F416120
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 220 | 333 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300047443|Ga0495687_000174|Ga0495687_000174_86843_87889 |
| Length | 348 |
| Sequence | MHTRLAKFQTTTIPKDPSMTTRLRTALRRRGLLLGGAALVLPLALPPLAHAQAFPAKPITLIVPWPAGGSTDRHLRALAEIASKNLGQIITVDNRPGGGGTTGPGTMALTARPDGYTIAQYPMGMLRVPHMQKVQWDPLKDFTFIIGVSGYTFGFTVRSDSPYKTFNDYVEAARKEPGKIDYGSTGIGTSPHLLMEELAGNARIALNHVPFKGNADLTQALLGGHVMAMSDATGWDKFVDGGQMRLLVTFGEQRTRRWPNVPTAKDLGYNVVATSPYGFVGPKGMDPAVVKTLHDAFKKAMDDPKHLEVLAQLNQDLWYRSGDDYAKWARETYAKDKALIERLGLAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 10 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 11 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 145 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 160 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 161 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 162 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 163 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 164 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 165 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 166 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 167 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 168 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 188 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 189 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 190 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 195 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 200 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 201 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 202 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 203 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 210 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 211 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 212 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 213 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 214 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 215 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 216 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 217 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 218 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 220 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.8 |
| Metatranscriptomes | 0 |
| Isolates | 3.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.13 |
| Nodule | 1.16 |
| Rhizoplane | 1.74 |
| Rhizosphere | 63.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000973 | 3300003215 | Bacteria | 17387 |
| 2 | JGI25153J46596_10014835 | 3300003215 | Bacteria | 3214 |
| 3 | rootL2_10056964 | 3300003322 | Bacteria | 1432 |
| 4 | rootH1_10196826 | 3300003323 | Bacteria | 2121 |
| 5 | Ga0055526_1001927 | 3300003771 | Bacteria | 14348 |
| 6 | Ga0055524_1000420 | 3300003775 | Bacteria | 35681 |
| 7 | Ga0055530_10001480 | 3300003791 | Bacteria | 17058 |
| 8 | Ga0055540_1000308 | 3300003792 | Bacteria | 43457 |
| 9 | Ga0065165_1002369 | 3300005262 | Bacteria | 16289 |
| 10 | Ga0065165_1034655 | 3300005262 | Bacteria | 1559 |
| 11 | Ga0065707_10093597 | 3300005295 | Bacteria | 3604 |
| 12 | Ga0070676_10021421 | 3300005328 | Bacteria | 3619 |
| 13 | Ga0070683_100323583 | 3300005329 | Bacteria | 1468 |
| 14 | Ga0070670_100037992 | 3300005331 | Bacteria | 4140 |
| 15 | Ga0070670_100290935 | 3300005331 | Bacteria | 1427 |
| 16 | Ga0068869_100027292 | 3300005334 | Bacteria | 3980 |
| 17 | Ga0068869_100047832 | 3300005334 | Bacteria | 3090 |
| 18 | Ga0070666_10020325 | 3300005335 | Bacteria | 4291 |
| 19 | Ga0070669_100167574 | 3300005353 | Bacteria | 1711 |
| 20 | Ga0070675_100019069 | 3300005354 | Bacteria | 5465 |
| 21 | Ga0070675_100065171 | 3300005354 | Bacteria | 3012 |
| 22 | Ga0070675_100076228 | 3300005354 | Bacteria | 2789 |
| 23 | Ga0070671_100016741 | 3300005355 | Bacteria | 5927 |
| 24 | Ga0070674_100012116 | 3300005356 | Bacteria | 5284 |
| 25 | Ga0070674_100024551 | 3300005356 | Bacteria | 3914 |
| 26 | Ga0070674_100179941 | 3300005356 | Bacteria | 1619 |
| 27 | Ga0070674_100231163 | 3300005356 | Bacteria | 1443 |
| 28 | Ga0070673_100091863 | 3300005364 | Bacteria | 2482 |
| 29 | Ga0070673_100162981 | 3300005364 | Bacteria | 1897 |
| 30 | Ga0070659_100083414 | 3300005366 | Bacteria | 2554 |
| 31 | Ga0070667_100003274 | 3300005367 | Bacteria | 13837 |
| 32 | Ga0070667_100084885 | 3300005367 | Bacteria | 2715 |
| 33 | Ga0070714_100110858 | 3300005435 | Bacteria | 2430 |
| 34 | Ga0070705_100004947 | 3300005440 | Bacteria | 6490 |
| 35 | Ga0070705_100179987 | 3300005440 | Bacteria | 1431 |
| 36 | Ga0070708_100284414 | 3300005445 | Bacteria | 1557 |
| 37 | Ga0070663_100046306 | 3300005455 | Bacteria | 3077 |
| 38 | Ga0070663_100183533 | 3300005455 | Bacteria | 1624 |
| 39 | Ga0070678_100086163 | 3300005456 | Bacteria | 2395 |
| 40 | Ga0070678_100144884 | 3300005456 | Bacteria | 1905 |
| 41 | Ga0070678_100426463 | 3300005456 | Bacteria | 1157 |
| 42 | Ga0070662_100045404 | 3300005457 | Bacteria | 3152 |
| 43 | Ga0070662_100064808 | 3300005457 | Bacteria | 2676 |
| 44 | Ga0068867_100004219 | 3300005459 | Bacteria | 10113 |
| 45 | Ga0068867_100082111 | 3300005459 | Bacteria | 2431 |
| 46 | Ga0070706_100001825 | 3300005467 | Bacteria | 22059 |
| 47 | Ga0070707_100132536 | 3300005468 | Bacteria | 2424 |
| 48 | Ga0070698_100259237 | 3300005471 | Bacteria | 1671 |
| 49 | Ga0070699_100110978 | 3300005518 | Bacteria | 2408 |
| 50 | Ga0070697_100053948 | 3300005536 | Bacteria | 3267 |
| 51 | Ga0070672_100000873 | 3300005543 | Bacteria | 18042 |
| 52 | Ga0070672_100023072 | 3300005543 | Bacteria | 4582 |
| 53 | Ga0070672_100071128 | 3300005543 | Bacteria | 2766 |
| 54 | Ga0070696_100021186 | 3300005546 | Bacteria | 4407 |
| 55 | Ga0070665_100283950 | 3300005548 | Bacteria | 1657 |
| 56 | Ga0070704_100064157 | 3300005549 | Bacteria | 2639 |
| 57 | Ga0068857_100063712 | 3300005577 | Bacteria | 3277 |
| 58 | Ga0068857_100223219 | 3300005577 | Bacteria | 1721 |
| 59 | Ga0068854_100012899 | 3300005578 | Bacteria | 5473 |
| 60 | Ga0068852_100203445 | 3300005616 | Bacteria | 1875 |
| 61 | Ga0068864_100042218 | 3300005618 | Bacteria | 3902 |
| 62 | Ga0068861_100002298 | 3300005719 | Bacteria | 12417 |
| 63 | Ga0068863_100062011 | 3300005841 | Bacteria | 3536 |
| 64 | Ga0068863_100096453 | 3300005841 | Bacteria | 2807 |
| 65 | Ga0068858_100019100 | 3300005842 | Bacteria | 6411 |
| 66 | Ga0068860_100002437 | 3300005843 | Bacteria | 19541 |
| 67 | Ga0068860_100056234 | 3300005843 | Bacteria | 3741 |
| 68 | Ga0068860_100071518 | 3300005843 | Bacteria | 3296 |
| 69 | Ga0081539_10002066 | 3300005985 | Bacteria | 30089 |
| 70 | Ga0075368_10017182 | 3300006042 | Bacteria | 2705 |
| 71 | Ga0075363_100137686 | 3300006048 | Bacteria | 1373 |
| 72 | Ga0075364_10002785 | 3300006051 | Bacteria | 9828 |
| 73 | Ga0075364_10023466 | 3300006051 | Bacteria | 3905 |
| 74 | Ga0075364_10086028 | 3300006051 | Bacteria | 2082 |
| 75 | Ga0070716_100116731 | 3300006173 | Bacteria | 1664 |
| 76 | Ga0075362_10022629 | 3300006177 | Bacteria | 2650 |
| 77 | Ga0075362_10023089 | 3300006177 | Bacteria | 2627 |
| 78 | Ga0075367_10002066 | 3300006178 | Bacteria | 8992 |
| 79 | Ga0075367_10042392 | 3300006178 | Bacteria | 2663 |
| 80 | Ga0075367_10097162 | 3300006178 | Bacteria | 1797 |
| 81 | Ga0075367_10160280 | 3300006178 | Bacteria | 1399 |
| 82 | Ga0075369_10001746 | 3300006186 | Bacteria | 7534 |
| 83 | Ga0075369_10022528 | 3300006186 | Bacteria | 2598 |
| 84 | Ga0075366_10000731 | 3300006195 | Bacteria | 15629 |
| 85 | Ga0075366_10007300 | 3300006195 | Bacteria | 6097 |
| 86 | Ga0075366_10010021 | 3300006195 | Bacteria | 5310 |
| 87 | Ga0075366_10041774 | 3300006195 | Bacteria | 2715 |
| 88 | Ga0075366_10061266 | 3300006195 | Bacteria | 2236 |
| 89 | Ga0075366_10087246 | 3300006195 | Bacteria | 1867 |
| 90 | Ga0075366_10182183 | 3300006195 | Bacteria | 1276 |
| 91 | Ga0075366_10255706 | 3300006195 | Bacteria | 1069 |
| 92 | Ga0097621_100029794 | 3300006237 | Bacteria | 4314 |
| 93 | Ga0075370_10000323 | 3300006353 | Bacteria | 17249 |
| 94 | Ga0075370_10001147 | 3300006353 | Bacteria | 11127 |
| 95 | Ga0075370_10004740 | 3300006353 | Bacteria | 6649 |
| 96 | Ga0075370_10017397 | 3300006353 | Bacteria | 3885 |
| 97 | Ga0075370_10029020 | 3300006353 | Bacteria | 3079 |
| 98 | Ga0075370_10140690 | 3300006353 | Bacteria | 1410 |
| 99 | Ga0068871_100033288 | 3300006358 | Bacteria | 4081 |
| 100 | Ga0075430_100045817 | 3300006846 | Bacteria | 3693 |
| 101 | Ga0075430_100235096 | 3300006846 | Bacteria | 1519 |
| 102 | Ga0075431_100101303 | 3300006847 | Bacteria | 2972 |
| 103 | Ga0075429_100012611 | 3300006880 | Bacteria | 7328 |
| 104 | Ga0068865_100083571 | 3300006881 | Bacteria | 2298 |
| 105 | Ga0075436_100000407 | 3300006914 | Bacteria | 27718 |
| 106 | Ga0075436_100115939 | 3300006914 | Bacteria | 1871 |
| 107 | Ga0079104_1000569 | 3300006946 | Bacteria | 37494 |
| 108 | Ga0079104_1001506 | 3300006946 | Bacteria | 15478 |
| 109 | Ga0105245_10178842 | 3300009098 | Bacteria | 2025 |
| 110 | Ga0114129_10237550 | 3300009147 | Bacteria | 2451 |
| 111 | Ga0105243_10009917 | 3300009148 | Bacteria | 7243 |
| 112 | Ga0105243_10013167 | 3300009148 | Bacteria | 6252 |
| 113 | Ga0105243_10030887 | 3300009148 | Bacteria | 4128 |
| 114 | Ga0105243_10086073 | 3300009148 | Bacteria | 2577 |
| 115 | Ga0105237_10020953 | 3300009545 | Bacteria | 6730 |
| 116 | Ga0105237_10057550 | 3300009545 | Bacteria | 3890 |
| 117 | Ga0105238_10133701 | 3300009551 | Bacteria | 2458 |
| 118 | Ga0105249_10013033 | 3300009553 | Bacteria | 7337 |
| 119 | Ga0105239_10058538 | 3300010375 | Bacteria | 4228 |
| 120 | Ga0105246_10116948 | 3300011119 | Bacteria | 1969 |
| 121 | Ga0157374_10073931 | 3300013296 | Bacteria | 3217 |
| 122 | Ga0163162_10005334 | 3300013306 | Bacteria | 12405 |
| 123 | Ga0163162_10305189 | 3300013306 | Bacteria | 1724 |
| 124 | Ga0163162_10401601 | 3300013306 | Bacteria | 1503 |
| 125 | Ga0157375_10001965 | 3300013308 | Bacteria | 17723 |
| 126 | Ga0163163_10375632 | 3300014325 | Bacteria | 1479 |
| 127 | Ga0157380_10007184 | 3300014326 | Bacteria | 7893 |
| 128 | Ga0157379_10031441 | 3300014968 | Bacteria | 4729 |
| 129 | Ga0157379_10035370 | 3300014968 | Bacteria | 4453 |
| 130 | Ga0157376_10508943 | 3300014969 | Bacteria | 1185 |
| 131 | Ga0207425_1009101 | 3300025245 | Bacteria | 2493 |
| 132 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 133 | Ga0209673_1007003 | 3300025273 | Bacteria | 5308 |
| 134 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 135 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 136 | Ga0209758_1000226 | 3300025297 | Bacteria | 120484 |
| 137 | Ga0209050_1000266 | 3300025298 | Bacteria | 111792 |
| 138 | Ga0209050_1002658 | 3300025298 | Bacteria | 14615 |
| 139 | Ga0209050_1008586 | 3300025298 | Bacteria | 5413 |
| 140 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 141 | Ga0209051_1000247 | 3300025303 | Bacteria | 91122 |
| 142 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 143 | Ga0207682_10018703 | 3300025893 | Bacteria | 2709 |
| 144 | Ga0207642_10174335 | 3300025899 | Bacteria | 1166 |
| 145 | Ga0207645_10009923 | 3300025907 | Bacteria | 6559 |
| 146 | Ga0207645_10010384 | 3300025907 | Bacteria | 6392 |
| 147 | Ga0207645_10222380 | 3300025907 | Bacteria | 1245 |
| 148 | Ga0207671_10011567 | 3300025914 | Bacteria | 7166 |
| 149 | Ga0207662_10035767 | 3300025918 | Bacteria | 2902 |
| 150 | Ga0207694_10047494 | 3300025924 | Bacteria | 3321 |
| 151 | Ga0207650_10029980 | 3300025925 | Bacteria | 3915 |
| 152 | Ga0207650_10053901 | 3300025925 | Bacteria | 2982 |
| 153 | Ga0207659_10022831 | 3300025926 | Bacteria | 4170 |
| 154 | Ga0207659_10069855 | 3300025926 | Bacteria | 2560 |
| 155 | Ga0207659_10118526 | 3300025926 | Bacteria | 2025 |
| 156 | Ga0207687_10200930 | 3300025927 | Bacteria | 1558 |
| 157 | Ga0207644_10014556 | 3300025931 | Bacteria | 5264 |
| 158 | Ga0207644_10054789 | 3300025931 | Bacteria | 2873 |
| 159 | Ga0207690_10401500 | 3300025932 | Bacteria | 1093 |
| 160 | Ga0207706_10011662 | 3300025933 | Bacteria | 8013 |
| 161 | Ga0207706_10091267 | 3300025933 | Bacteria | 2678 |
| 162 | Ga0207709_10001737 | 3300025935 | Bacteria | 14677 |
| 163 | Ga0207709_10010795 | 3300025935 | Bacteria | 5029 |
| 164 | Ga0207709_10042497 | 3300025935 | Bacteria | 2735 |
| 165 | Ga0207669_10001772 | 3300025937 | Bacteria | 9158 |
| 166 | Ga0207669_10108466 | 3300025937 | Bacteria | 1854 |
| 167 | Ga0207669_10195280 | 3300025937 | Bacteria | 1464 |
| 168 | Ga0207704_10074062 | 3300025938 | Bacteria | 2171 |
| 169 | Ga0207691_10083335 | 3300025940 | Bacteria | 2871 |
| 170 | Ga0207691_10105128 | 3300025940 | Bacteria | 2515 |
| 171 | Ga0207691_10118103 | 3300025940 | Bacteria | 2353 |
| 172 | Ga0207711_10024196 | 3300025941 | Bacteria | 5084 |
| 173 | Ga0207689_10004154 | 3300025942 | Bacteria | 13165 |
| 174 | Ga0207661_10126544 | 3300025944 | Bacteria | 2183 |
| 175 | Ga0207679_10045088 | 3300025945 | Bacteria | 3187 |
| 176 | Ga0207679_10362083 | 3300025945 | Bacteria | 1267 |
| 177 | Ga0207668_10010323 | 3300025972 | Bacteria | 5642 |
| 178 | Ga0207640_10005134 | 3300025981 | Bacteria | 7121 |
| 179 | Ga0207658_10067889 | 3300025986 | Bacteria | 2688 |
| 180 | Ga0207703_10001561 | 3300026035 | Bacteria | 20760 |
| 181 | Ga0207639_10254374 | 3300026041 | Bacteria | 1533 |
| 182 | Ga0207678_10063031 | 3300026067 | Bacteria | 3186 |
| 183 | Ga0207708_10006187 | 3300026075 | Bacteria | 8870 |
| 184 | Ga0207641_10008411 | 3300026088 | Bacteria | 8527 |
| 185 | Ga0207648_10005645 | 3300026089 | Bacteria | 12562 |
| 186 | Ga0207648_10017778 | 3300026089 | Bacteria | 6456 |
| 187 | Ga0207676_10038070 | 3300026095 | Bacteria | 3669 |
| 188 | Ga0207674_10099442 | 3300026116 | Bacteria | 2891 |
| 189 | Ga0207674_10142323 | 3300026116 | Bacteria | 2358 |
| 190 | Ga0207675_100004823 | 3300026118 | Bacteria | 12985 |
| 191 | Ga0207683_10058080 | 3300026121 | Bacteria | 3397 |
| 192 | Ga0207683_10158562 | 3300026121 | Bacteria | 2044 |
| 193 | Ga0207698_10076321 | 3300026142 | Bacteria | 2682 |
| 194 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 195 | Ga0209281_1000395 | 3300027111 | Bacteria | 67983 |
| 196 | Ga0209970_1001402 | 3300027614 | Bacteria | 4206 |
| 197 | Ga0209974_10007899 | 3300027876 | Bacteria | 3651 |
| 198 | Ga0268266_10051320 | 3300028379 | Bacteria | 3540 |
| 199 | Ga0268266_10489003 | 3300028379 | Bacteria | 1174 |
| 200 | Ga0268264_10018727 | 3300028381 | Bacteria | 5662 |
| 201 | Ga0268264_10027660 | 3300028381 | Bacteria | 4635 |
| 202 | Ga0307517_10024101 | 3300028786 | Bacteria | 7522 |
| 203 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 204 | Ga0307515_10000824 | 3300028794 | Bacteria | 71229 |
| 205 | Ga0307515_10010044 | 3300028794 | Bacteria | 18205 |
| 206 | Ga0307515_10103415 | 3300028794 | Bacteria | 3414 |
| 207 | Ga0307515_10295877 | 3300028794 | Bacteria | 1309 |
| 208 | Ga0307512_10026527 | 3300030522 | Bacteria | 5116 |
| 209 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 210 | Ga0307513_10008272 | 3300031456 | Bacteria | 13341 |
| 211 | Ga0307513_10028655 | 3300031456 | Bacteria | 6361 |
| 212 | Ga0307513_10083145 | 3300031456 | Bacteria | 3293 |
| 213 | Ga0307513_10165663 | 3300031456 | Bacteria | 2095 |
| 214 | Ga0307513_10203274 | 3300031456 | Bacteria | 1819 |
| 215 | Ga0307408_100077391 | 3300031548 | Bacteria | 2477 |
| 216 | Ga0307508_10000043 | 3300031616 | Bacteria | 143889 |
| 217 | Ga0307508_10001494 | 3300031616 | Bacteria | 26240 |
| 218 | Ga0307514_10023994 | 3300031649 | Bacteria | 4942 |
| 219 | Ga0307516_10099582 | 3300031730 | Bacteria | 2723 |
| 220 | Ga0307516_10158376 | 3300031730 | Bacteria | 2017 |
| 221 | Ga0307516_10254449 | 3300031730 | Bacteria | 1449 |
| 222 | Ga0307405_10006965 | 3300031731 | Bacteria | 5614 |
| 223 | Ga0307405_10043336 | 3300031731 | Bacteria | 2745 |
| 224 | Ga0307405_10348658 | 3300031731 | Bacteria | 1141 |
| 225 | Ga0307410_10024769 | 3300031852 | Bacteria | 3754 |
| 226 | Ga0307410_10049786 | 3300031852 | Bacteria | 2814 |
| 227 | Ga0307406_10003882 | 3300031901 | Bacteria | 8142 |
| 228 | Ga0307407_10319314 | 3300031903 | Bacteria | 1089 |
| 229 | Ga0307412_10023699 | 3300031911 | Bacteria | 3780 |
| 230 | Ga0307412_10076021 | 3300031911 | Bacteria | 2306 |
| 231 | Ga0307409_100004771 | 3300031995 | Bacteria | 7684 |
| 232 | Ga0307416_100009133 | 3300032002 | Bacteria | 6464 |
| 233 | Ga0307416_100631056 | 3300032002 | Bacteria | 1154 |
| 234 | Ga0307414_10075739 | 3300032004 | Bacteria | 2443 |
| 235 | Ga0307411_10018592 | 3300032005 | Bacteria | 3991 |
| 236 | Ga0307411_10139574 | 3300032005 | Bacteria | 1785 |
| 237 | Ga0307415_100045257 | 3300032126 | Bacteria | 2949 |
| 238 | Ga0373937_0273825 | 3300036401 | Bacteria | 1594 |
| 239 | Ga0395898_0363005 | 3300037466 | Bacteria | 1381 |
| 240 | Ga0395905_0008319 | 3300037471 | Bacteria | 10234 |
| 241 | Ga0395905_0011387 | 3300037471 | Bacteria | 8594 |
| 242 | Ga0395905_0015349 | 3300037471 | Bacteria | 7281 |
| 243 | Ga0395905_0085110 | 3300037471 | Bacteria | 2963 |
| 244 | Ga0395905_0209648 | 3300037471 | Bacteria | 1825 |
| 245 | Ga0451839_1501674 | 3300041496 | Bacteria | 2088 |
| 246 | Ga0439431_0005875 | 3300041997 | Bacteria | 2712 |
| 247 | Ga0439441_008313 | 3300042001 | Bacteria | 1692 |
| 248 | Ga0439449_0021723 | 3300042007 | Bacteria | 2403 |
| 249 | Ga0439455_0023581 | 3300042012 | Bacteria | 1482 |
| 250 | Ga0439455_0032509 | 3300042012 | Bacteria | 1305 |
| 251 | Ga0450911_001584 | 3300042115 | Bacteria | 5132 |
| 252 | Ga0450919_000192 | 3300042121 | Bacteria | 6658 |
| 253 | Ga0439446_0030782 | 3300042156 | Bacteria | 1552 |
| 254 | Ga0439459_0025105 | 3300042438 | Bacteria | 1174 |
| 255 | Ga0450918_000037 | 3300042531 | Bacteria | 26554 |
| 256 | Ga0451577_0016289 | 3300042876 | Bacteria | 6887 |
| 257 | Ga0451577_0149250 | 3300042876 | Bacteria | 2103 |
| 258 | Ga0453684_0007496 | 3300044712 | Bacteria | 20017 |
| 259 | Ga0451576_0220873 | 3300045051 | Bacteria | 1978 |
| 260 | Ga0495638_0029735 | 3300046460 | Bacteria | 3523 |
| 261 | Ga0495650_0013279 | 3300046471 | Bacteria | 4366 |
| 262 | Ga0495650_0107468 | 3300046471 | Bacteria | 1040 |
| 263 | Ga0495610_0054948 | 3300046512 | Bacteria | 1922 |
| 264 | Ga0495610_0116277 | 3300046512 | Bacteria | 1178 |
| 265 | Ga0495620_0099098 | 3300046515 | Bacteria | 1163 |
| 266 | Ga0495632_0028132 | 3300046519 | Bacteria | 2936 |
| 267 | Ga0495643_0134032 | 3300046522 | Bacteria | 1241 |
| 268 | Ga0495597_0116794 | 3300046542 | Bacteria | 1115 |
| 269 | Ga0495625_0001729 | 3300046660 | Bacteria | 25319 |
| 270 | Ga0495625_0056474 | 3300046660 | Bacteria | 2794 |
| 271 | Ga0495625_0232988 | 3300046660 | Bacteria | 1202 |
| 272 | Ga0495649_0000541 | 3300046694 | Bacteria | 32077 |
| 273 | Ga0495660_0047112 | 3300046810 | Bacteria | 2362 |
| 274 | Ga0495687_000174 | 3300047443 | Bacteria | 95031 |
| 275 | Ga0495687_013171 | 3300047443 | Bacteria | 4329 |
| 276 | Ga0496102_0025442 | 3300048905 | Bacteria | 5269 |
| 277 | Ga0496108_0016352 | 3300048911 | Bacteria | 6051 |
| 278 | Ga0496108_0348460 | 3300048911 | Bacteria | 1292 |
| 279 | Ga0496109_0081037 | 3300048912 | Bacteria | 2991 |
| 280 | Ga0496114_0006230 | 3300048917 | Bacteria | 9390 |
| 281 | Ga0496114_0081482 | 3300048917 | Bacteria | 2734 |
| 282 | Ga0496121_0006539 | 3300048924 | Bacteria | 14404 |
| 283 | Ga0496124_0050836 | 3300048927 | Bacteria | 3529 |
| 284 | Ga0496125_0003980 | 3300048928 | Bacteria | 17384 |
| 285 | Ga0496125_0064800 | 3300048928 | Bacteria | 2900 |
| 286 | Ga0496126_0175505 | 3300048929 | Bacteria | 1823 |
| 287 | Ga0501036_0231378 | 3300049572 | Bacteria | 1551 |
| 288 | Ga0501076_0499036 | 3300049592 | Bacteria | 1003 |
| 289 | Ga0501081_0197708 | 3300049743 | Bacteria | 1458 |
| 290 | Ga0501265_003825 | 3300049762 | Bacteria | 1709 |
| 291 | Ga0501266_000871 | 3300049763 | Bacteria | 3931 |
| 292 | Ga0501035_0380673 | 3300049822 | Bacteria | 1177 |
| 293 | nmdc:mga03683_5161_c1 | 3300050489 | Bacteria | 4391 |
| 294 | nmdc:mga03n38_81187_c1 | 3300050490 | Bacteria | 1524 |
| 295 | nmdc:mga00v17_21340_c1 | 3300050491 | Bacteria | 3722 |
| 296 | nmdc:mga00v17_329699_c1 | 3300050491 | Bacteria | 992 |
| 297 | nmdc:mga0yw44_158685_c1 | 3300050492 | Bacteria | 1480 |
| 298 | nmdc:mga0k408_108937_c1 | 3300050493 | Bacteria | 1637 |
| 299 | nmdc:mga0k408_1264_c1 | 3300050493 | Bacteria | 13764 |
| 300 | nmdc:mga0k408_27755_c1 | 3300050493 | Bacteria | 3216 |
| 301 | nmdc:mga0k408_28936_c1 | 3300050493 | Bacteria | 3152 |
| 302 | nmdc:mga0k408_5135_c1 | 3300050493 | Bacteria | 3674 |
| 303 | nmdc:mga0k408_9816_c1 | 3300050493 | Bacteria | 5170 |
| 304 | nmdc:mga06z11_28884_c1 | 3300050494 | Bacteria | 2665 |
| 305 | nmdc:mga06z11_28979_c1 | 3300050494 | Bacteria | 2662 |
| 306 | nmdc:mga06z11_45715_c1 | 3300050494 | Bacteria | 2215 |
| 307 | nmdc:mga06z11_80349_c1 | 3300050494 | Bacteria | 1748 |
| 308 | nmdc:mga04h51_17190_c1 | 3300050495 | Bacteria | 2112 |
| 309 | nmdc:mga07m45_145088_c1 | 3300050496 | Bacteria | 1376 |
| 310 | nmdc:mga07m45_19535_c1 | 3300050496 | Bacteria | 3673 |
| 311 | nmdc:mga07m45_293016_c1 | 3300050496 | Bacteria | 947 |
| 312 | nmdc:mga07m45_309_c1 | 3300050496 | Bacteria | 19711 |
| 313 | nmdc:mga07m45_4827_c1 | 3300050496 | Bacteria | 6630 |
| 314 | nmdc:mga07m45_70848_c1 | 3300050496 | Bacteria | 1983 |
| 315 | nmdc:mga07m45_8282_c1 | 3300050496 | Bacteria | 5335 |
| 316 | nmdc:mga05p37_286272_c1 | 3300050507 | Bacteria | 1963 |
| 317 | nmdc:mga09592_50920_c1 | 3300050508 | Bacteria | 3493 |
| 318 | nmdc:mga0qj67_213704_c1 | 3300050509 | Bacteria | 1566 |
| 319 | nmdc:mga0qj67_49483_c1 | 3300050509 | Bacteria | 3322 |
| 320 | nmdc:mga08x19_76150_c1 | 3300050514 | Bacteria | 2195 |
| 321 | nmdc:mga0sz30_6027_c1 | 3300050516 | Bacteria | 4479 |
| 322 | Ga0500578_0000104 | 3300053086 | Bacteria | 98802 |
| 323 | Ga0500646_0012091 | 3300053090 | Bacteria | 2226 |
| 324 | Ga0500651_0077293 | 3300053093 | Bacteria | 2065 |
| 325 | Ga0500641_0046808 | 3300053096 | Bacteria | 1767 |
| 326 | Ga0500641_0065866 | 3300053096 | Bacteria | 1516 |
| 327 | Ga0500650_0073259 | 3300053098 | Bacteria | 1601 |
| 328 | Ga0500655_009500 | 3300053133 | Bacteria | 1755 |
| 329 | Ga0500568_0017764 | 3300053139 | Bacteria | 3131 |
| 330 | Ga0500577_0026637 | 3300053142 | Bacteria | 1971 |
| 331 | Ga0500604_0030498 | 3300053151 | Bacteria | 1577 |
| 332 | Ga0500622_0000081 | 3300053156 | Bacteria | 102191 |
| 333 | Ga0500587_005677 | 3300053739 | Bacteria | 1670 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0499036 | Ga0501076_0499036_195_977 | 258 |
| 2 | 3300053096 | Ga0500641_0065866 | Ga0500641_0065866_637_1503 | 286 |
| 3 | 3300046471 | Ga0495650_0107468 | Ga0495650_0107468_151_1020 | 288 |
| 4 | 3300050496 | nmdc:mga07m45_293016_c1 | nmdc:mga07m45_293016_c1_67_933 | 288 |
| 5 | 3300028379 | Ga0268266_10489003 | Ga0268266_104890032 | 291 |
| 6 | 3300005985 | Ga0081539_10002066 | Ga0081539_1000206630 | 292 |
| 7 | 3300042876 | Ga0451577_0149250 | Ga0451577_0149250_1083_2075 | 293 |
| 8 | 3300005440 | Ga0070705_100179987 | Ga0070705_1001799872 | 298 |
| 9 | 3300031731 | Ga0307405_10348658 | Ga0307405_103486582 | 299 |
| 10 | 3300050491 | nmdc:mga00v17_329699_c1 | nmdc:mga00v17_329699_c1_30_971 | 300 |
| 11 | 3300005435 | Ga0070714_100110858 | Ga0070714_1001108582 | 301 |
| 12 | 3300048924 | Ga0496121_0006539 | Ga0496121_0006539_12472_13443 | 301 |
| 13 | 3300048928 | Ga0496125_0064800 | Ga0496125_0064800_651_1622 | 301 |
| 14 | 3300042012 | Ga0439455_0032509 | Ga0439455_0032509_25_939 | 303 |
| 15 | 3300049743 | Ga0501081_0197708 | Ga0501081_0197708_349_1305 | 303 |
| 16 | 3300042007 | Ga0439449_0021723 | Ga0439449_0021723_984_1970 | 304 |
| 17 | 3300005456 | Ga0070678_100426463 | Ga0070678_1004264631 | 305 |
| 18 | 3300050496 | nmdc:mga07m45_8282_c1 | nmdc:mga07m45_8282_c1_2210_3184 | 305 |
| 19 | 3300046471 | Ga0495650_0013279 | Ga0495650_0013279_2858_3838 | 308 |
| 20 | 3300006846 | Ga0075430_100235096 | Ga0075430_1002350962 | 310 |
| 21 | 3300006880 | Ga0075429_100012611 | Ga0075429_1000126113 | 310 |
| 22 | 3300009147 | Ga0114129_10237550 | Ga0114129_102375502 | 310 |
| 23 | 3300025933 | Ga0207706_10091267 | Ga0207706_100912672 | 310 |
| 24 | 3300050507 | nmdc:mga05p37_286272_c1 | nmdc:mga05p37_286272_c1_413_1360 | 310 |
| 25 | 3300050508 | nmdc:mga09592_50920_c1 | nmdc:mga09592_50920_c1_709_1686 | 310 |
| 26 | 3300050509 | nmdc:mga0qj67_213704_c1 | nmdc:mga0qj67_213704_c1_334_1311 | 310 |
| 27 | 3300005328 | Ga0070676_10021421 | Ga0070676_100214212 | 311 |
| 28 | 3300005354 | Ga0070675_100019069 | Ga0070675_1000190693 | 311 |
| 29 | 3300005440 | Ga0070705_100004947 | Ga0070705_1000049474 | 311 |
| 30 | 3300005536 | Ga0070697_100053948 | Ga0070697_1000539482 | 311 |
| 31 | 3300005543 | Ga0070672_100071128 | Ga0070672_1000711283 | 311 |
| 32 | 3300005546 | Ga0070696_100021186 | Ga0070696_1000211862 | 311 |
| 33 | 3300005549 | Ga0070704_100064157 | Ga0070704_1000641573 | 311 |
| 34 | 3300005577 | Ga0068857_100223219 | Ga0068857_1002232192 | 311 |
| 35 | 3300006173 | Ga0070716_100116731 | Ga0070716_1001167312 | 311 |
| 36 | 3300006846 | Ga0075430_100045817 | Ga0075430_1000458172 | 311 |
| 37 | 3300006847 | Ga0075431_100101303 | Ga0075431_1001013032 | 311 |
| 38 | 3300006914 | Ga0075436_100000407 | Ga0075436_1000004074 | 311 |
| 39 | 3300006914 | Ga0075436_100115939 | Ga0075436_1001159392 | 311 |
| 40 | 3300009098 | Ga0105245_10178842 | Ga0105245_101788422 | 311 |
| 41 | 3300009551 | Ga0105238_10133701 | Ga0105238_101337012 | 311 |
| 42 | 3300011119 | Ga0105246_10116948 | Ga0105246_101169482 | 311 |
| 43 | 3300013306 | Ga0163162_10305189 | Ga0163162_103051891 | 311 |
| 44 | 3300014325 | Ga0163163_10375632 | Ga0163163_103756322 | 311 |
| 45 | 3300025298 | Ga0209050_1000266 | Ga0209050_100026686 | 311 |
| 46 | 3300025907 | Ga0207645_10009923 | Ga0207645_100099234 | 311 |
| 47 | 3300025924 | Ga0207694_10047494 | Ga0207694_100474942 | 311 |
| 48 | 3300025926 | Ga0207659_10069855 | Ga0207659_100698552 | 311 |
| 49 | 3300025927 | Ga0207687_10200930 | Ga0207687_102009302 | 311 |
| 50 | 3300025931 | Ga0207644_10054789 | Ga0207644_100547892 | 311 |
| 51 | 3300025940 | Ga0207691_10083335 | Ga0207691_100833351 | 311 |
| 52 | 3300025940 | Ga0207691_10105128 | Ga0207691_101051283 | 311 |
| 53 | 3300026116 | Ga0207674_10099442 | Ga0207674_100994422 | 311 |
| 54 | 3300050509 | nmdc:mga0qj67_49483_c1 | nmdc:mga0qj67_49483_c1_567_1514 | 311 |
| 55 | 3300050514 | nmdc:mga08x19_76150_c1 | nmdc:mga08x19_76150_c1_70_1026 | 311 |
| 56 | 3300003215 | JGI25153J46596_10014835 | JGI25153J46596_100148352 | 312 |
| 57 | 3300005262 | Ga0065165_1002369 | Ga0065165_100236912 | 312 |
| 58 | 3300005355 | Ga0070671_100016741 | Ga0070671_1000167412 | 312 |
| 59 | 3300005456 | Ga0070678_100144884 | Ga0070678_1001448841 | 312 |
| 60 | 3300005616 | Ga0068852_100203445 | Ga0068852_1002034452 | 312 |
| 61 | 3300006048 | Ga0075363_100137686 | Ga0075363_1001376862 | 312 |
| 62 | 3300006195 | Ga0075366_10061266 | Ga0075366_100612662 | 312 |
| 63 | 3300006237 | Ga0097621_100029794 | Ga0097621_1000297942 | 312 |
| 64 | 3300006353 | Ga0075370_10029020 | Ga0075370_100290202 | 312 |
| 65 | 3300006358 | Ga0068871_100033288 | Ga0068871_1000332882 | 312 |
| 66 | 3300013296 | Ga0157374_10073931 | Ga0157374_100739311 | 312 |
| 67 | 3300025273 | Ga0209673_1007003 | Ga0209673_10070035 | 312 |
| 68 | 3300025297 | Ga0209758_1000226 | Ga0209758_1000226103 | 312 |
| 69 | 3300025931 | Ga0207644_10014556 | Ga0207644_100145562 | 312 |
| 70 | 3300025941 | Ga0207711_10024196 | Ga0207711_100241967 | 312 |
| 71 | 3300026121 | Ga0207683_10158562 | Ga0207683_101585623 | 312 |
| 72 | 3300028786 | Ga0307517_10024101 | Ga0307517_100241012 | 312 |
| 73 | 3300031456 | Ga0307513_10028655 | Ga0307513_100286557 | 312 |
| 74 | 3300031456 | Ga0307513_10165663 | Ga0307513_101656632 | 312 |
| 75 | 3300031730 | Ga0307516_10158376 | Ga0307516_101583762 | 312 |
| 76 | 3300046460 | Ga0495638_0029735 | Ga0495638_0029735_686_1672 | 312 |
| 77 | 3300048911 | Ga0496108_0348460 | Ga0496108_0348460_124_1146 | 312 |
| 78 | 3300050493 | nmdc:mga0k408_27755_c1 | nmdc:mga0k408_27755_c1_885_1871 | 312 |
| 79 | 3300050496 | nmdc:mga07m45_70848_c1 | nmdc:mga07m45_70848_c1_430_1416 | 312 |
| 80 | 3300053086 | Ga0500578_0000104 | Ga0500578_0000104_78164_79150 | 312 |
| 81 | 3300053090 | Ga0500646_0012091 | Ga0500646_0012091_263_1249 | 312 |
| 82 | 3300053093 | Ga0500651_0077293 | Ga0500651_0077293_328_1314 | 312 |
| 83 | 3300053098 | Ga0500650_0073259 | Ga0500650_0073259_189_1175 | 312 |
| 84 | 3300053133 | Ga0500655_009500 | Ga0500655_009500_266_1252 | 312 |
| 85 | 3300053142 | Ga0500577_0026637 | Ga0500577_0026637_735_1721 | 312 |
| 86 | 3300053151 | Ga0500604_0030498 | Ga0500604_0030498_291_1277 | 312 |
| 87 | 3300053156 | Ga0500622_0000081 | Ga0500622_0000081_72518_73504 | 312 |
| 88 | 3300005518 | Ga0070699_100110978 | Ga0070699_1001109783 | 313 |
| 89 | 3300005548 | Ga0070665_100283950 | Ga0070665_1002839502 | 313 |
| 90 | 3300006195 | Ga0075366_10182183 | Ga0075366_101821832 | 313 |
| 91 | 3300013306 | Ga0163162_10401601 | Ga0163162_104016011 | 313 |
| 92 | 3300028379 | Ga0268266_10051320 | Ga0268266_100513202 | 313 |
| 93 | 3300050489 | nmdc:mga03683_5161_c1 | nmdc:mga03683_5161_c1_335_1372 | 313 |
| 94 | 3300050493 | nmdc:mga0k408_5135_c1 | nmdc:mga0k408_5135_c1_2010_3047 | 313 |
| 95 | 3300050494 | nmdc:mga06z11_80349_c1 | nmdc:mga06z11_80349_c1_382_1419 | 313 |
| 96 | 3300050495 | nmdc:mga04h51_17190_c1 | nmdc:mga04h51_17190_c1_456_1493 | 313 |
| 97 | 3300005356 | Ga0070674_100231163 | Ga0070674_1002311632 | 314 |
| 98 | 3300006195 | Ga0075366_10087246 | Ga0075366_100872462 | 314 |
| 99 | 3300006353 | Ga0075370_10140690 | Ga0075370_101406902 | 314 |
| 100 | 3300014969 | Ga0157376_10508943 | Ga0157376_105089431 | 314 |
| 101 | 3300025937 | Ga0207669_10195280 | Ga0207669_101952802 | 314 |
| 102 | 3300036401 | Ga0373937_0273825 | Ga0373937_0273825_212_1210 | 314 |
| 103 | 3300037471 | Ga0395905_0209648 | Ga0395905_0209648_118_1074 | 314 |
| 104 | 3300042001 | Ga0439441_008313 | Ga0439441_008313_98_1057 | 314 |
| 105 | 3300050496 | nmdc:mga07m45_19535_c1 | nmdc:mga07m45_19535_c1_93_1046 | 314 |
| 106 | 3300053096 | Ga0500641_0046808 | Ga0500641_0046808_371_1333 | 314 |
| 107 | 3300046660 | Ga0495625_0232988 | Ga0495625_0232988_126_1082 | 315 |
| 108 | 3300003323 | rootH1_10196826 | rootH1_101968262 | 316 |
| 109 | 3300005331 | Ga0070670_100290935 | Ga0070670_1002909352 | 316 |
| 110 | 3300006195 | Ga0075366_10255706 | Ga0075366_102557061 | 316 |
| 111 | 3300025925 | Ga0207650_10029980 | Ga0207650_100299803 | 316 |
| 112 | 3300027876 | Ga0209974_10007899 | Ga0209974_100078993 | 316 |
| 113 | 3300028794 | Ga0307515_10295877 | Ga0307515_102958772 | 316 |
| 114 | 3300031456 | Ga0307513_10203274 | Ga0307513_102032742 | 316 |
| 115 | 3300031548 | Ga0307408_100077391 | Ga0307408_1000773913 | 316 |
| 116 | 3300037471 | Ga0395905_0008319 | Ga0395905_0008319_6868_7878 | 316 |
| 117 | 3300042876 | Ga0451577_0016289 | Ga0451577_0016289_4958_5923 | 316 |
| 118 | 3300049572 | Ga0501036_0231378 | Ga0501036_0231378_533_1498 | 316 |
| 119 | 3300049822 | Ga0501035_0380673 | Ga0501035_0380673_200_1165 | 316 |
| 120 | 3300006178 | Ga0075367_10097162 | Ga0075367_100971622 | 317 |
| 121 | 3300031456 | Ga0307513_10000006 | Ga0307513_1000000612 | 317 |
| 122 | 3300042115 | Ga0450911_001584 | Ga0450911_001584_3625_4596 | 317 |
| 123 | 3300048927 | Ga0496124_0050836 | Ga0496124_0050836_1530_2501 | 317 |
| 124 | 3300048928 | Ga0496125_0003980 | Ga0496125_0003980_7524_8495 | 317 |
| 125 | 3300048929 | Ga0496126_0175505 | Ga0496126_0175505_130_1101 | 317 |
| 126 | 3300050490 | nmdc:mga03n38_81187_c1 | nmdc:mga03n38_81187_c1_406_1371 | 317 |
| 127 | 3300050494 | nmdc:mga06z11_28884_c1 | nmdc:mga06z11_28884_c1_729_1694 | 317 |
| 128 | iso_pu_bacteria | 2721755523 | 2722885741 | 317 |
| 129 | iso_pu_bacteria | 2839138175 | 2839138613 | 317 |
| 130 | iso_pu_bacteria | 2974320154 | 2974322083 | 317 |
| 131 | 3300006051 | Ga0075364_10002785 | Ga0075364_1000278511 | 318 |
| 132 | 3300006178 | Ga0075367_10042392 | Ga0075367_100423922 | 318 |
| 133 | 3300042438 | Ga0439459_0025105 | Ga0439459_0025105_108_1085 | 318 |
| 134 | 3300049762 | Ga0501265_003825 | Ga0501265_003825_271_1242 | 318 |
| 135 | 3300050491 | nmdc:mga00v17_21340_c1 | nmdc:mga00v17_21340_c1_1735_2706 | 318 |
| 136 | 3300050492 | nmdc:mga0yw44_158685_c1 | nmdc:mga0yw44_158685_c1_371_1342 | 318 |
| 137 | 3300050494 | nmdc:mga06z11_28979_c1 | nmdc:mga06z11_28979_c1_524_1495 | 318 |
| 138 | 3300031911 | Ga0307412_10076021 | Ga0307412_100760212 | 319 |
| 139 | 3300032005 | Ga0307411_10139574 | Ga0307411_101395742 | 319 |
| 140 | 3300045051 | Ga0451576_0220873 | Ga0451576_0220873_538_1590 | 319 |
| 141 | 3300005843 | Ga0068860_100071518 | Ga0068860_1000715182 | 320 |
| 142 | 3300006051 | Ga0075364_10086028 | Ga0075364_100860282 | 320 |
| 143 | 3300006946 | Ga0079104_1001506 | Ga0079104_10015062 | 320 |
| 144 | 3300009148 | Ga0105243_10009917 | Ga0105243_100099172 | 320 |
| 145 | 3300014968 | Ga0157379_10031441 | Ga0157379_100314414 | 320 |
| 146 | 3300025935 | Ga0207709_10001737 | Ga0207709_100017372 | 320 |
| 147 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002774 | 320 |
| 148 | 3300028381 | Ga0268264_10018727 | Ga0268264_100187274 | 320 |
| 149 | 3300037466 | Ga0395898_0363005 | Ga0395898_0363005_18_995 | 320 |
| 150 | 3300037471 | Ga0395905_0011387 | Ga0395905_0011387_4801_5778 | 320 |
| 151 | 3300037471 | Ga0395905_0015349 | Ga0395905_0015349_2349_3326 | 320 |
| 152 | 3300037471 | Ga0395905_0085110 | Ga0395905_0085110_710_1687 | 320 |
| 153 | 3300041997 | Ga0439431_0005875 | Ga0439431_0005875_94_1068 | 320 |
| 154 | 3300042156 | Ga0439446_0030782 | Ga0439446_0030782_49_1023 | 320 |
| 155 | 3300048911 | Ga0496108_0016352 | Ga0496108_0016352_1150_2181 | 320 |
| 156 | 3300048912 | Ga0496109_0081037 | Ga0496109_0081037_63_1094 | 320 |
| 157 | 3300049763 | Ga0501266_000871 | Ga0501266_000871_2235_3212 | 320 |
| 158 | 3300050493 | nmdc:mga0k408_28936_c1 | nmdc:mga0k408_28936_c1_650_1618 | 320 |
| 159 | iso_pu_bacteria | 2643221644 | 2644244799 | 320 |
| 160 | 3300005364 | Ga0070673_100091863 | Ga0070673_1000918633 | 321 |
| 161 | 3300005841 | Ga0068863_100062011 | Ga0068863_1000620113 | 321 |
| 162 | 3300013308 | Ga0157375_10001965 | Ga0157375_100019656 | 321 |
| 163 | iso_pu_bacteria | 2643221654 | 2644301156 | 321 |
| 164 | 3300003775 | Ga0055524_1000420 | Ga0055524_100042030 | 322 |
| 165 | 3300003791 | Ga0055530_10001480 | Ga0055530_100014807 | 322 |
| 166 | 3300003792 | Ga0055540_1000308 | Ga0055540_100030812 | 322 |
| 167 | 3300005262 | Ga0065165_1034655 | Ga0065165_10346552 | 322 |
| 168 | 3300006946 | Ga0079104_1000569 | Ga0079104_100056912 | 322 |
| 169 | 3300025298 | Ga0209050_1002658 | Ga0209050_10026585 | 322 |
| 170 | 3300025298 | Ga0209050_1008586 | Ga0209050_10085865 | 322 |
| 171 | 3300025299 | Ga0209256_1000049 | Ga0209256_1000049102 | 322 |
| 172 | 3300025303 | Ga0209051_1000247 | Ga0209051_100024783 | 322 |
| 173 | 3300025304 | Ga0209257_1000141 | Ga0209257_100014183 | 322 |
| 174 | 3300027111 | Ga0209281_1000395 | Ga0209281_100039512 | 322 |
| 175 | 3300048917 | Ga0496114_0006230 | Ga0496114_0006230_782_1759 | 322 |
| 176 | iso_pu_bacteria | 2585428058 | 2587732711 | 322 |
| 177 | iso_pu_bacteria | 2585428062 | 2587760138 | 322 |
| 178 | iso_pu_bacteria | 2588253510 | 2588290307 | 322 |
| 179 | iso_pu_bacteria | 2643221592 | 2643967622 | 322 |
| 180 | iso_pu_bacteria | 2643221625 | 2644140444 | 322 |
| 181 | iso_pu_bacteria | 2643221648 | 2644273411 | 322 |
| 182 | 3300005354 | Ga0070675_100065171 | Ga0070675_1000651713 | 323 |
| 183 | 3300005543 | Ga0070672_100023072 | Ga0070672_1000230724 | 323 |
| 184 | 3300006051 | Ga0075364_10023466 | Ga0075364_100234662 | 323 |
| 185 | 3300009148 | Ga0105243_10086073 | Ga0105243_100860732 | 323 |
| 186 | 3300025926 | Ga0207659_10118526 | Ga0207659_101185262 | 323 |
| 187 | 3300025940 | Ga0207691_10118103 | Ga0207691_101181032 | 323 |
| 188 | 3300042121 | Ga0450919_000192 | Ga0450919_000192_2770_3744 | 323 |
| 189 | 3300042531 | Ga0450918_000037 | Ga0450918_000037_5193_6167 | 323 |
| 190 | 3300005295 | Ga0065707_10093597 | Ga0065707_100935972 | 324 |
| 191 | 3300005367 | Ga0070667_100084885 | Ga0070667_1000848852 | 324 |
| 192 | 3300005445 | Ga0070708_100284414 | Ga0070708_1002844141 | 324 |
| 193 | 3300005467 | Ga0070706_100001825 | Ga0070706_10000182516 | 324 |
| 194 | 3300005468 | Ga0070707_100132536 | Ga0070707_1001325362 | 324 |
| 195 | 3300005471 | Ga0070698_100259237 | Ga0070698_1002592371 | 324 |
| 196 | 3300005843 | Ga0068860_100056234 | Ga0068860_1000562342 | 324 |
| 197 | 3300009545 | Ga0105237_10057550 | Ga0105237_100575504 | 324 |
| 198 | 3300025986 | Ga0207658_10067889 | Ga0207658_100678893 | 324 |
| 199 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020185 | 324 |
| 200 | 3300028794 | Ga0307515_10103415 | Ga0307515_101034152 | 324 |
| 201 | 3300031616 | Ga0307508_10001494 | Ga0307508_100014945 | 324 |
| 202 | 3300050494 | nmdc:mga06z11_45715_c1 | nmdc:mga06z11_45715_c1_1214_2197 | 324 |
| 203 | 3300006195 | Ga0075366_10041774 | Ga0075366_100417743 | 325 |
| 204 | 3300042012 | Ga0439455_0023581 | Ga0439455_0023581_359_1354 | 325 |
| 205 | 3300046512 | Ga0495610_0054948 | Ga0495610_0054948_301_1290 | 325 |
| 206 | 3300046515 | Ga0495620_0099098 | Ga0495620_0099098_115_1104 | 325 |
| 207 | 3300046660 | Ga0495625_0056474 | Ga0495625_0056474_1048_2037 | 325 |
| 208 | 3300046694 | Ga0495649_0000541 | Ga0495649_0000541_7758_8747 | 325 |
| 209 | 3300046810 | Ga0495660_0047112 | Ga0495660_0047112_1032_2021 | 325 |
| 210 | 3300047443 | Ga0495687_013171 | Ga0495687_013171_2561_3550 | 325 |
| 211 | 3300053139 | Ga0500568_0017764 | Ga0500568_0017764_984_1973 | 325 |
| 212 | 3300003322 | rootL2_10056964 | rootL2_100569641 | 326 |
| 213 | 3300005334 | Ga0068869_100027292 | Ga0068869_1000272923 | 326 |
| 214 | 3300005455 | Ga0070663_100046306 | Ga0070663_1000463064 | 326 |
| 215 | 3300005456 | Ga0070678_100086163 | Ga0070678_1000861632 | 326 |
| 216 | 3300005457 | Ga0070662_100045404 | Ga0070662_1000454043 | 326 |
| 217 | 3300005459 | Ga0068867_100082111 | Ga0068867_1000821112 | 326 |
| 218 | 3300005577 | Ga0068857_100063712 | Ga0068857_1000637124 | 326 |
| 219 | 3300005578 | Ga0068854_100012899 | Ga0068854_1000128994 | 326 |
| 220 | 3300006042 | Ga0075368_10017182 | Ga0075368_100171822 | 326 |
| 221 | 3300006177 | Ga0075362_10022629 | Ga0075362_100226292 | 326 |
| 222 | 3300006177 | Ga0075362_10023089 | Ga0075362_100230891 | 326 |
| 223 | 3300006178 | Ga0075367_10002066 | Ga0075367_100020669 | 326 |
| 224 | 3300006178 | Ga0075367_10160280 | Ga0075367_101602801 | 326 |
| 225 | 3300006186 | Ga0075369_10001746 | Ga0075369_100017462 | 326 |
| 226 | 3300006186 | Ga0075369_10022528 | Ga0075369_100225282 | 326 |
| 227 | 3300006195 | Ga0075366_10007300 | Ga0075366_100073005 | 326 |
| 228 | 3300006195 | Ga0075366_10010021 | Ga0075366_100100212 | 326 |
| 229 | 3300006353 | Ga0075370_10000323 | Ga0075370_1000032317 | 326 |
| 230 | 3300006353 | Ga0075370_10001147 | Ga0075370_1000114711 | 326 |
| 231 | 3300006353 | Ga0075370_10004740 | Ga0075370_100047405 | 326 |
| 232 | 3300006353 | Ga0075370_10017397 | Ga0075370_100173973 | 326 |
| 233 | 3300009148 | Ga0105243_10030887 | Ga0105243_100308874 | 326 |
| 234 | 3300009545 | Ga0105237_10020953 | Ga0105237_100209537 | 326 |
| 235 | 3300010375 | Ga0105239_10058538 | Ga0105239_100585384 | 326 |
| 236 | 3300025907 | Ga0207645_10222380 | Ga0207645_102223802 | 326 |
| 237 | 3300025914 | Ga0207671_10011567 | Ga0207671_100115677 | 326 |
| 238 | 3300025933 | Ga0207706_10011662 | Ga0207706_100116622 | 326 |
| 239 | 3300025935 | Ga0207709_10010795 | Ga0207709_100107952 | 326 |
| 240 | 3300025945 | Ga0207679_10362083 | Ga0207679_103620832 | 326 |
| 241 | 3300025981 | Ga0207640_10005134 | Ga0207640_100051342 | 326 |
| 242 | 3300026041 | Ga0207639_10254374 | Ga0207639_102543742 | 326 |
| 243 | 3300026067 | Ga0207678_10063031 | Ga0207678_100630312 | 326 |
| 244 | 3300026089 | Ga0207648_10017778 | Ga0207648_100177786 | 326 |
| 245 | 3300026116 | Ga0207674_10142323 | Ga0207674_101423233 | 326 |
| 246 | 3300026121 | Ga0207683_10058080 | Ga0207683_100580802 | 326 |
| 247 | 3300028794 | Ga0307515_10010044 | Ga0307515_100100447 | 326 |
| 248 | 3300031730 | Ga0307516_10099582 | Ga0307516_100995822 | 326 |
| 249 | 3300031730 | Ga0307516_10254449 | Ga0307516_102544492 | 326 |
| 250 | 3300031731 | Ga0307405_10043336 | Ga0307405_100433362 | 326 |
| 251 | 3300031852 | Ga0307410_10049786 | Ga0307410_100497863 | 326 |
| 252 | 3300032002 | Ga0307416_100009133 | Ga0307416_1000091334 | 326 |
| 253 | 3300041496 | Ga0451839_1501674 | Ga0451839_1501674_1019_2011 | 326 |
| 254 | 3300046512 | Ga0495610_0116277 | Ga0495610_0116277_148_1137 | 326 |
| 255 | 3300046519 | Ga0495632_0028132 | Ga0495632_0028132_273_1262 | 326 |
| 256 | 3300046522 | Ga0495643_0134032 | Ga0495643_0134032_185_1174 | 326 |
| 257 | 3300046542 | Ga0495597_0116794 | Ga0495597_0116794_67_1056 | 326 |
| 258 | 3300046660 | Ga0495625_0001729 | Ga0495625_0001729_180_1169 | 326 |
| 259 | 3300047443 | Ga0495687_000174 | Ga0495687_000174_86843_87889 | 326 |
| 260 | 3300048917 | Ga0496114_0081482 | Ga0496114_0081482_528_1523 | 326 |
| 261 | 3300050493 | nmdc:mga0k408_108937_c1 | nmdc:mga0k408_108937_c1_315_1307 | 326 |
| 262 | 3300050493 | nmdc:mga0k408_1264_c1 | nmdc:mga0k408_1264_c1_2485_3477 | 326 |
| 263 | 3300050493 | nmdc:mga0k408_9816_c1 | nmdc:mga0k408_9816_c1_1111_2103 | 326 |
| 264 | 3300050496 | nmdc:mga07m45_145088_c1 | nmdc:mga07m45_145088_c1_196_1233 | 326 |
| 265 | 3300050496 | nmdc:mga07m45_309_c1 | nmdc:mga07m45_309_c1_7046_8038 | 326 |
| 266 | 3300050496 | nmdc:mga07m45_4827_c1 | nmdc:mga07m45_4827_c1_4054_5073 | 326 |
| 267 | 3300050516 | nmdc:mga0sz30_6027_c1 | nmdc:mga0sz30_6027_c1_1707_2744 | 326 |
| 268 | 3300053739 | Ga0500587_005677 | Ga0500587_005677_146_1135 | 326 |
| 269 | 3300005329 | Ga0070683_100323583 | Ga0070683_1003235832 | 327 |
| 270 | 3300005331 | Ga0070670_100037992 | Ga0070670_1000379926 | 327 |
| 271 | 3300005334 | Ga0068869_100047832 | Ga0068869_1000478324 | 327 |
| 272 | 3300005335 | Ga0070666_10020325 | Ga0070666_100203256 | 327 |
| 273 | 3300005354 | Ga0070675_100076228 | Ga0070675_1000762282 | 327 |
| 274 | 3300005356 | Ga0070674_100012116 | Ga0070674_1000121163 | 327 |
| 275 | 3300005356 | Ga0070674_100179941 | Ga0070674_1001799412 | 327 |
| 276 | 3300005364 | Ga0070673_100162981 | Ga0070673_1001629812 | 327 |
| 277 | 3300005366 | Ga0070659_100083414 | Ga0070659_1000834142 | 327 |
| 278 | 3300005367 | Ga0070667_100003274 | Ga0070667_10000327411 | 327 |
| 279 | 3300005455 | Ga0070663_100183533 | Ga0070663_1001835332 | 327 |
| 280 | 3300005457 | Ga0070662_100064808 | Ga0070662_1000648082 | 327 |
| 281 | 3300005459 | Ga0068867_100004219 | Ga0068867_1000042196 | 327 |
| 282 | 3300005543 | Ga0070672_100000873 | Ga0070672_1000008739 | 327 |
| 283 | 3300005618 | Ga0068864_100042218 | Ga0068864_1000422181 | 327 |
| 284 | 3300005719 | Ga0068861_100002298 | Ga0068861_1000022982 | 327 |
| 285 | 3300005841 | Ga0068863_100096453 | Ga0068863_1000964532 | 327 |
| 286 | 3300005842 | Ga0068858_100019100 | Ga0068858_1000191008 | 327 |
| 287 | 3300005843 | Ga0068860_100002437 | Ga0068860_10000243711 | 327 |
| 288 | 3300006195 | Ga0075366_10000731 | Ga0075366_1000073115 | 327 |
| 289 | 3300006881 | Ga0068865_100083571 | Ga0068865_1000835713 | 327 |
| 290 | 3300009148 | Ga0105243_10013167 | Ga0105243_100131677 | 327 |
| 291 | 3300009553 | Ga0105249_10013033 | Ga0105249_100130332 | 327 |
| 292 | 3300013306 | Ga0163162_10005334 | Ga0163162_100053342 | 327 |
| 293 | 3300014326 | Ga0157380_10007184 | Ga0157380_100071849 | 327 |
| 294 | 3300014968 | Ga0157379_10035370 | Ga0157379_100353706 | 327 |
| 295 | 3300025893 | Ga0207682_10018703 | Ga0207682_100187032 | 327 |
| 296 | 3300025899 | Ga0207642_10174335 | Ga0207642_101743351 | 327 |
| 297 | 3300025907 | Ga0207645_10010384 | Ga0207645_100103842 | 327 |
| 298 | 3300025918 | Ga0207662_10035767 | Ga0207662_100357672 | 327 |
| 299 | 3300025926 | Ga0207659_10022831 | Ga0207659_100228312 | 327 |
| 300 | 3300025932 | Ga0207690_10401500 | Ga0207690_104015001 | 327 |
| 301 | 3300025935 | Ga0207709_10042497 | Ga0207709_100424972 | 327 |
| 302 | 3300025937 | Ga0207669_10001772 | Ga0207669_100017726 | 327 |
| 303 | 3300025937 | Ga0207669_10108466 | Ga0207669_101084662 | 327 |
| 304 | 3300025938 | Ga0207704_10074062 | Ga0207704_100740622 | 327 |
| 305 | 3300025942 | Ga0207689_10004154 | Ga0207689_1000415411 | 327 |
| 306 | 3300025944 | Ga0207661_10126544 | Ga0207661_101265442 | 327 |
| 307 | 3300025945 | Ga0207679_10045088 | Ga0207679_100450882 | 327 |
| 308 | 3300025972 | Ga0207668_10010323 | Ga0207668_100103232 | 327 |
| 309 | 3300026035 | Ga0207703_10001561 | Ga0207703_100015617 | 327 |
| 310 | 3300026075 | Ga0207708_10006187 | Ga0207708_1000618710 | 327 |
| 311 | 3300026088 | Ga0207641_10008411 | Ga0207641_1000841110 | 327 |
| 312 | 3300026089 | Ga0207648_10005645 | Ga0207648_100056452 | 327 |
| 313 | 3300026095 | Ga0207676_10038070 | Ga0207676_100380702 | 327 |
| 314 | 3300026118 | Ga0207675_100004823 | Ga0207675_10000482311 | 327 |
| 315 | 3300026142 | Ga0207698_10076321 | Ga0207698_100763213 | 327 |
| 316 | 3300027614 | Ga0209970_1001402 | Ga0209970_10014023 | 327 |
| 317 | 3300028381 | Ga0268264_10027660 | Ga0268264_100276603 | 327 |
| 318 | 3300028794 | Ga0307515_10000824 | Ga0307515_1000082425 | 327 |
| 319 | 3300030522 | Ga0307512_10026527 | Ga0307512_100265276 | 327 |
| 320 | 3300031456 | Ga0307513_10008272 | Ga0307513_100082726 | 327 |
| 321 | 3300031456 | Ga0307513_10083145 | Ga0307513_100831452 | 327 |
| 322 | 3300031616 | Ga0307508_10000043 | Ga0307508_100000432 | 327 |
| 323 | 3300031649 | Ga0307514_10023994 | Ga0307514_100239942 | 327 |
| 324 | 3300048905 | Ga0496102_0025442 | Ga0496102_0025442_869_1861 | 327 |
| 325 | 3300005356 | Ga0070674_100024551 | Ga0070674_1000245513 | 328 |
| 326 | 3300025925 | Ga0207650_10053901 | Ga0207650_100539012 | 328 |
| 327 | 3300031731 | Ga0307405_10006965 | Ga0307405_100069655 | 328 |
| 328 | 3300031852 | Ga0307410_10024769 | Ga0307410_100247692 | 328 |
| 329 | 3300031901 | Ga0307406_10003882 | Ga0307406_100038826 | 328 |
| 330 | 3300031903 | Ga0307407_10319314 | Ga0307407_103193141 | 328 |
| 331 | 3300031911 | Ga0307412_10023699 | Ga0307412_100236992 | 328 |
| 332 | 3300031995 | Ga0307409_100004771 | Ga0307409_1000047717 | 328 |
| 333 | 3300032002 | Ga0307416_100631056 | Ga0307416_1006310561 | 328 |
| 334 | 3300032004 | Ga0307414_10075739 | Ga0307414_100757392 | 328 |
| 335 | 3300032005 | Ga0307411_10018592 | Ga0307411_100185922 | 328 |
| 336 | 3300032126 | Ga0307415_100045257 | Ga0307415_1000452572 | 328 |
| 337 | 3300005353 | Ga0070669_100167574 | Ga0070669_1001675742 | 329 |
| 338 | 3300044712 | Ga0453684_0007496 | Ga0453684_0007496_15545_16558 | 329 |
| 339 | 3300003215 | JGI25153J46596_10000973 | JGI25153J46596_1000097314 | 330 |
| 340 | 3300003771 | Ga0055526_1001927 | Ga0055526_10019277 | 330 |
| 341 | 3300025245 | Ga0207425_1009101 | Ga0207425_10091013 | 330 |
| 342 | 3300025258 | Ga0209129_1000035 | Ga0209129_100003556 | 330 |
| 343 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024250 | 330 |
| 344 | 3300025297 | Ga0209758_1000066 | Ga0209758_1000066262 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9562 | 36 | 328 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9428 | 36 | 330 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9417 | 36 | 328 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9348 | 36 | 322 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9345 | 36 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9306 | 135 | 255 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.919 | 135 | 255 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9159 | 135 | 255 | 3.40.190.10 |
| 2f5xC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9138 | 36 | 328 | 3.40.190.150 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9073 | 36 | 330 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A807DXQ0-F1-model_v4 | deleted | 0.9697 | 23 | 330 |
|
| AF-A0A1F3ZG10-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9657 | 30 | 330 |
|
| AF-A0A1F4DA25-F1-model_v4 | LacI family transcriptional regulator | 0.9643 | 26 | 330 |
|
| AF-A0A1H8LZS6-F1-model_v4 | Tripartite-type tricarboxylate transporter, receptor component TctC | 0.9577 | 30 | 330 |
|
| AF-A0A4Z0BRZ8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein BugE | 0.957 | 29 | 330 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar