F416545

General Info

Members Datasets Scaffolds Average Seq Length
345 192 337 213

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0032905|Ga0501033_0032905_2119_2817
Length 232
Sequence MSPAAQSPASQSIVIAVDGTAASGKGTLAKRLAAHFGFAHLDSGALYRLTALAVVEAGGDPRSEQDAVRGAHAIDLSMAGDPAIRTDKIGQAASHVAAIGAVRAALLDFQRAFLAHPPGGSPGAVMDGRDIGTVICPTATAKLYVDARPELRANRRWRELAGMGIHRDEAELLKELMARDAADKARPISPLVQAPDAALLDTSDLGIEPAFAAALALVSPKVQSALKDRHRG

Samples

Sample ID Description Type Environment
1 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
2 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
3 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
4 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
5 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
6 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
7 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0.29
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.83
Nodule 0
Rhizoplane 0.29
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25165J46597_1008072 3300003214 Bacteria 1684
3 rootH2_10055130 3300003320 Bacteria 1308
4 Ga0070680_100188054 3300005336 Bacteria 1740
5 Ga0070680_100214171 3300005336 Bacteria 1625
6 Ga0070682_100005242 3300005337 Bacteria 7210
7 Ga0070691_10050735 3300005341 Bacteria 1980
8 Ga0070673_100881342 3300005364 Bacteria 829
9 Ga0070659_100682333 3300005366 Bacteria 887
10 Ga0070709_10000892 3300005434 Bacteria 16688
11 Ga0070709_10194783 3300005434 Bacteria 1432
12 Ga0070714_100015160 3300005435 Bacteria 6198
13 Ga0070714_100196044 3300005435 Bacteria 1845
14 Ga0070713_100000003 3300005436 Bacteria 245840
15 Ga0070713_100061601 3300005436 Bacteria 3139
16 Ga0070710_10045250 3300005437 Bacteria 2446
17 Ga0070710_10109281 3300005437 Bacteria 1659
18 Ga0070711_100021753 3300005439 Bacteria 4150
19 Ga0070711_100150758 3300005439 Bacteria 1753
20 Ga0070711_100908533 3300005439 Bacteria 752
21 Ga0070663_100166180 3300005455 Bacteria 1702
22 Ga0070681_10003737 3300005458 Bacteria 14283
23 Ga0070706_100095277 3300005467 Bacteria 2762
24 Ga0070699_100091745 3300005518 Bacteria 2656
25 Ga0070679_100000734 3300005530 Bacteria 28346
26 Ga0070679_100056201 3300005530 Bacteria 3922
27 Ga0070679_100388807 3300005530 Bacteria 1341
28 Ga0068853_100001764 3300005539 Bacteria 15895
29 Ga0068853_100018389 3300005539 Bacteria 5784
30 Ga0070695_100079773 3300005545 Bacteria 2162
31 Ga0070693_100035371 3300005547 Bacteria 2770
32 Ga0070704_100002514 3300005549 Bacteria 10315
33 Ga0068855_100010524 3300005563 Bacteria 11157
34 Ga0068855_100062780 3300005563 Bacteria 4336
35 Ga0068857_100002420 3300005577 Bacteria 15228
36 Ga0068854_100091304 3300005578 Bacteria 2266
37 Ga0068856_100000719 3300005614 Bacteria 36011
38 Ga0068856_100003762 3300005614 Bacteria 15216
39 Ga0068858_100568906 3300005842 Bacteria 1098
40 Ga0068860_100063329 3300005843 Bacteria 3513
41 Ga0081455_10028005 3300005937 Bacteria 5154
42 Ga0081455_10366220 3300005937 Bacteria 1012
43 Ga0081455_10450545 3300005937 Bacteria 879
44 Ga0081540_1135479 3300005983 Bacteria 998
45 Ga0081539_10299881 3300005985 Bacteria 691
46 Ga0075368_10019610 3300006042 Bacteria 2553
47 Ga0070715_10170708 3300006163 Bacteria 1083
48 Ga0070712_100000169 3300006175 Bacteria 35660
49 Ga0070712_100313887 3300006175 Bacteria 1273
50 Ga0075362_10038436 3300006177 Bacteria 2102
51 Ga0075362_10166429 3300006177 Bacteria 1063
52 Ga0075369_10093190 3300006186 Bacteria 1345
53 Ga0075366_10044179 3300006195 Bacteria 2640
54 Ga0075366_10181441 3300006195 Bacteria 1279
55 Ga0075428_101252670 3300006844 Bacteria 781
56 Ga0075430_100097849 3300006846 Bacteria 2451
57 Ga0075436_100000038 3300006914 Bacteria 82918
58 Ga0105240_10089159 3300009093 Bacteria 3773
59 Ga0105240_10182050 3300009093 Bacteria 2479
60 Ga0105240_10331707 3300009093 Bacteria 1731
61 Ga0105240_10431870 3300009093 Bacteria 1478
62 Ga0111539_10165244 3300009094 Bacteria 2588
63 Ga0105241_10017676 3300009174 Bacteria 5243
64 Ga0105237_10011891 3300009545 Bacteria 9205
65 Ga0105238_10003588 3300009551 Bacteria 15470
66 Ga0105238_10067682 3300009551 Bacteria 3572
67 Ga0105249_10007085 3300009553 Bacteria 9787
68 Ga0105239_10066970 3300010375 Bacteria 3945
69 Ga0105239_10141205 3300010375 Bacteria 2684
70 Ga0105246_10710609 3300011119 Bacteria 882
71 Ga0105246_10926273 3300011119 Bacteria 783
72 Ga0157373_10007365 3300013100 Bacteria 8191
73 Ga0157373_10026943 3300013100 Bacteria 4148
74 Ga0157370_10005041 3300013104 Bacteria 14920
75 Ga0157369_10004747 3300013105 Bacteria 15970
76 Ga0157372_10101565 3300013307 Bacteria 3283
77 Ga0157380_10433191 3300014326 Bacteria 1258
78 Ga0157379_10132174 3300014968 Bacteria 2247
79 Ga0213876_10071448 3300021384 Bacteria 1833
80 Ga0213871_10005835 3300021441 Bacteria 2572
81 Ga0209677_102065 3300025253 Bacteria 7934
82 Ga0209148_1004251 3300025254 Bacteria 3581
83 Ga0209148_1014105 3300025254 Bacteria 1418
84 Ga0209233_1000013 3300025261 Bacteria 1013785
85 Ga0209233_1001782 3300025261 Bacteria 8294
86 Ga0209455_1003489 3300025272 Bacteria 5539
87 Ga0207692_10356210 3300025898 Bacteria 903
88 Ga0207685_10055194 3300025905 Bacteria 1550
89 Ga0207699_10000676 3300025906 Bacteria 16381
90 Ga0207684_10285358 3300025910 Bacteria 1423
91 Ga0207707_10026797 3300025912 Bacteria 5037
92 Ga0207695_10162274 3300025913 Bacteria 2166
93 Ga0207695_10226027 3300025913 Bacteria 1778
94 Ga0207695_10757945 3300025913 Bacteria 851
95 Ga0207693_10000408 3300025915 Bacteria 39093
96 Ga0207693_10152350 3300025915 Bacteria 1819
97 Ga0207693_10233266 3300025915 Bacteria 1445
98 Ga0207693_10280267 3300025915 Bacteria 1306
99 Ga0207652_10064813 3300025921 Bacteria 3162
100 Ga0207652_10093449 3300025921 Bacteria 2647
101 Ga0207652_10390211 3300025921 Bacteria 1256
102 Ga0207652_10410999 3300025921 Bacteria 1221
103 Ga0207694_10038193 3300025924 Bacteria 3691
104 Ga0207700_10000083 3300025928 Bacteria 58710
105 Ga0207664_10011315 3300025929 Bacteria 6331
106 Ga0207664_10055611 3300025929 Bacteria 3141
107 Ga0207690_10024420 3300025932 Bacteria 3786
108 Ga0207665_10296218 3300025939 Bacteria 1208
109 Ga0207691_10992077 3300025940 Bacteria 701
110 Ga0207679_10072771 3300025945 Bacteria 2597
111 Ga0207667_10044809 3300025949 Bacteria 4686
112 Ga0207651_11210353 3300025960 Bacteria 678
113 Ga0207712_10001203 3300025961 Bacteria 17887
114 Ga0207640_10070475 3300025981 Bacteria 2351
115 Ga0207703_10660856 3300026035 Bacteria 992
116 Ga0207639_10034312 3300026041 Bacteria 3749
117 Ga0207639_10197974 3300026041 Bacteria 1721
118 Ga0207639_10217060 3300026041 Bacteria 1650
119 Ga0207702_10000045 3300026078 Bacteria 144714
120 Ga0207702_10002929 3300026078 Bacteria 15968
121 Ga0207674_10000026 3300026116 Bacteria 151359
122 Ga0207675_101301894 3300026118 Bacteria 747
123 Ga0209813_10021795 3300027866 Bacteria 1805
124 Ga0268264_10044797 3300028381 Bacteria 3671
125 Ga0265334_10160072 3300028573 Bacteria 792
126 Ga0265336_10000235 3300028666 Bacteria 39578
127 Ga0265338_10596978 3300028800 Bacteria 769
128 Ga0265330_10016975 3300031235 Bacteria 3356
129 Ga0265330_10137182 3300031235 Bacteria 1040
130 Ga0265332_10111476 3300031238 Bacteria 1152
131 Ga0265328_10000044 3300031239 Bacteria 84452
132 Ga0265328_10000201 3300031239 Bacteria 27939
133 Ga0265328_10002263 3300031239 Bacteria 8682
134 Ga0265328_10003469 3300031239 Bacteria 6963
135 Ga0265328_10016816 3300031239 Bacteria 2840
136 Ga0265325_10051734 3300031241 Bacteria 2111
137 Ga0265329_10012208 3300031242 Bacteria 3095
138 Ga0265340_10000262 3300031247 Bacteria 27248
139 Ga0265339_10089296 3300031249 Bacteria 1617
140 Ga0265339_10092453 3300031249 Bacteria 1584
141 Ga0265331_10000210 3300031250 Bacteria 70529
142 Ga0265331_10000630 3300031250 Bacteria 30634
143 Ga0265331_10049033 3300031250 Bacteria 2029
144 Ga0265331_10155343 3300031250 Bacteria 1038
145 Ga0265327_10018206 3300031251 Bacteria 4365
146 Ga0265327_10056806 3300031251 Bacteria 2015
147 Ga0265316_10000414 3300031344 Bacteria 48841
148 Ga0265316_10076345 3300031344 Bacteria 2574
149 Ga0265316_10324675 3300031344 Bacteria 1117
150 Ga0265313_10041083 3300031595 Bacteria 2281
151 Ga0265313_10124947 3300031595 Bacteria 1119
152 Ga0265342_10060329 3300031712 Bacteria 2237
153 Ga0316593_10047030 3300032168 Bacteria 1450
154 Ga0373926_0371583 3300035083 Bacteria 562
155 Ga0373923_0071454 3300035111 Bacteria 1491
156 Ga0373939_0160997 3300035114 Bacteria 824
157 Ga0373955_0207549 3300035172 Bacteria 1167
158 Ga0373931_0155567 3300035691 Bacteria 1336
159 Ga0373927_0082431 3300035695 Bacteria 2085
160 Ga0373933_0008797 3300035724 Bacteria 5507
161 Ga0373933_0178446 3300035724 Bacteria 1354
162 Ga0373947_0122573 3300035725 Bacteria 1653
163 Ga0373937_0016703 3300036401 Bacteria 6522
164 Ga0316582_0215127 3300036647 Bacteria 1313
165 Ga0316584_0345316 3300036712 Bacteria 1069
166 Ga0373925_0141469 3300037068 Bacteria 1883
167 Ga0373925_0276236 3300037068 Bacteria 1352
168 Ga0436364_0597463 3300037853 Bacteria 1172
169 Ga0436364_0877737 3300037853 Bacteria 1813
170 Ga0436365_1104873 3300039437 Bacteria 14597
171 Ga0436365_1524500 3300039437 Bacteria 1563
172 Ga0436365_1744096 3300039437 Bacteria 5144
173 Ga0436360_0632186 3300039438 Bacteria 2928
174 Ga0436361_0031744 3300039447 Bacteria 4981
175 Ga0436361_0088019 3300039447 Bacteria 746
176 Ga0436361_0669471 3300039447 Bacteria 2996
177 Ga0436361_0974578 3300039447 Bacteria 4075
178 Ga0436363_0021631 3300039450 Bacteria 4908
179 Ga0436363_0060563 3300039450 Bacteria 947
180 Ga0436363_1417541 3300039450 Bacteria 2613
181 Ga0439448_0082402 3300042005 Bacteria 1081
182 Ga0450923_008233 3300042125 Bacteria 1788
183 Ga0466966_0157593 3300044684 Bacteria 1383
184 Ga0466961_0051386 3300044693 Bacteria 2633
185 Ga0453684_0012470 3300044712 Bacteria 14005
186 Ga0466970_0342765 3300044765 Bacteria 847
187 Ga0466957_0161998 3300044842 Bacteria 1453
188 Ga0466957_0203963 3300044842 Bacteria 1300
189 Ga0466957_0274441 3300044842 Bacteria 1127
190 Ga0466959_0010726 3300045049 Bacteria 6563
191 Ga0466959_0124055 3300045049 Bacteria 1834
192 Ga0451576_0007419 3300045051 Bacteria 13115
193 Ga0466958_0077943 3300045836 Bacteria 2036
194 Ga0466958_0270621 3300045836 Bacteria 1088
195 Ga0466967_0598718 3300045976 Bacteria 1088
196 Ga0495650_0055653 3300046471 Bacteria 1609
197 Ga0495580_0075354 3300046472 Bacteria 2354
198 Ga0495580_0090456 3300046472 Bacteria 2131
199 Ga0495652_0342421 3300046529 Bacteria 1074
200 Ga0495672_0185008 3300047320 Bacteria 1052
201 Ga0496100_0065934 3300048903 Bacteria 2401
202 Ga0496117_0083383 3300048920 Bacteria 2090
203 Ga0496118_0016852 3300048921 Bacteria 6676
204 Ga0496119_0164727 3300048922 Bacteria 1175
205 Ga0496119_0429788 3300048922 Bacteria 625
206 Ga0496121_0005644 3300048924 Bacteria 15919
207 Ga0496121_0016228 3300048924 Bacteria 7706
208 Ga0496126_0113864 3300048929 Bacteria 2354
209 Ga0496126_0375169 3300048929 Bacteria 1159
210 Ga0501031_0000905 3300049568 Bacteria 17854
211 Ga0501031_0021638 3300049568 Bacteria 4192
212 Ga0501031_0059896 3300049568 Bacteria 2481
213 Ga0501032_0013547 3300049569 Bacteria 5796
214 Ga0501032_0061102 3300049569 Bacteria 2526
215 Ga0501032_0080778 3300049569 Bacteria 2163
216 Ga0501032_0094635 3300049569 Bacteria 1981
217 Ga0501032_0109596 3300049569 Bacteria 1828
218 Ga0501032_0244928 3300049569 Bacteria 1164
219 Ga0501033_0015585 3300049570 Bacteria 5764
220 Ga0501033_0017686 3300049570 Bacteria 5384
221 Ga0501033_0032905 3300049570 Bacteria 3893
222 Ga0501033_0043008 3300049570 Bacteria 3365
223 Ga0501033_0106910 3300049570 Bacteria 2038
224 Ga0501033_0124494 3300049570 Bacteria 1869
225 Ga0501033_0152532 3300049570 Bacteria 1666
226 Ga0501034_0005434 3300049571 Bacteria 13930
227 Ga0501034_0011560 3300049571 Bacteria 9142
228 Ga0501034_0062415 3300049571 Bacteria 3741
229 Ga0501034_0100250 3300049571 Bacteria 2890
230 Ga0501034_0268640 3300049571 Bacteria 1647
231 Ga0501036_0005195 3300049572 Bacteria 10531
232 Ga0501036_0043574 3300049572 Bacteria 3801
233 Ga0501036_0111952 3300049572 Bacteria 2306
234 Ga0501036_0527825 3300049572 Bacteria 981
235 Ga0501037_0009933 3300049573 Bacteria 6979
236 Ga0501037_0071786 3300049573 Bacteria 2518
237 Ga0501037_0083183 3300049573 Bacteria 2319
238 Ga0501037_0319858 3300049573 Bacteria 1074
239 Ga0501038_0021444 3300049574 Bacteria 5797
240 Ga0501038_0046444 3300049574 Bacteria 3765
241 Ga0501038_0122438 3300049574 Bacteria 2143
242 Ga0501038_0188750 3300049574 Bacteria 1659
243 Ga0501038_0201829 3300049574 Bacteria 1595
244 Ga0501038_0256789 3300049574 Bacteria 1382
245 Ga0501038_0257339 3300049574 Bacteria 1381
246 Ga0501039_0004629 3300049575 Bacteria 10399
247 Ga0501039_0067788 3300049575 Bacteria 2771
248 Ga0501039_0311606 3300049575 Bacteria 1237
249 Ga0501043_0038415 3300049579 Bacteria 3764
250 Ga0501043_0067749 3300049579 Bacteria 2803
251 Ga0501043_0210866 3300049579 Bacteria 1505
252 Ga0501043_0254690 3300049579 Bacteria 1351
253 Ga0501046_0154045 3300049580 Bacteria 1733
254 Ga0501047_0006073 3300049581 Bacteria 11352
255 Ga0501047_0007555 3300049581 Bacteria 10231
256 Ga0501047_0008129 3300049581 Bacteria 9901
257 Ga0501047_0012359 3300049581 Bacteria 8083
258 Ga0501047_0032107 3300049581 Bacteria 5067
259 Ga0501047_0050725 3300049581 Bacteria 4007
260 Ga0501047_0132792 3300049581 Bacteria 2369
261 Ga0501047_0133539 3300049581 Bacteria 2362
262 Ga0501047_0167509 3300049581 Bacteria 2067
263 Ga0501047_0169559 3300049581 Bacteria 2052
264 Ga0501047_0176115 3300049581 Bacteria 2006
265 Ga0501047_0207009 3300049581 Bacteria 1821
266 Ga0501047_0324341 3300049581 Bacteria 1379
267 Ga0501048_0157857 3300049582 Bacteria 1604
268 Ga0501067_0007529 3300049583 Bacteria 6051
269 Ga0501067_0024813 3300049583 Bacteria 3324
270 Ga0501068_0077780 3300049584 Bacteria 2032
271 Ga0501068_0114768 3300049584 Bacteria 1677
272 Ga0501068_0128202 3300049584 Bacteria 1585
273 Ga0501069_0350635 3300049585 Unclassified 870
274 Ga0501070_0000015 3300049586 Bacteria 179449
275 Ga0501070_0016752 3300049586 Bacteria 6152
276 Ga0501070_0023675 3300049586 Bacteria 5145
277 Ga0501070_0157264 3300049586 Bacteria 1874
278 Ga0501071_0442958 3300049587 Bacteria 994
279 Ga0501072_0060783 3300049588 Bacteria 2979
280 Ga0501073_0017576 3300049589 Bacteria 5178
281 Ga0501073_0038342 3300049589 Bacteria 3399
282 Ga0501074_0022111 3300049590 Bacteria 4620
283 Ga0501074_0058303 3300049590 Bacteria 2781
284 Ga0501079_0003370 3300049741 Bacteria 11724
285 Ga0501080_0004107 3300049742 Bacteria 12902
286 Ga0501080_0019722 3300049742 Bacteria 6244
287 Ga0501080_0025146 3300049742 Bacteria 5526
288 Ga0501080_0073326 3300049742 Bacteria 3185
289 Ga0501080_0463244 3300049742 Bacteria 1135
290 Ga0501083_0122669 3300049744 Bacteria 1704
291 Ga0501083_0193202 3300049744 Bacteria 1328
292 Ga0501083_0366854 3300049744 Bacteria 936
293 Ga0501035_0007878 3300049822 Bacteria 9954
294 Ga0501035_0013061 3300049822 Bacteria 7664
295 Ga0501035_0078735 3300049822 Bacteria 2911
296 Ga0501035_0094721 3300049822 Bacteria 2625
297 Ga0501035_0173493 3300049822 Bacteria 1862
298 Ga0501035_0179911 3300049822 Bacteria 1822
299 Ga0501035_0298832 3300049822 Bacteria 1357
300 Ga0501035_0710505 3300049822 Bacteria 810
301 Ga0501044_0000530 3300049823 Bacteria 46371
302 Ga0501044_0007031 3300049823 Bacteria 12383
303 Ga0501044_0063947 3300049823 Bacteria 3757
304 Ga0501044_0090428 3300049823 Bacteria 3088
305 Ga0501044_0139184 3300049823 Bacteria 2416
306 Ga0501044_0162545 3300049823 Bacteria 2208
307 Ga0501044_0176523 3300049823 Bacteria 2105
308 Ga0501044_0184864 3300049823 Bacteria 2049
309 Ga0501044_0232134 3300049823 Bacteria 1792
310 Ga0501044_0250012 3300049823 Bacteria 1714
311 Ga0501044_0315496 3300049823 Bacteria 1489
312 Ga0501044_0499770 3300049823 Bacteria 1117
313 Ga0501044_0936998 3300049823 Bacteria 740
314 Ga0501045_0332317 3300049824 Bacteria 1131
315 nmdc:mga03683_75385_c1 3300050489 Bacteria 1448
316 nmdc:mga00v17_119366_c1 3300050491 Bacteria 1678
317 nmdc:mga0yw44_122212_c1 3300050492 Bacteria 1678
318 nmdc:mga0k408_215399_c1 3300050493 Bacteria 1147
319 nmdc:mga0k408_25133_c2 3300050493 Bacteria 1513
320 nmdc:mga04h51_8945_c1 3300050495 Bacteria 2694
321 nmdc:mga06r32_450329_c1 3300050510 Bacteria 1267
322 nmdc:mga08y16_497914_c1 3300050511 Bacteria 1238
323 nmdc:mga08y16_62054_c1 3300050511 Bacteria 3903
324 nmdc:mga0rr50_61750_c1 3300050513 Bacteria 2824
325 nmdc:mga08x19_615396_c1 3300050514 Bacteria 770
326 nmdc:mga08x19_95_c1 3300050514 Bacteria 78182
327 Ga0495601_0324928 3300053077 Bacteria 1002
328 Ga0500641_0153660 3300053096 Bacteria 993
329 Ga0500650_0086067 3300053098 Bacteria 1471
330 Ga0500642_0081854 3300053130 Bacteria 1484
331 Ga0500616_0003430 3300053153 Bacteria 12111
332 Ga0500637_0245024 3300053178 Bacteria 1003
333 Ga0500552_001043 3300053733 Bacteria 2617
334 Ga0501084_0016689 3300054114 Bacteria 6098
335 Ga0501082_0004309 3300060353 Bacteria 12443
336 Ga0501082_0202214 3300060353 Bacteria 1728
337 Ga0466962_0139930 3300061719 Bacteria 1172

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_497914_c1 nmdc:mga08y16_497914_c1_716_1228 170
2 3300035083 Ga0373926_0371583 Ga0373926_0371583_12_536 174
3 3300048922 Ga0496119_0429788 Ga0496119_0429788_78_605 175
4 3300049571 Ga0501034_0062415 Ga0501034_0062415_705_1328 187
5 3300049574 Ga0501038_0046444 Ga0501038_0046444_3079_3702 187
6 3300049581 Ga0501047_0007555 Ga0501047_0007555_2203_2826 187
7 3300049584 Ga0501068_0114768 Ga0501068_0114768_87_710 187
8 3300006846 Ga0075430_100097849 Ga0075430_1000978492 189
9 3300049568 Ga0501031_0021638 Ga0501031_0021638_2372_2992 189
10 3300049569 Ga0501032_0061102 Ga0501032_0061102_867_1487 189
11 3300049570 Ga0501033_0043008 Ga0501033_0043008_1224_1844 189
12 3300049571 Ga0501034_0100250 Ga0501034_0100250_1222_1842 189
13 3300049572 Ga0501036_0111952 Ga0501036_0111952_767_1387 189
14 3300049574 Ga0501038_0122438 Ga0501038_0122438_909_1529 189
15 3300049575 Ga0501039_0067788 Ga0501039_0067788_945_1565 189
16 3300049579 Ga0501043_0254690 Ga0501043_0254690_187_807 189
17 3300049581 Ga0501047_0132792 Ga0501047_0132792_944_1564 189
18 3300049586 Ga0501070_0157264 Ga0501070_0157264_631_1251 189
19 3300049823 Ga0501044_0184864 Ga0501044_0184864_800_1420 189
20 3300050510 nmdc:mga06r32_450329_c1 nmdc:mga06r32_450329_c1_556_1179 189
21 3300049575 Ga0501039_0311606 Ga0501039_0311606_509_1132 190
22 3300049823 Ga0501044_0139184 Ga0501044_0139184_781_1401 191
23 3300006844 Ga0075428_101252670 Ga0075428_1012526702 194
24 3300049581 Ga0501047_0324341 Ga0501047_0324341_269_895 194
25 3300005530 Ga0070679_100388807 Ga0070679_1003888072 195
26 3300025921 Ga0207652_10390211 Ga0207652_103902112 195
27 3300025921 Ga0207652_10410999 Ga0207652_104109992 195
28 3300049570 Ga0501033_0124494 Ga0501033_0124494_864_1490 195
29 3300049573 Ga0501037_0071786 Ga0501037_0071786_138_764 195
30 3300039447 Ga0436361_0974578 Ga0436361_0974578_2786_3430 196
31 3300039450 Ga0436363_0021631 Ga0436363_0021631_700_1344 196
32 3300031239 Ga0265328_10016816 Ga0265328_100168163 197
33 3300049822 Ga0501035_0179911 Ga0501035_0179911_739_1407 197
34 3300049823 Ga0501044_0176523 Ga0501044_0176523_1035_1703 197
35 3300049581 Ga0501047_0169559 Ga0501047_0169559_427_1101 199
36 3300049744 Ga0501083_0366854 Ga0501083_0366854_10_642 199
37 3300039447 Ga0436361_0088019 Ga0436361_0088019_94_732 200
38 3300049585 Ga0501069_0350635 Ga0501069_0350635_30_647 203
39 3300037068 Ga0373925_0276236 Ga0373925_0276236_710_1327 205
40 3300049569 Ga0501032_0244928 Ga0501032_0244928_409_1032 206
41 3300049572 Ga0501036_0527825 Ga0501036_0527825_317_937 206
42 3300049573 Ga0501037_0319858 Ga0501037_0319858_257_877 206
43 3300049581 Ga0501047_0008129 Ga0501047_0008129_3636_4259 206
44 3300049581 Ga0501047_0176115 Ga0501047_0176115_1191_1811 206
45 3300049742 Ga0501080_0025146 Ga0501080_0025146_2385_3008 206
46 3300049822 Ga0501035_0710505 Ga0501035_0710505_93_716 206
47 3300049823 Ga0501044_0090428 Ga0501044_0090428_107_730 206
48 3300049823 Ga0501044_0499770 Ga0501044_0499770_452_1072 206
49 iso_pu_bacteria 2738541281 2738745755 206
50 iso_pu_bacteria 2738543032 2739354985 206
51 iso_pu_bacteria 2842698319 2842701852 206
52 iso_pu_bacteria 2842775625 2842777341 206
53 iso_pu_bacteria 2891048133 2891048302 206
54 iso_pu_bacteria 8002060224 8002062608 206
55 3300005364 Ga0070673_100881342 Ga0070673_1008813422 207
56 3300011119 Ga0105246_10926273 Ga0105246_109262731 207
57 3300014326 Ga0157380_10433191 Ga0157380_104331912 207
58 3300025940 Ga0207691_10992077 Ga0207691_109920771 207
59 3300025960 Ga0207651_11210353 Ga0207651_112103531 207
60 3300026118 Ga0207675_101301894 Ga0207675_1013018941 207
61 iso_pu_bacteria 2883577096 2883579024 207
62 3300005467 Ga0070706_100095277 Ga0070706_1000952772 208
63 3300006042 Ga0075368_10019610 Ga0075368_100196103 208
64 3300006163 Ga0070715_10170708 Ga0070715_101707081 208
65 3300006177 Ga0075362_10038436 Ga0075362_100384362 208
66 3300006177 Ga0075362_10166429 Ga0075362_101664292 208
67 3300006186 Ga0075369_10093190 Ga0075369_100931902 208
68 3300006195 Ga0075366_10181441 Ga0075366_101814411 208
69 3300009093 Ga0105240_10331707 Ga0105240_103317071 208
70 3300009551 Ga0105238_10067682 Ga0105238_100676825 208
71 3300025905 Ga0207685_10055194 Ga0207685_100551942 208
72 3300025910 Ga0207684_10285358 Ga0207684_102853582 208
73 3300025913 Ga0207695_10757945 Ga0207695_107579451 208
74 3300025915 Ga0207693_10233266 Ga0207693_102332662 208
75 3300026041 Ga0207639_10197974 Ga0207639_101979742 208
76 3300027866 Ga0209813_10021795 Ga0209813_100217952 208
77 3300028573 Ga0265334_10160072 Ga0265334_101600721 208
78 3300031344 Ga0265316_10324675 Ga0265316_103246751 208
79 3300035111 Ga0373923_0071454 Ga0373923_0071454_796_1446 208
80 3300035172 Ga0373955_0207549 Ga0373955_0207549_21_671 208
81 3300035691 Ga0373931_0155567 Ga0373931_0155567_568_1200 208
82 3300035695 Ga0373927_0082431 Ga0373927_0082431_149_784 208
83 3300035724 Ga0373933_0178446 Ga0373933_0178446_617_1267 208
84 3300035725 Ga0373947_0122573 Ga0373947_0122573_885_1520 208
85 3300037068 Ga0373925_0141469 Ga0373925_0141469_522_1157 208
86 3300039450 Ga0436363_0060563 Ga0436363_0060563_257_883 208
87 3300045836 Ga0466958_0270621 Ga0466958_0270621_366_992 208
88 3300046472 Ga0495580_0090456 Ga0495580_0090456_620_1270 208
89 3300046529 Ga0495652_0342421 Ga0495652_0342421_379_1029 208
90 3300048929 Ga0496126_0375169 Ga0496126_0375169_412_1062 208
91 3300050489 nmdc:mga03683_75385_c1 nmdc:mga03683_75385_c1_742_1380 208
92 3300050491 nmdc:mga00v17_119366_c1 nmdc:mga00v17_119366_c1_719_1351 208
93 3300050492 nmdc:mga0yw44_122212_c1 nmdc:mga0yw44_122212_c1_806_1444 208
94 3300050493 nmdc:mga0k408_25133_c2 nmdc:mga0k408_25133_c2_426_1058 208
95 3300050495 nmdc:mga04h51_8945_c1 nmdc:mga04h51_8945_c1_983_1657 208
96 3300050514 nmdc:mga08x19_615396_c1 nmdc:mga08x19_615396_c1_106_747 208
97 3300053098 Ga0500650_0086067 Ga0500650_0086067_672_1310 208
98 3300053130 Ga0500642_0081854 Ga0500642_0081854_44_682 208
99 3300053153 Ga0500616_0003430 Ga0500616_0003430_879_1517 208
100 3300053178 Ga0500637_0245024 Ga0500637_0245024_261_890 208
101 3300053733 Ga0500552_001043 Ga0500552_001043_746_1378 208
102 3300005336 Ga0070680_100214171 Ga0070680_1002141712 209
103 3300005985 Ga0081539_10299881 Ga0081539_102998811 209
104 3300006195 Ga0075366_10044179 Ga0075366_100441793 209
105 3300021441 Ga0213871_10005835 Ga0213871_100058352 209
106 3300025913 Ga0207695_10226027 Ga0207695_102260272 209
107 3300031235 Ga0265330_10137182 Ga0265330_101371822 209
108 3300031239 Ga0265328_10000044 Ga0265328_1000004466 209
109 3300031239 Ga0265328_10000201 Ga0265328_1000020126 209
110 3300031242 Ga0265329_10012208 Ga0265329_100122081 209
111 3300031250 Ga0265331_10000210 Ga0265331_1000021048 209
112 3300031250 Ga0265331_10155343 Ga0265331_101553432 209
113 3300031251 Ga0265327_10056806 Ga0265327_100568062 209
114 3300031344 Ga0265316_10000414 Ga0265316_1000041429 209
115 3300039438 Ga0436360_0632186 Ga0436360_0632186_1745_2377 209
116 3300039447 Ga0436361_0669471 Ga0436361_0669471_1882_2511 209
117 3300044712 Ga0453684_0012470 Ga0453684_0012470_8849_9505 209
118 3300049581 Ga0501047_0207009 Ga0501047_0207009_180_809 209
119 3300049742 Ga0501080_0463244 Ga0501080_0463244_60_689 209
120 3300050493 nmdc:mga0k408_215399_c1 nmdc:mga0k408_215399_c1_144_773 209
121 3300009093 Ga0105240_10431870 Ga0105240_104318702 210
122 3300009094 Ga0111539_10165244 Ga0111539_101652442 210
123 3300011119 Ga0105246_10710609 Ga0105246_107106092 210
124 3300031239 Ga0265328_10002263 Ga0265328_100022632 210
125 3300031239 Ga0265328_10003469 Ga0265328_100034696 210
126 3300031250 Ga0265331_10000630 Ga0265331_1000063021 210
127 3300031251 Ga0265327_10018206 Ga0265327_100182066 210
128 3300032168 Ga0316593_10047030 Ga0316593_100470302 210
129 3300036647 Ga0316582_0215127 Ga0316582_0215127_607_1245 210
130 3300036712 Ga0316584_0345316 Ga0316584_0345316_196_834 210
131 3300050511 nmdc:mga08y16_62054_c1 nmdc:mga08y16_62054_c1_1271_1903 210
132 iso_pu_bacteria 2861691609 2861692111 210
133 3300042125 Ga0450923_008233 Ga0450923_008233_869_1504 211
134 3300044693 Ga0466961_0051386 Ga0466961_0051386_90_728 211
135 3300044842 Ga0466957_0274441 Ga0466957_0274441_124_762 211
136 3300045049 Ga0466959_0010726 Ga0466959_0010726_1903_2541 211
137 3300045836 Ga0466958_0077943 Ga0466958_0077943_808_1446 211
138 3300061719 Ga0466962_0139930 Ga0466962_0139930_213_851 211
139 3300003214 JGI25165J46597_1008072 JGI25165J46597_10080722 212
140 3300005337 Ga0070682_100005242 Ga0070682_1000052429 212
141 3300005341 Ga0070691_10050735 Ga0070691_100507352 212
142 3300005366 Ga0070659_100682333 Ga0070659_1006823332 212
143 3300005435 Ga0070714_100196044 Ga0070714_1001960443 212
144 3300005436 Ga0070713_100061601 Ga0070713_1000616014 212
145 3300005437 Ga0070710_10109281 Ga0070710_101092812 212
146 3300005439 Ga0070711_100021753 Ga0070711_1000217533 212
147 3300005455 Ga0070663_100166180 Ga0070663_1001661802 212
148 3300005458 Ga0070681_10003737 Ga0070681_1000373718 212
149 3300005530 Ga0070679_100000734 Ga0070679_10000073425 212
150 3300005539 Ga0068853_100001764 Ga0068853_10000176418 212
151 3300005549 Ga0070704_100002514 Ga0070704_10000251411 212
152 3300005563 Ga0068855_100010524 Ga0068855_10001052410 212
153 3300005937 Ga0081455_10028005 Ga0081455_100280055 212
154 3300005937 Ga0081455_10366220 Ga0081455_103662201 212
155 3300005983 Ga0081540_1135479 Ga0081540_11354791 212
156 3300009093 Ga0105240_10182050 Ga0105240_101820502 212
157 3300009553 Ga0105249_10007085 Ga0105249_100070857 212
158 3300010375 Ga0105239_10066970 Ga0105239_100669703 212
159 3300013100 Ga0157373_10026943 Ga0157373_100269432 212
160 3300013307 Ga0157372_10101565 Ga0157372_101015652 212
161 3300021384 Ga0213876_10071448 Ga0213876_100714482 212
162 3300025253 Ga0209677_102065 Ga0209677_1020652 212
163 3300025254 Ga0209148_1004251 Ga0209148_10042512 212
164 3300025254 Ga0209148_1014105 Ga0209148_10141052 212
165 3300025261 Ga0209233_1001782 Ga0209233_10017828 212
166 3300025272 Ga0209455_1003489 Ga0209455_10034892 212
167 3300025898 Ga0207692_10356210 Ga0207692_103562102 212
168 3300025912 Ga0207707_10026797 Ga0207707_100267975 212
169 3300025915 Ga0207693_10280267 Ga0207693_102802672 212
170 3300025921 Ga0207652_10064813 Ga0207652_100648132 212
171 3300025929 Ga0207664_10055611 Ga0207664_100556113 212
172 3300025932 Ga0207690_10024420 Ga0207690_100244202 212
173 3300025939 Ga0207665_10296218 Ga0207665_102962183 212
174 3300025961 Ga0207712_10001203 Ga0207712_1000120315 212
175 3300026041 Ga0207639_10034312 Ga0207639_100343122 212
176 3300028666 Ga0265336_10000235 Ga0265336_1000023532 212
177 3300035114 Ga0373939_0160997 Ga0373939_0160997_165_803 212
178 3300037853 Ga0436364_0877737 Ga0436364_0877737_560_1204 212
179 3300039437 Ga0436365_1524500 Ga0436365_1524500_557_1195 212
180 3300039437 Ga0436365_1744096 Ga0436365_1744096_703_1341 212
181 3300039450 Ga0436363_1417541 Ga0436363_1417541_1619_2257 212
182 3300042005 Ga0439448_0082402 Ga0439448_0082402_338_976 212
183 3300044684 Ga0466966_0157593 Ga0466966_0157593_303_941 212
184 3300044765 Ga0466970_0342765 Ga0466970_0342765_142_780 212
185 3300044842 Ga0466957_0161998 Ga0466957_0161998_381_1019 212
186 3300044842 Ga0466957_0203963 Ga0466957_0203963_633_1271 212
187 3300045049 Ga0466959_0124055 Ga0466959_0124055_656_1294 212
188 3300048903 Ga0496100_0065934 Ga0496100_0065934_431_1069 212
189 3300048920 Ga0496117_0083383 Ga0496117_0083383_501_1139 212
190 3300048921 Ga0496118_0016852 Ga0496118_0016852_5303_5941 212
191 3300048922 Ga0496119_0164727 Ga0496119_0164727_423_1061 212
192 3300048924 Ga0496121_0016228 Ga0496121_0016228_1387_2025 212
193 3300049569 Ga0501032_0080778 Ga0501032_0080778_595_1233 212
194 3300049570 Ga0501033_0106910 Ga0501033_0106910_522_1172 212
195 3300049571 Ga0501034_0011560 Ga0501034_0011560_810_1448 212
196 3300049572 Ga0501036_0005195 Ga0501036_0005195_7328_7966 212
197 3300049572 Ga0501036_0043574 Ga0501036_0043574_1024_1674 212
198 3300049574 Ga0501038_0021444 Ga0501038_0021444_1343_1981 212
199 3300049574 Ga0501038_0256789 Ga0501038_0256789_84_734 212
200 3300049579 Ga0501043_0038415 Ga0501043_0038415_850_1488 212
201 3300049580 Ga0501046_0154045 Ga0501046_0154045_307_945 212
202 3300049581 Ga0501047_0006073 Ga0501047_0006073_7143_7781 212
203 3300049581 Ga0501047_0032107 Ga0501047_0032107_3525_4163 212
204 3300049583 Ga0501067_0024813 Ga0501067_0024813_2662_3300 212
205 3300049584 Ga0501068_0128202 Ga0501068_0128202_290_928 212
206 3300049586 Ga0501070_0016752 Ga0501070_0016752_4213_4851 212
207 3300049589 Ga0501073_0038342 Ga0501073_0038342_612_1250 212
208 3300049590 Ga0501074_0058303 Ga0501074_0058303_830_1468 212
209 3300049742 Ga0501080_0019722 Ga0501080_0019722_4271_4909 212
210 3300049744 Ga0501083_0122669 Ga0501083_0122669_929_1567 212
211 3300049823 Ga0501044_0162545 Ga0501044_0162545_754_1392 212
212 3300049823 Ga0501044_0936998 Ga0501044_0936998_51_701 212
213 3300053077 Ga0495601_0324928 Ga0495601_0324928_177_815 212
214 3300060353 Ga0501082_0202214 Ga0501082_0202214_462_1100 212
215 3300039447 Ga0436361_0031744 Ga0436361_0031744_691_1332 213
216 3300049581 Ga0501047_0012359 Ga0501047_0012359_825_1505 213
217 3300045051 Ga0451576_0007419 Ga0451576_0007419_5550_6200 214
218 3300045976 Ga0466967_0598718 Ga0466967_0598718_272_916 214
219 3300047320 Ga0495672_0185008 Ga0495672_0185008_41_715 214
220 3300049568 Ga0501031_0059896 Ga0501031_0059896_1115_1765 214
221 3300049581 Ga0501047_0133539 Ga0501047_0133539_787_1434 215
222 3300049587 Ga0501071_0442958 Ga0501071_0442958_207_863 215
223 3300037853 Ga0436364_0597463 Ga0436364_0597463_108_767 216
224 3300005843 Ga0068860_100063329 Ga0068860_1000633292 218
225 3300028381 Ga0268264_10044797 Ga0268264_100447971 218
226 3300028800 Ga0265338_10596978 Ga0265338_105969781 218
227 3300031235 Ga0265330_10016975 Ga0265330_100169752 218
228 3300031238 Ga0265332_10111476 Ga0265332_101114762 218
229 3300031241 Ga0265325_10051734 Ga0265325_100517342 218
230 3300031247 Ga0265340_10000262 Ga0265340_1000026223 218
231 3300031249 Ga0265339_10089296 Ga0265339_100892962 218
232 3300031250 Ga0265331_10049033 Ga0265331_100490332 218
233 3300031344 Ga0265316_10076345 Ga0265316_100763453 218
234 3300031595 Ga0265313_10041083 Ga0265313_100410832 218
235 3300049574 Ga0501038_0257339 Ga0501038_0257339_387_1055 220
236 3300049586 Ga0501070_0000015 Ga0501070_0000015_71630_72298 220
237 3300049742 Ga0501080_0004107 Ga0501080_0004107_12174_12842 220
238 3300049822 Ga0501035_0013061 Ga0501035_0013061_1984_2652 220
239 3300049823 Ga0501044_0007031 Ga0501044_0007031_2262_2930 220
240 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013321 222
241 3300003320 rootH2_10055130 rootH2_100551302 222
242 3300005336 Ga0070680_100188054 Ga0070680_1001880542 222
243 3300005434 Ga0070709_10000892 Ga0070709_1000089213 222
244 3300005434 Ga0070709_10194783 Ga0070709_101947832 222
245 3300005435 Ga0070714_100015160 Ga0070714_1000151602 222
246 3300005436 Ga0070713_100000003 Ga0070713_10000000329 222
247 3300005437 Ga0070710_10045250 Ga0070710_100452501 222
248 3300005439 Ga0070711_100150758 Ga0070711_1001507581 222
249 3300005439 Ga0070711_100908533 Ga0070711_1009085331 222
250 3300005518 Ga0070699_100091745 Ga0070699_1000917452 222
251 3300005530 Ga0070679_100056201 Ga0070679_1000562012 222
252 3300005539 Ga0068853_100018389 Ga0068853_1000183895 222
253 3300005545 Ga0070695_100079773 Ga0070695_1000797731 222
254 3300005547 Ga0070693_100035371 Ga0070693_1000353712 222
255 3300005563 Ga0068855_100062780 Ga0068855_1000627802 222
256 3300005577 Ga0068857_100002420 Ga0068857_10000242014 222
257 3300005578 Ga0068854_100091304 Ga0068854_1000913042 222
258 3300005614 Ga0068856_100000719 Ga0068856_10000071923 222
259 3300005614 Ga0068856_100003762 Ga0068856_1000037626 222
260 3300005842 Ga0068858_100568906 Ga0068858_1005689062 222
261 3300005937 Ga0081455_10450545 Ga0081455_104505451 222
262 3300006175 Ga0070712_100000169 Ga0070712_1000001696 222
263 3300006175 Ga0070712_100313887 Ga0070712_1003138872 222
264 3300006914 Ga0075436_100000038 Ga0075436_10000003887 222
265 3300009093 Ga0105240_10089159 Ga0105240_100891594 222
266 3300009174 Ga0105241_10017676 Ga0105241_100176762 222
267 3300009545 Ga0105237_10011891 Ga0105237_1001189110 222
268 3300009551 Ga0105238_10003588 Ga0105238_100035889 222
269 3300010375 Ga0105239_10141205 Ga0105239_101412052 222
270 3300013100 Ga0157373_10007365 Ga0157373_100073659 222
271 3300013104 Ga0157370_10005041 Ga0157370_1000504114 222
272 3300013105 Ga0157369_10004747 Ga0157369_1000474714 222
273 3300014968 Ga0157379_10132174 Ga0157379_101321742 222
274 3300025261 Ga0209233_1000013 Ga0209233_1000013568 222
275 3300025906 Ga0207699_10000676 Ga0207699_1000067612 222
276 3300025913 Ga0207695_10162274 Ga0207695_101622742 222
277 3300025915 Ga0207693_10000408 Ga0207693_1000040836 222
278 3300025915 Ga0207693_10152350 Ga0207693_101523502 222
279 3300025921 Ga0207652_10093449 Ga0207652_100934492 222
280 3300025924 Ga0207694_10038193 Ga0207694_100381934 222
281 3300025928 Ga0207700_10000083 Ga0207700_1000008329 222
282 3300025929 Ga0207664_10011315 Ga0207664_100113157 222
283 3300025945 Ga0207679_10072771 Ga0207679_100727712 222
284 3300025949 Ga0207667_10044809 Ga0207667_100448092 222
285 3300025981 Ga0207640_10070475 Ga0207640_100704752 222
286 3300026035 Ga0207703_10660856 Ga0207703_106608562 222
287 3300026041 Ga0207639_10217060 Ga0207639_102170602 222
288 3300026078 Ga0207702_10000045 Ga0207702_10000045128 222
289 3300026078 Ga0207702_10002929 Ga0207702_100029299 222
290 3300026116 Ga0207674_10000026 Ga0207674_1000002680 222
291 3300031249 Ga0265339_10092453 Ga0265339_100924532 222
292 3300031595 Ga0265313_10124947 Ga0265313_101249472 222
293 3300031712 Ga0265342_10060329 Ga0265342_100603292 222
294 3300035724 Ga0373933_0008797 Ga0373933_0008797_4370_5038 222
295 3300036401 Ga0373937_0016703 Ga0373937_0016703_5094_5762 222
296 3300039437 Ga0436365_1104873 Ga0436365_1104873_5525_6193 222
297 3300046471 Ga0495650_0055653 Ga0495650_0055653_19_693 222
298 3300046472 Ga0495580_0075354 Ga0495580_0075354_1392_2060 222
299 3300048924 Ga0496121_0005644 Ga0496121_0005644_3804_4472 222
300 3300048929 Ga0496126_0113864 Ga0496126_0113864_464_1138 222
301 3300049568 Ga0501031_0000905 Ga0501031_0000905_16694_17374 222
302 3300049569 Ga0501032_0013547 Ga0501032_0013547_2537_3217 222
303 3300049569 Ga0501032_0094635 Ga0501032_0094635_543_1223 222
304 3300049569 Ga0501032_0109596 Ga0501032_0109596_465_1139 222
305 3300049570 Ga0501033_0015585 Ga0501033_0015585_4107_4787 222
306 3300049570 Ga0501033_0017686 Ga0501033_0017686_3264_3938 222
307 3300049570 Ga0501033_0032905 Ga0501033_0032905_2119_2817 222
308 3300049570 Ga0501033_0152532 Ga0501033_0152532_259_933 222
309 3300049571 Ga0501034_0005434 Ga0501034_0005434_12817_13497 222
310 3300049571 Ga0501034_0268640 Ga0501034_0268640_554_1222 222
311 3300049573 Ga0501037_0009933 Ga0501037_0009933_5673_6353 222
312 3300049573 Ga0501037_0083183 Ga0501037_0083183_1380_2054 222
313 3300049574 Ga0501038_0188750 Ga0501038_0188750_316_990 222
314 3300049574 Ga0501038_0201829 Ga0501038_0201829_434_1114 222
315 3300049575 Ga0501039_0004629 Ga0501039_0004629_9479_10159 222
316 3300049579 Ga0501043_0067749 Ga0501043_0067749_1128_1802 222
317 3300049579 Ga0501043_0210866 Ga0501043_0210866_482_1162 222
318 3300049581 Ga0501047_0050725 Ga0501047_0050725_1428_2102 222
319 3300049581 Ga0501047_0167509 Ga0501047_0167509_835_1509 222
320 3300049582 Ga0501048_0157857 Ga0501048_0157857_785_1465 222
321 3300049583 Ga0501067_0007529 Ga0501067_0007529_925_1605 222
322 3300049584 Ga0501068_0077780 Ga0501068_0077780_559_1239 222
323 3300049586 Ga0501070_0023675 Ga0501070_0023675_2422_3102 222
324 3300049588 Ga0501072_0060783 Ga0501072_0060783_2187_2867 222
325 3300049589 Ga0501073_0017576 Ga0501073_0017576_2241_2921 222
326 3300049590 Ga0501074_0022111 Ga0501074_0022111_784_1464 222
327 3300049741 Ga0501079_0003370 Ga0501079_0003370_7527_8207 222
328 3300049742 Ga0501080_0073326 Ga0501080_0073326_1446_2120 222
329 3300049744 Ga0501083_0193202 Ga0501083_0193202_300_980 222
330 3300049822 Ga0501035_0007878 Ga0501035_0007878_6048_6722 222
331 3300049822 Ga0501035_0078735 Ga0501035_0078735_1420_2100 222
332 3300049822 Ga0501035_0094721 Ga0501035_0094721_651_1325 222
333 3300049822 Ga0501035_0173493 Ga0501035_0173493_1121_1801 222
334 3300049822 Ga0501035_0298832 Ga0501035_0298832_634_1314 222
335 3300049823 Ga0501044_0000530 Ga0501044_0000530_28904_29578 222
336 3300049823 Ga0501044_0063947 Ga0501044_0063947_2085_2759 222
337 3300049823 Ga0501044_0232134 Ga0501044_0232134_44_724 222
338 3300049823 Ga0501044_0250012 Ga0501044_0250012_544_1224 222
339 3300049823 Ga0501044_0315496 Ga0501044_0315496_304_987 222
340 3300049824 Ga0501045_0332317 Ga0501045_0332317_343_1023 222
341 3300050513 nmdc:mga0rr50_61750_c1 nmdc:mga0rr50_61750_c1_327_995 222
342 3300050514 nmdc:mga08x19_95_c1 nmdc:mga08x19_95_c1_6046_6714 222
343 3300053096 Ga0500641_0153660 Ga0500641_0153660_259_927 222
344 3300054114 Ga0501084_0016689 Ga0501084_0016689_222_902 222
345 3300060353 Ga0501082_0004309 Ga0501082_0004309_481_1161 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

15

219

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.9124 1 211
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.9027 1 212
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8827 2 208
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.8688 1 211
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8598 1 212
ID Description Score Start End Superfamily
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8489 2 210 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8278 37 211 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8264 2 210 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8192 2 210 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8187 2 210 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537V0W6-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9785 2 143 GO:0005524
GO:0036430
GO:0036431
AF-A0A7X4EPK9-F1-model_v4 deleted 0.9757 1 214
AF-A0A5A7MYD6-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.975 3 126 GO:0004127
GO:0005524
AF-A0A7U4Z9Z3-F1-model_v4 deleted 0.9725 2 211
AF-A0A3D5UWI9-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9723 81 211 GO:0004127
GO:0005524

Feature Viewer

pLDDT pTM Quality
93.89 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map