 | 222 |
| 275 | 3300025906 | Ga0207699_10000676 | Ga0207699_1000067612 | 222 |
| 276 | 3300025913 | Ga0207695_10162274 | Ga0207695_101622742 | 222 |
| 277 | 3300025915 | Ga0207693_10000408 | Ga0207693_1000040836 | 222 |
| 278 | 3300025915 | Ga0207693_10152350 | Ga0207693_101523502 | 222 |
| 279 | 3300025921 | Ga0207652_10093449 | Ga0207652_100934492 | 222 |
| 280 | 3300025924 | Ga0207694_10038193 | Ga0207694_100381934 | 222 |
| 281 | 3300025928 | Ga0207700_10000083 | Ga0207700_1000008329 | 222 |
| 282 | 3300025929 | Ga0207664_10011315 | Ga0207664_100113157 | 222 |
| 283 | 3300025945 | Ga0207679_10072771 | Ga0207679_100727712 | 222 |
| 284 | 3300025949 | Ga0207667_10044809 | Ga0207667_100448092 | 222 |
| 285 | 3300025981 | Ga0207640_10070475 | Ga0207640_100704752 | 222 |
| 286 | 3300026035 | Ga0207703_10660856 | Ga0207703_106608562 | 222 |
| 287 | 3300026041 | Ga0207639_10217060 | Ga0207639_102170602 | 222 |
| 288 | 3300026078 | Ga0207702_10000045 | Ga0207702_10000045128 | 222 |
| 289 | 3300026078 | Ga0207702_10002929 | Ga0207702_100029299 | 222 |
| 290 | 3300026116 | Ga0207674_10000026 | Ga0207674_1000002680 | 222 |
| 291 | 3300031249 | Ga0265339_10092453 | Ga0265339_100924532 | 222 |
| 292 | 3300031595 | Ga0265313_10124947 | Ga0265313_101249472 | 222 |
| 293 | 3300031712 | Ga0265342_10060329 | Ga0265342_100603292 | 222 |
| 294 | 3300035724 | Ga0373933_0008797 | Ga0373933_0008797_4370_5038 | 222 |
| 295 | 3300036401 | Ga0373937_0016703 | Ga0373937_0016703_5094_5762 | 222 |
| 296 | 3300039437 | Ga0436365_1104873 | Ga0436365_1104873_5525_6193 | 222 |
| 297 | 3300046471 | Ga0495650_0055653 | Ga0495650_0055653_19_693 | 222 |
| 298 | 3300046472 | Ga0495580_0075354 | Ga0495580_0075354_1392_2060 | 222 |
| 299 | 3300048924 | Ga0496121_0005644 | Ga0496121_0005644_3804_4472 | 222 |
| 300 | 3300048929 | Ga0496126_0113864 | Ga0496126_0113864_464_1138 | 222 |
| 301 | 3300049568 | Ga0501031_0000905 | Ga0501031_0000905_16694_17374 | 222 |
| 302 | 3300049569 | Ga0501032_0013547 | Ga0501032_0013547_2537_3217 | 222 |
| 303 | 3300049569 | Ga0501032_0094635 | Ga0501032_0094635_543_1223 | 222 |
| 304 | 3300049569 | Ga0501032_0109596 | Ga0501032_0109596_465_1139 | 222 |
| 305 | 3300049570 | Ga0501033_0015585 | Ga0501033_0015585_4107_4787 | 222 |
| 306 | 3300049570 | Ga0501033_0017686 | Ga0501033_0017686_3264_3938 | 222 |
| 307 | 3300049570 | Ga0501033_0032905 | Ga0501033_0032905_2119_2817 | 222 |
| 308 | 3300049570 | Ga0501033_0152532 | Ga0501033_0152532_259_933 | 222 |
| 309 | 3300049571 | Ga0501034_0005434 | Ga0501034_0005434_12817_13497 | 222 |
| 310 | 3300049571 | Ga0501034_0268640 | Ga0501034_0268640_554_1222 | 222 |
| 311 | 3300049573 | Ga0501037_0009933 | Ga0501037_0009933_5673_6353 | 222 |
| 312 | 3300049573 | Ga0501037_0083183 | Ga0501037_0083183_1380_2054 | 222 |
| 313 | 3300049574 | Ga0501038_0188750 | Ga0501038_0188750_316_990 | 222 |
| 314 | 3300049574 | Ga0501038_0201829 | Ga0501038_0201829_434_1114 | 222 |
| 315 | 3300049575 | Ga0501039_0004629 | Ga0501039_0004629_9479_10159 | 222 |
| 316 | 3300049579 | Ga0501043_0067749 | Ga0501043_0067749_1128_1802 | 222 |
| 317 | 3300049579 | Ga0501043_0210866 | Ga0501043_0210866_482_1162 | 222 |
| 318 | 3300049581 | Ga0501047_0050725 | Ga0501047_0050725_1428_2102 | 222 |
| 319 | 3300049581 | Ga0501047_0167509 | Ga0501047_0167509_835_1509 | 222 |
| 320 | 3300049582 | Ga0501048_0157857 | Ga0501048_0157857_785_1465 | 222 |
| 321 | 3300049583 | Ga0501067_0007529 | Ga0501067_0007529_925_1605 | 222 |
| 322 | 3300049584 | Ga0501068_0077780 | Ga0501068_0077780_559_1239 | 222 |
| 323 | 3300049586 | Ga0501070_0023675 | Ga0501070_0023675_2422_3102 | 222 |
| 324 | 3300049588 | Ga0501072_0060783 | Ga0501072_0060783_2187_2867 | 222 |
| 325 | 3300049589 | Ga0501073_0017576 | Ga0501073_0017576_2241_2921 | 222 |
| 326 | 3300049590 | Ga0501074_0022111 | Ga0501074_0022111_784_1464 | 222 |
| 327 | 3300049741 | Ga0501079_0003370 | Ga0501079_0003370_7527_8207 | 222 |
| 328 | 3300049742 | Ga0501080_0073326 | Ga0501080_0073326_1446_2120 | 222 |
| 329 | 3300049744 | Ga0501083_0193202 | Ga0501083_0193202_300_980 | 222 |
| 330 | 3300049822 | Ga0501035_0007878 | Ga0501035_0007878_6048_6722 | 222 |
| 331 | 3300049822 | Ga0501035_0078735 | Ga0501035_0078735_1420_2100 | 222 |
| 332 | 3300049822 | Ga0501035_0094721 | Ga0501035_0094721_651_1325 | 222 |
| 333 | 3300049822 | Ga0501035_0173493 | Ga0501035_0173493_1121_1801 | 222 |
| 334 | 3300049822 | Ga0501035_0298832 | Ga0501035_0298832_634_1314 | 222 |
| 335 | 3300049823 | Ga0501044_0000530 | Ga0501044_0000530_28904_29578 | 222 |
| 336 | 3300049823 | Ga0501044_0063947 | Ga0501044_0063947_2085_2759 | 222 |
| 337 | 3300049823 | Ga0501044_0232134 | Ga0501044_0232134_44_724 | 222 |
| 338 | 3300049823 | Ga0501044_0250012 | Ga0501044_0250012_544_1224 | 222 |
| 339 | 3300049823 | Ga0501044_0315496 | Ga0501044_0315496_304_987 | 222 |
| 340 | 3300049824 | Ga0501045_0332317 | Ga0501045_0332317_343_1023 | 222 |
| 341 | 3300050513 | nmdc:mga0rr50_61750_c1 | nmdc:mga0rr50_61750_c1_327_995 | 222 |
| 342 | 3300050514 | nmdc:mga08x19_95_c1 | nmdc:mga08x19_95_c1_6046_6714 | 222 |
| 343 | 3300053096 | Ga0500641_0153660 | Ga0500641_0153660_259_927 | 222 |
| 344 | 3300054114 | Ga0501084_0016689 | Ga0501084_0016689_222_902 | 222 |
| 345 | 3300060353 | Ga0501082_0004309 | Ga0501082_0004309_481_1161 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.9124 | 1 | 211 |
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.9027 | 1 | 212 |
| 3r20-assembly1.cif.gz_A | crystal structure of cytidylate kinase from mycobacterium smegmatis | 0.8827 | 2 | 208 |
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.8688 | 1 | 211 |
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.8598 | 1 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8489 | 2 | 210 | 3.40.50.300 |
| af_Q2FYF5_1_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8278 | 37 | 211 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8264 | 2 | 210 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8192 | 2 | 210 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8187 | 2 | 210 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537V0W6-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9785 | 2 | 143 |
GO:0005524
GO:0036430 GO:0036431 |
| AF-A0A7X4EPK9-F1-model_v4 | deleted | 0.9757 | 1 | 214 |
|
| AF-A0A5A7MYD6-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.975 | 3 | 126 |
GO:0004127
GO:0005524 |
| AF-A0A7U4Z9Z3-F1-model_v4 | deleted | 0.9725 | 2 | 211 |
|
| AF-A0A3D5UWI9-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9723 | 81 | 211 |
GO:0004127
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar