F416252

General Info

Members Datasets Scaffolds Average Seq Length
345 231 690 193

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100768294|Ga0070668_1007682941
Length 217
Sequence MIEPRPRCWWAGAESPNPDPLMVAYHDEEWGTPVHDDAELFERLALESFQAGLSWSTILRKRENFRAAFRGFDPAVVAAFGLDDRERLMADAGIVRNGAKIDATVGNAQGVRALAGEFGSFDAYLVSIVPQPPATLPPDAISGSLPATTPVSDALSKDLKKRGFRFVGSTIVYSFMQSVGLVDDHLPGCFRYRGQGQPAISSGTSPGRGSCSRRRTR

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
226 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
227 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
228 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
229 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
230 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
231 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 1.45
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 10.14
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100768294 3300005347 Bacteria 854
2 JGI25406J46586_10078534 3300003203 Bacteria 1017
3 Ga0070658_10002846 3300005327 Bacteria 14383
4 Ga0070658_10019264 3300005327 Bacteria 5466
5 Ga0070683_100118792 3300005329 Unclassified 2497
6 Ga0070682_100326702 3300005337 Bacteria 1135
7 Ga0070660_100097451 3300005339 Bacteria 2326
8 Ga0070660_100411062 3300005339 Bacteria 1120
9 Ga0070691_10351809 3300005341 Bacteria 818
10 Ga0070692_10233263 3300005345 Bacteria 1093
11 Ga0070668_100502961 3300005347 Bacteria 1049
12 Ga0070674_100302301 3300005356 Bacteria 1276
13 Ga0070674_100383587 3300005356 Bacteria 1144
14 Ga0070659_100004179 3300005366 Bacteria 10298
15 Ga0070659_100542144 3300005366 Bacteria 995
16 Ga0070713_100012198 3300005436 Bacteria 6295
17 Ga0070705_100215621 3300005440 Bacteria 1326
18 Ga0070705_100445464 3300005440 Bacteria 970
19 Ga0070708_100006290 3300005445 Bacteria 9451
20 Ga0070708_100012980 3300005445 Bacteria 6806
21 Ga0070708_100043541 3300005445 Bacteria 3944
22 Ga0070678_100002081 3300005456 Bacteria 10853
23 Ga0070678_100015547 3300005456 Bacteria 4841
24 Ga0070678_100696446 3300005456 Bacteria 915
25 Ga0070662_100736632 3300005457 Bacteria 835
26 Ga0070706_100172915 3300005467 Bacteria 2017
27 Ga0070706_100185873 3300005467 Bacteria 1942
28 Ga0070707_100463854 3300005468 Bacteria 1228
29 Ga0070698_100072491 3300005471 Bacteria 3452
30 Ga0070698_100080094 3300005471 Bacteria 3261
31 Ga0070698_100257160 3300005471 Bacteria 1679
32 Ga0070699_100028798 3300005518 Bacteria 4790
33 Ga0070684_100096624 3300005535 Bacteria 2634
34 Ga0070697_100225057 3300005536 Bacteria 1599
35 Ga0070695_100010749 3300005545 Bacteria 5469
36 Ga0070695_100011885 3300005545 Bacteria 5211
37 Ga0070696_100101596 3300005546 Bacteria 2061
38 Ga0070696_100196260 3300005546 Bacteria 1505
39 Ga0070696_100259399 3300005546 Bacteria 1317
40 Ga0070696_100449000 3300005546 Bacteria 1017
41 Ga0070693_100031472 3300005547 Bacteria 2908
42 Ga0070704_100007507 3300005549 Bacteria 6491
43 Ga0070704_100202430 3300005549 Bacteria 1603
44 Ga0070704_100447587 3300005549 Bacteria 1111
45 Ga0068855_100392436 3300005563 Bacteria 1522
46 Ga0068855_100719092 3300005563 Bacteria 1067
47 Ga0068856_100451678 3300005614 Bacteria 1306
48 Ga0070702_100085472 3300005615 Bacteria 1900
49 Ga0068852_100302983 3300005616 Bacteria 1547
50 Ga0068864_100050079 3300005618 Bacteria 3594
51 Ga0068864_100058411 3300005618 Bacteria 3334
52 Ga0068866_10139021 3300005718 Bacteria 1392
53 Ga0068861_100313777 3300005719 Bacteria 1363
54 Ga0068863_100086406 3300005841 Bacteria 2972
55 Ga0068858_100298046 3300005842 Bacteria 1538
56 Ga0068860_100099365 3300005843 Bacteria 2776
57 Ga0081455_10098227 3300005937 Bacteria 2357
58 Ga0081539_10010700 3300005985 Bacteria 7397
59 Ga0081539_10121833 3300005985 Bacteria 1294
60 Ga0075432_10113145 3300006058 Bacteria 1013
61 Ga0068871_100581683 3300006358 Bacteria 1017
62 Ga0075428_100288638 3300006844 Bacteria 1765
63 Ga0075430_100009804 3300006846 Bacteria 8102
64 Ga0075430_100516496 3300006846 Bacteria 986
65 Ga0075431_100005807 3300006847 Bacteria 12211
66 Ga0075431_100036449 3300006847 Bacteria 5066
67 Ga0075433_10028695 3300006852 Bacteria 4733
68 Ga0075434_100101535 3300006871 Bacteria 2883
69 Ga0075434_100474892 3300006871 Bacteria 1272
70 Ga0075429_100565160 3300006880 Bacteria 997
71 Ga0075436_100039383 3300006914 Bacteria 3262
72 Ga0075435_100045057 3300007076 Bacteria 3534
73 Ga0075435_100123717 3300007076 Bacteria 2160
74 Ga0111539_10049400 3300009094 Bacteria 5017
75 Ga0111539_10067443 3300009094 Bacteria 4225
76 Ga0111539_10756470 3300009094 Bacteria 1131
77 Ga0105245_10078302 3300009098 Bacteria 3016
78 Ga0105245_10612670 3300009098 Bacteria 1116
79 Ga0114129_10003905 3300009147 Bacteria 21040
80 Ga0114129_10968822 3300009147 Bacteria 1073
81 Ga0105243_10017516 3300009148 Bacteria 5416
82 Ga0105243_10085681 3300009148 Bacteria 2583
83 Ga0105243_10420225 3300009148 Bacteria 1247
84 Ga0105241_10439622 3300009174 Bacteria 1152
85 Ga0105248_10245264 3300009177 Bacteria 2016
86 Ga0105237_10481505 3300009545 Bacteria 1247
87 Ga0105238_10057948 3300009551 Bacteria 3883
88 Ga0105239_10089060 3300010375 Bacteria 3403
89 Ga0105239_10376102 3300010375 Bacteria 1606
90 Ga0105246_10154333 3300011119 Bacteria 1742
91 Ga0157369_10017790 3300013105 Bacteria 7979
92 Ga0157369_10047298 3300013105 Bacteria 4672
93 Ga0157374_10255588 3300013296 Bacteria 1725
94 Ga0157378_10012452 3300013297 Bacteria 7447
95 Ga0157378_10688376 3300013297 Bacteria 1041
96 Ga0163162_10034816 3300013306 Bacteria 5013
97 Ga0163162_10650771 3300013306 Bacteria 1177
98 Ga0157375_10045974 3300013308 Bacteria 4252
99 Ga0157375_10332582 3300013308 Bacteria 1684
100 Ga0163163_10063205 3300014325 Bacteria 3670
101 Ga0182008_10017546 3300014497 Bacteria 3712
102 Ga0157379_10451957 3300014968 Bacteria 1186
103 Ga0182007_10010625 3300015262 Bacteria 3626
104 Ga0197907_10594490 3300020069 Bacteria 1967
105 Ga0206356_10665382 3300020070 Bacteria 3897
106 Ga0206354_10422745 3300020081 Bacteria 1852
107 Ga0206353_10363239 3300020082 Bacteria 2753
108 Ga0206353_11277808 3300020082 Bacteria 6480
109 Ga0207642_10110099 3300025899 Bacteria 1401
110 Ga0207645_10528633 3300025907 Bacteria 799
111 Ga0207705_10049689 3300025909 Bacteria 3019
112 Ga0207705_10169091 3300025909 Bacteria 1645
113 Ga0207684_10005661 3300025910 Bacteria 11478
114 Ga0207684_10160759 3300025910 Bacteria 1934
115 Ga0207695_10164465 3300025913 Bacteria 2148
116 Ga0207660_10273930 3300025917 Bacteria 1338
117 Ga0207657_10007611 3300025919 Bacteria 11086
118 Ga0207657_10022682 3300025919 Bacteria 5866
119 Ga0207649_10924699 3300025920 Bacteria 684
120 Ga0207652_10302162 3300025921 Bacteria 1444
121 Ga0207646_10072593 3300025922 Bacteria 3074
122 Ga0207646_10104925 3300025922 Bacteria 2534
123 Ga0207694_10480415 3300025924 Bacteria 1039
124 Ga0207659_10095572 3300025926 Bacteria 2229
125 Ga0207687_10589922 3300025927 Bacteria 936
126 Ga0207664_10384372 3300025929 Bacteria 1246
127 Ga0207664_11146856 3300025929 Bacteria 694
128 Ga0207686_10643528 3300025934 Bacteria 838
129 Ga0207709_10739474 3300025935 Bacteria 790
130 Ga0207669_10478793 3300025937 Bacteria 992
131 Ga0207704_10326788 3300025938 Bacteria 1185
132 Ga0207691_10403121 3300025940 Bacteria 1166
133 Ga0207689_10166700 3300025942 Bacteria 1815
134 Ga0207667_10019925 3300025949 Bacteria 7474
135 Ga0207667_10151463 3300025949 Bacteria 2387
136 Ga0207668_10494266 3300025972 Bacteria 1051
137 Ga0207668_10670941 3300025972 Bacteria 909
138 Ga0207677_10286942 3300026023 Bacteria 1354
139 Ga0207703_10398345 3300026035 Bacteria 1277
140 Ga0207702_10924273 3300026078 Bacteria 865
141 Ga0207641_10218096 3300026088 Bacteria 1768
142 Ga0207675_100394589 3300026118 Bacteria 1363
143 Ga0207683_10029846 3300026121 Bacteria 4722
144 Ga0207428_10680778 3300027907 Bacteria 737
145 Ga0265326_10019501 3300028558 Bacteria 1947
146 Ga0265319_1000918 3300028563 Bacteria 18484
147 Ga0265319_1020284 3300028563 Bacteria 2467
148 Ga0265334_10010949 3300028573 Bacteria 3826
149 Ga0265318_10007815 3300028577 Bacteria 4807
150 Ga0265318_10070835 3300028577 Bacteria 1292
151 Ga0265318_10074601 3300028577 Bacteria 1255
152 Ga0265336_10004039 3300028666 Bacteria 5591
153 Ga0265338_10574329 3300028800 Bacteria 787
154 Ga0265324_10001603 3300029957 Bacteria 12601
155 Ga0265330_10064498 3300031235 Bacteria 1591
156 Ga0265320_10007401 3300031240 Bacteria 6818
157 Ga0265325_10084995 3300031241 Bacteria 1568
158 Ga0265329_10004773 3300031242 Bacteria 5571
159 Ga0265329_10025195 3300031242 Bacteria 1970
160 Ga0265340_10015044 3300031247 Bacteria 4027
161 Ga0265339_10034179 3300031249 Bacteria 2858
162 Ga0265339_10171069 3300031249 Bacteria 1087
163 Ga0265339_10236213 3300031249 Bacteria 889
164 Ga0265331_10037851 3300031250 Bacteria 2361
165 Ga0265316_10127489 3300031344 Bacteria 1918
166 Ga0265316_10409662 3300031344 Bacteria 976
167 Ga0307513_10304134 3300031456 Bacteria 1360
168 Ga0307408_100076835 3300031548 Bacteria 2485
169 Ga0307514_10114219 3300031649 Bacteria 1904
170 Ga0265314_10004553 3300031711 Bacteria 12802
171 Ga0265342_10036978 3300031712 Bacteria 2980
172 Ga0265342_10067892 3300031712 Bacteria 2085
173 Ga0316576_10782449 3300031727 Bacteria 688
174 Ga0307410_10219152 3300031852 Bacteria 1463
175 Ga0307406_10410560 3300031901 Bacteria 1076
176 Ga0307406_10417086 3300031901 Bacteria 1068
177 Ga0307416_100001109 3300032002 Bacteria 14457
178 Ga0307415_100005086 3300032126 Bacteria 6927
179 Ga0373929_0033478 3300035085 Bacteria 1111
180 Ga0373934_0015005 3300035086 Bacteria 2938
181 Ga0373952_0062076 3300035092 Bacteria 916
182 Ga0373956_0022385 3300035119 Bacteria 2704
183 Ga0373960_0038015 3300035121 Bacteria 1378
184 Ga0373961_0159528 3300035241 Bacteria 774
185 Ga0373924_0157295 3300035410 Bacteria 996
186 Ga0373933_0041047 3300035724 Bacteria 2729
187 Ga0373933_0483378 3300035724 Bacteria 811
188 Ga0373937_0014369 3300036401 Bacteria 6989
189 Ga0373925_0085490 3300037068 Bacteria 2405
190 Ga0373925_0332013 3300037068 Bacteria 1232
191 Ga0395900_0068183 3300037418 Bacteria 3655
192 Ga0395898_0070121 3300037466 Bacteria 3389
193 Ga0395898_0355317 3300037466 Bacteria 1397
194 Ga0395898_1028986 3300037466 Bacteria 759
195 Ga0395905_0067133 3300037471 Bacteria 3359
196 Ga0395905_0989380 3300037471 Bacteria 744
197 Ga0395901_0036619 3300038443 Bacteria 5072
198 Ga0242420_026470 3300038996 Bacteria 1058
199 Ga0439466_0177977 3300041411 Bacteria 648
200 Ga0451789_0311538 3300041443 Bacteria 1414
201 Ga0451798_0800942 3300041458 Bacteria 2273
202 Ga0451804_0563871 3300041463 Bacteria 1637
203 Ga0451853_1417449 3300041512 Unclassified 1587
204 Ga0450907_041934 3300042146 Bacteria 784
205 Ga0453683_0032100 3300044673 Bacteria 3315
206 Ga0466961_0095566 3300044693 Bacteria 1874
207 Ga0466963_0001821 3300044694 Bacteria 11601
208 Ga0466963_0006411 3300044694 Bacteria 6960
209 Ga0466963_0016799 3300044694 Bacteria 4555
210 Ga0466964_0234981 3300044706 Bacteria 896
211 Ga0466964_0247551 3300044706 Bacteria 877
212 Ga0453684_0052750 3300044712 Bacteria 5313
213 Ga0453684_0663695 3300044712 Bacteria 1136
214 Ga0466959_0694866 3300045049 Bacteria 682
215 Ga0451576_0003376 3300045051 Bacteria 22069
216 Ga0451576_0108822 3300045051 Bacteria 2884
217 Ga0466958_0002495 3300045836 Bacteria 9274
218 Ga0466958_0106509 3300045836 Bacteria 1748
219 Ga0466967_0050813 3300045976 Bacteria 3631
220 Ga0495592_0125348 3300046454 Bacteria 1803
221 Ga0495641_0005375 3300046461 Bacteria 8671
222 Ga0495651_0298517 3300046462 Bacteria 1081
223 Ga0495594_0330149 3300046499 Bacteria 869
224 Ga0495628_0091721 3300046516 Bacteria 2351
225 Ga0495665_0363790 3300046531 Bacteria 736
226 Ga0495586_0277700 3300046535 Bacteria 958
227 Ga0495645_0083396 3300046543 Bacteria 2291
228 Ga0495667_0095667 3300046559 Bacteria 1923
229 Ga0495634_0014283 3300046642 Bacteria 5730
230 Ga0495599_0140946 3300046678 Bacteria 1496
231 Ga0495658_0513845 3300046683 Bacteria 767
232 Ga0495649_0002052 3300046694 Bacteria 14494
233 Ga0495600_0046519 3300046809 Bacteria 2831
234 Ga0495680_0080010 3300047322 Bacteria 2470
235 Ga0495684_0061976 3300047471 Bacteria 2845
236 Ga0495686_0000020 3300047472 Bacteria 429191
237 Ga0495602_0011259 3300048088 Bacteria 9250
238 Ga0496100_0282300 3300048903 Bacteria 1238
239 Ga0496101_0081379 3300048904 Bacteria 2395
240 Ga0496101_0397686 3300048904 Bacteria 1085
241 Ga0496102_0027538 3300048905 Bacteria 5076
242 Ga0496102_0031938 3300048905 Bacteria 4727
243 Ga0496102_0050532 3300048905 Bacteria 3786
244 Ga0496102_0225019 3300048905 Bacteria 1769
245 Ga0496102_0430355 3300048905 Bacteria 1239
246 Ga0496102_0987847 3300048905 Bacteria 762
247 Ga0496104_0003944 3300048907 Bacteria 12841
248 Ga0496104_0507392 3300048907 Bacteria 1117
249 Ga0496105_0026890 3300048908 Bacteria 4695
250 Ga0496106_0311741 3300048909 Bacteria 1263
251 Ga0496107_0104998 3300048910 Bacteria 2074
252 Ga0496107_0229750 3300048910 Bacteria 1380
253 Ga0496108_0014176 3300048911 Bacteria 6503
254 Ga0496108_0103643 3300048911 Bacteria 2427
255 Ga0496108_0138391 3300048911 Bacteria 2097
256 Ga0496109_0004495 3300048912 Bacteria 11655
257 Ga0496109_0007745 3300048912 Bacteria 9094
258 Ga0496109_0073285 3300048912 Bacteria 3146
259 Ga0496109_0075688 3300048912 Bacteria 3095
260 Ga0496110_0012161 3300048913 Bacteria 7071
261 Ga0496110_0033909 3300048913 Bacteria 4418
262 Ga0496111_0006080 3300048914 Bacteria 7805
263 Ga0496111_0033157 3300048914 Bacteria 3682
264 Ga0496111_0321446 3300048914 Bacteria 1146
265 Ga0496112_0076136 3300048915 Bacteria 3319
266 Ga0496112_0133076 3300048915 Bacteria 2457
267 Ga0496112_0196263 3300048915 Bacteria 1979
268 Ga0496113_0106662 3300048916 Bacteria 2176
269 Ga0496114_0076991 3300048917 Bacteria 2812
270 Ga0501031_0261658 3300049568 Bacteria 1124
271 Ga0501036_0237457 3300049572 Bacteria 1529
272 Ga0501039_0360946 3300049575 Bacteria 1141
273 Ga0501040_0044128 3300049576 Bacteria 3039
274 Ga0501041_0080097 3300049577 Bacteria 2011
275 Ga0501041_0099650 3300049577 Bacteria 1798
276 Ga0501042_0028899 3300049578 Bacteria 3910
277 Ga0501067_0020305 3300049583 Bacteria 3676
278 Ga0501067_0093665 3300049583 Bacteria 1668
279 Ga0501067_0268321 3300049583 Bacteria 950
280 Ga0501067_0346841 3300049583 Bacteria 827
281 Ga0501068_0344708 3300049584 Bacteria 957
282 Ga0501068_0643477 3300049584 Bacteria 692
283 Ga0501069_0124133 3300049585 Bacteria 1476
284 Ga0501070_0855844 3300049586 Bacteria 711
285 Ga0501071_0148576 3300049587 Bacteria 1747
286 Ga0501071_0175791 3300049587 Bacteria 1604
287 Ga0501071_0409221 3300049587 Bacteria 1036
288 Ga0501072_0036840 3300049588 Bacteria 3836
289 Ga0501072_0071921 3300049588 Bacteria 2733
290 Ga0501074_0146239 3300049590 Bacteria 1690
291 Ga0501075_0091996 3300049591 Bacteria 2302
292 Ga0501076_0013446 3300049592 Bacteria 6140
293 Ga0501076_0014331 3300049592 Bacteria 5970
294 Ga0501076_0059233 3300049592 Bacteria 3046
295 Ga0501079_0017204 3300049741 Bacteria 5520
296 Ga0501079_0022960 3300049741 Bacteria 4791
297 Ga0501079_0079330 3300049741 Bacteria 2539
298 Ga0501080_0746019 3300049742 Bacteria 861
299 Ga0501081_0015499 3300049743 Bacteria 5031
300 Ga0501081_0555689 3300049743 Bacteria 858
301 Ga0501283_056938 3300049779 Bacteria 701
302 Ga0501045_0074416 3300049824 Bacteria 2501
303 nmdc:mga0yw44_270675_c1 3300050492 Bacteria 1134
304 nmdc:mga05p37_102347_c1 3300050507 Bacteria 3527
305 nmdc:mga05p37_1093679_c1 3300050507 Bacteria 836
306 nmdc:mga05p37_11980_c1 3300050507 Bacteria 10346
307 nmdc:mga05p37_56206_c1 3300050507 Bacteria 4845
308 nmdc:mga09592_710160_c1 3300050508 Bacteria 855
309 nmdc:mga0qj67_107560_c1 3300050509 Bacteria 2250
310 nmdc:mga0qj67_613295_c1 3300050509 Bacteria 870
311 nmdc:mga06r32_444772_c1 3300050510 Bacteria 1276
312 nmdc:mga06r32_711308_c1 3300050510 Bacteria 970
313 nmdc:mga08y16_115049_c1 3300050511 Bacteria 2800
314 nmdc:mga08y16_21988_c1 3300050511 Bacteria 6733
315 nmdc:mga08y16_254540_c1 3300050511 Bacteria 1814
316 nmdc:mga0n895_146074_c1 3300050512 Bacteria 2394
317 nmdc:mga0n895_39203_c1 3300050512 Bacteria 4595
318 nmdc:mga0n895_748439_c1 3300050512 Bacteria 970
319 nmdc:mga0n895_90959_c1 3300050512 Bacteria 3054
320 nmdc:mga0rr50_114988_c1 3300050513 Bacteria 2135
321 nmdc:mga0rr50_220222_c1 3300050513 Bacteria 1567
322 nmdc:mga0rr50_488303_c1 3300050513 Bacteria 1046
323 nmdc:mga08x19_365312_c1 3300050514 Bacteria 1009
324 nmdc:mga0a205_124940_c1 3300050515 Bacteria 2472
325 nmdc:mga0a205_59492_c1 3300050515 Bacteria 3690
326 nmdc:mga0a205_859170_c1 3300050515 Bacteria 754
327 Ga0495601_0185821 3300053077 Bacteria 1358
328 Ga0495655_0273357 3300053083 Bacteria 574
329 Ga0495595_0002628 3300053084 Bacteria 7043
330 Ga0495595_0355080 3300053084 Bacteria 740
331 Ga0495619_0242545 3300053085 Bacteria 1249
332 Ga0500650_0207828 3300053098 Bacteria 890
333 Ga0501084_0038493 3300054114 Bacteria 3998
334 Ga0501084_0253778 3300054114 Bacteria 1484
335 Ga0501082_0036287 3300060353 Bacteria 4247
336 Ga0501082_0189710 3300060353 Bacteria 1788
337 Ga0501082_0451541 3300060353 Bacteria 1123
338 Ga0530510_0001027 3300061734 Bacteria 18472
339 2808856649 2808606361 Bacteria 6136259
340 2808925817 2808606376 Bacteria 6248667
341 2808936615 2808606378 Bacteria 6177535
342 2808947942 2808606380 Bacteria 6248705
343 2808965092 2808606383 Bacteria 6138645
344 2808999984 2808606389 Bacteria 6138126
345 2898795271 2898795034 Bacteria 4294459
346 Ga0070668_100768294
347 JGI25406J46586_10078534
348 Ga0070658_10002846
349 Ga0070658_10019264
350 Ga0070683_100118792
351 Ga0070682_100326702
352 Ga0070660_100097451
353 Ga0070660_100411062
354 Ga0070691_10351809
355 Ga0070692_10233263
356 Ga0070668_100502961
357 Ga0070674_100302301
358 Ga0070674_100383587
359 Ga0070659_100004179
360 Ga0070659_100542144
361 Ga0070713_100012198
362 Ga0070705_100215621
363 Ga0070705_100445464
364 Ga0070708_100006290
365 Ga0070708_100012980
366 Ga0070708_100043541
367 Ga0070678_100002081
368 Ga0070678_100015547
369 Ga0070678_100696446
370 Ga0070662_100736632
371 Ga0070706_100172915
372 Ga0070706_100185873
373 Ga0070707_100463854
374 Ga0070698_100072491
375 Ga0070698_100080094
376 Ga0070698_100257160
377 Ga0070699_100028798
378 Ga0070684_100096624
379 Ga0070697_100225057
380 Ga0070695_100010749
381 Ga0070695_100011885
382 Ga0070696_100101596
383 Ga0070696_100196260
384 Ga0070696_100259399
385 Ga0070696_100449000
386 Ga0070693_100031472
387 Ga0070704_100007507
388 Ga0070704_100202430
389 Ga0070704_100447587
390 Ga0068855_100392436
391 Ga0068855_100719092
392 Ga0068856_100451678
393 Ga0070702_100085472
394 Ga0068852_100302983
395 Ga0068864_100050079
396 Ga0068864_100058411
397 Ga0068866_10139021
398 Ga0068861_100313777
399 Ga0068863_100086406
400 Ga0068858_100298046
401 Ga0068860_100099365
402 Ga0081455_10098227
403 Ga0081539_10010700
404 Ga0081539_10121833
405 Ga0075432_10113145
406 Ga0068871_100581683
407 Ga0075428_100288638
408 Ga0075430_100009804
409 Ga0075430_100516496
410 Ga0075431_100005807
411 Ga0075431_100036449
412 Ga0075433_10028695
413 Ga0075434_100101535
414 Ga0075434_100474892
415 Ga0075429_100565160
416 Ga0075436_100039383
417 Ga0075435_100045057
418 Ga0075435_100123717
419 Ga0111539_10049400
420 Ga0111539_10067443
421 Ga0111539_10756470
422 Ga0105245_10078302
423 Ga0105245_10612670
424 Ga0114129_10003905
425 Ga0114129_10968822
426 Ga0105243_10017516
427 Ga0105243_10085681
428 Ga0105243_10420225
429 Ga0105241_10439622
430 Ga0105248_10245264
431 Ga0105237_10481505
432 Ga0105238_10057948
433 Ga0105239_10089060
434 Ga0105239_10376102
435 Ga0105246_10154333
436 Ga0157369_10017790
437 Ga0157369_10047298
438 Ga0157374_10255588
439 Ga0157378_10012452
440 Ga0157378_10688376
441 Ga0163162_10034816
442 Ga0163162_10650771
443 Ga0157375_10045974
444 Ga0157375_10332582
445 Ga0163163_10063205
446 Ga0182008_10017546
447 Ga0157379_10451957
448 Ga0182007_10010625
449 Ga0197907_10594490
450 Ga0206356_10665382
451 Ga0206354_10422745
452 Ga0206353_10363239
453 Ga0206353_11277808
454 Ga0207642_10110099
455 Ga0207645_10528633
456 Ga0207705_10049689
457 Ga0207705_10169091
458 Ga0207684_10005661
459 Ga0207684_10160759
460 Ga0207695_10164465
461 Ga0207660_10273930
462 Ga0207657_10007611
463 Ga0207657_10022682
464 Ga0207649_10924699
465 Ga0207652_10302162
466 Ga0207646_10072593
467 Ga0207646_10104925
468 Ga0207694_10480415
469 Ga0207659_10095572
470 Ga0207687_10589922
471 Ga0207664_10384372
472 Ga0207664_11146856
473 Ga0207686_10643528
474 Ga0207709_10739474
475 Ga0207669_10478793
476 Ga0207704_10326788
477 Ga0207691_10403121
478 Ga0207689_10166700
479 Ga0207667_10019925
480 Ga0207667_10151463
481 Ga0207668_10494266
482 Ga0207668_10670941
483 Ga0207677_10286942
484 Ga0207703_10398345
485 Ga0207702_10924273
486 Ga0207641_10218096
487 Ga0207675_100394589
488 Ga0207683_10029846
489 Ga0207428_10680778
490 Ga0265326_10019501
491 Ga0265319_1000918
492 Ga0265319_1020284
493 Ga0265334_10010949
494 Ga0265318_10007815
495 Ga0265318_10070835
496 Ga0265318_10074601
497 Ga0265336_10004039
498 Ga0265338_10574329
499 Ga0265324_10001603
500 Ga0265330_10064498
501 Ga0265320_10007401
502 Ga0265325_10084995
503 Ga0265329_10004773
504 Ga0265329_10025195
505 Ga0265340_10015044
506 Ga0265339_10034179
507 Ga0265339_10171069
508 Ga0265339_10236213
509 Ga0265331_10037851
510 Ga0265316_10127489
511 Ga0265316_10409662
512 Ga0307513_10304134
513 Ga0307408_100076835
514 Ga0307514_10114219
515 Ga0265314_10004553
516 Ga0265342_10036978
517 Ga0265342_10067892
518 Ga0316576_10782449
519 Ga0307410_10219152
520 Ga0307406_10410560
521 Ga0307406_10417086
522 Ga0307416_100001109
523 Ga0307415_100005086
524 Ga0373929_0033478
525 Ga0373934_0015005
526 Ga0373952_0062076
527 Ga0373956_0022385
528 Ga0373960_0038015
529 Ga0373961_0159528
530 Ga0373924_0157295
531 Ga0373933_0041047
532 Ga0373933_0483378
533 Ga0373937_0014369
534 Ga0373925_0085490
535 Ga0373925_0332013
536 Ga0395900_0068183
537 Ga0395898_0070121
538 Ga0395898_0355317
539 Ga0395898_1028986
540 Ga0395905_0067133
541 Ga0395905_0989380
542 Ga0395901_0036619
543 Ga0242420_026470
544 Ga0439466_0177977
545 Ga0451789_0311538
546 Ga0451798_0800942
547 Ga0451804_0563871
548 Ga0451853_1417449
549 Ga0450907_041934
550 Ga0453683_0032100
551 Ga0466961_0095566
552 Ga0466963_0001821
553 Ga0466963_0006411
554 Ga0466963_0016799
555 Ga0466964_0234981
556 Ga0466964_0247551
557 Ga0453684_0052750
558 Ga0453684_0663695
559 Ga0466959_0694866
560 Ga0451576_0003376
561 Ga0451576_0108822
562 Ga0466958_0002495
563 Ga0466958_0106509
564 Ga0466967_0050813
565 Ga0495592_0125348
566 Ga0495641_0005375
567 Ga0495651_0298517
568 Ga0495594_0330149
569 Ga0495628_0091721
570 Ga0495665_0363790
571 Ga0495586_0277700
572 Ga0495645_0083396
573 Ga0495667_0095667
574 Ga0495634_0014283
575 Ga0495599_0140946
576 Ga0495658_0513845
577 Ga0495649_0002052
578 Ga0495600_0046519
579 Ga0495680_0080010
580 Ga0495684_0061976
581 Ga0495686_0000020
582 Ga0495602_0011259
583 Ga0496100_0282300
584 Ga0496101_0081379
585 Ga0496101_0397686
586 Ga0496102_0027538
587 Ga0496102_0031938
588 Ga0496102_0050532
589 Ga0496102_0225019
590 Ga0496102_0430355
591 Ga0496102_0987847
592 Ga0496104_0003944
593 Ga0496104_0507392
594 Ga0496105_0026890
595 Ga0496106_0311741
596 Ga0496107_0104998
597 Ga0496107_0229750
598 Ga0496108_0014176
599 Ga0496108_0103643
600 Ga0496108_0138391
601 Ga0496109_0004495
602 Ga0496109_0007745
603 Ga0496109_0073285
604 Ga0496109_0075688
605 Ga0496110_0012161
606 Ga0496110_0033909
607 Ga0496111_0006080
608 Ga0496111_0033157
609 Ga0496111_0321446
610 Ga0496112_0076136
611 Ga0496112_0133076
612 Ga0496112_0196263
613 Ga0496113_0106662
614 Ga0496114_0076991
615 Ga0501031_0261658
616 Ga0501036_0237457
617 Ga0501039_0360946
618 Ga0501040_0044128
619 Ga0501041_0080097
620 Ga0501041_0099650
621 Ga0501042_0028899
622 Ga0501067_0020305
623 Ga0501067_0093665
624 Ga0501067_0268321
625 Ga0501067_0346841
626 Ga0501068_0344708
627 Ga0501068_0643477
628 Ga0501069_0124133
629 Ga0501070_0855844
630 Ga0501071_0148576
631 Ga0501071_0175791
632 Ga0501071_0409221
633 Ga0501072_0036840
634 Ga0501072_0071921
635 Ga0501074_0146239
636 Ga0501075_0091996
637 Ga0501076_0013446
638 Ga0501076_0014331
639 Ga0501076_0059233
640 Ga0501079_0017204
641 Ga0501079_0022960
642 Ga0501079_0079330
643 Ga0501080_0746019
644 Ga0501081_0015499
645 Ga0501081_0555689
646 Ga0501283_056938
647 Ga0501045_0074416
648 nmdc:mga0yw44_270675_c1
649 nmdc:mga05p37_102347_c1
650 nmdc:mga05p37_1093679_c1
651 nmdc:mga05p37_11980_c1
652 nmdc:mga05p37_56206_c1
653 nmdc:mga09592_710160_c1
654 nmdc:mga0qj67_107560_c1
655 nmdc:mga0qj67_613295_c1
656 nmdc:mga06r32_444772_c1
657 nmdc:mga06r32_711308_c1
658 nmdc:mga08y16_115049_c1
659 nmdc:mga08y16_21988_c1
660 nmdc:mga08y16_254540_c1
661 nmdc:mga0n895_146074_c1
662 nmdc:mga0n895_39203_c1
663 nmdc:mga0n895_748439_c1
664 nmdc:mga0n895_90959_c1
665 nmdc:mga0rr50_114988_c1
666 nmdc:mga0rr50_220222_c1
667 nmdc:mga0rr50_488303_c1
668 nmdc:mga08x19_365312_c1
669 nmdc:mga0a205_124940_c1
670 nmdc:mga0a205_59492_c1
671 nmdc:mga0a205_859170_c1
672 Ga0495601_0185821
673 Ga0495655_0273357
674 Ga0495595_0002628
675 Ga0495595_0355080
676 Ga0495619_0242545
677 Ga0500650_0207828
678 Ga0501084_0038493
679 Ga0501084_0253778
680 Ga0501082_0036287
681 Ga0501082_0189710
682 Ga0501082_0451541
683 Ga0530510_0001027
684 2808856649
685 2808925817
686 2808936615
687 2808947942
688 2808965092
689 2808999984
690 2898795271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

15

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9616 19 189
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9585 19 189
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9515 8 190
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9499 17 189
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9314 8 190
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.956 8 194 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9552 8 192 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9551 17 189 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9403 8 192 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9313 8 194 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A6J4VKG9-F1-model_v4 DNA-3-methyladenine glycosylase (EC 3.2.2.20) 0.9792 7 191 GO:0006284
GO:0008725
GO:0046872
AF-A0A536PTU3-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9771 8 180 GO:0006284
GO:0008725
GO:0046872
AF-A0A1F5ANT2-F1-model_v4 DNA-3-methyladenine glycosylase 0.9763 22 191 GO:0006284
GO:0008725
GO:0046872
AF-A0A7V4CYS3-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9757 6 193 GO:0006284
GO:0008725
GO:0046872
AF-W1Q5J3-F1-model_v4 Putative DNA-3-methyladenine glycosylase 1 0.9754 8 189 GO:0006284
GO:0008725
GO:0046872

Map