F416120

General Info

Members Datasets Scaffolds Average Seq Length
344 220 333 325

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_000174|Ga0495687_000174_86843_87889
Length 348
Sequence MHTRLAKFQTTTIPKDPSMTTRLRTALRRRGLLLGGAALVLPLALPPLAHAQAFPAKPITLIVPWPAGGSTDRHLRALAEIASKNLGQIITVDNRPGGGGTTGPGTMALTARPDGYTIAQYPMGMLRVPHMQKVQWDPLKDFTFIIGVSGYTFGFTVRSDSPYKTFNDYVEAARKEPGKIDYGSTGIGTSPHLLMEELAGNARIALNHVPFKGNADLTQALLGGHVMAMSDATGWDKFVDGGQMRLLVTFGEQRTRRWPNVPTAKDLGYNVVATSPYGFVGPKGMDPAVVKTLHDAFKKAMDDPKHLEVLAQLNQDLWYRSGDDYAKWARETYAKDKALIERLGLAAK

Samples

Sample ID Description Type Environment
1 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2721755523 Delftia sp. HK171 Isolate Unclassified
10 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
11 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
164 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
165 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
215 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.13
Nodule 1.16
Rhizoplane 1.74
Rhizosphere 63.08
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000973 3300003215 Bacteria 17387
2 JGI25153J46596_10014835 3300003215 Bacteria 3214
3 rootL2_10056964 3300003322 Bacteria 1432
4 rootH1_10196826 3300003323 Bacteria 2121
5 Ga0055526_1001927 3300003771 Bacteria 14348
6 Ga0055524_1000420 3300003775 Bacteria 35681
7 Ga0055530_10001480 3300003791 Bacteria 17058
8 Ga0055540_1000308 3300003792 Bacteria 43457
9 Ga0065165_1002369 3300005262 Bacteria 16289
10 Ga0065165_1034655 3300005262 Bacteria 1559
11 Ga0065707_10093597 3300005295 Bacteria 3604
12 Ga0070676_10021421 3300005328 Bacteria 3619
13 Ga0070683_100323583 3300005329 Bacteria 1468
14 Ga0070670_100037992 3300005331 Bacteria 4140
15 Ga0070670_100290935 3300005331 Bacteria 1427
16 Ga0068869_100027292 3300005334 Bacteria 3980
17 Ga0068869_100047832 3300005334 Bacteria 3090
18 Ga0070666_10020325 3300005335 Bacteria 4291
19 Ga0070669_100167574 3300005353 Bacteria 1711
20 Ga0070675_100019069 3300005354 Bacteria 5465
21 Ga0070675_100065171 3300005354 Bacteria 3012
22 Ga0070675_100076228 3300005354 Bacteria 2789
23 Ga0070671_100016741 3300005355 Bacteria 5927
24 Ga0070674_100012116 3300005356 Bacteria 5284
25 Ga0070674_100024551 3300005356 Bacteria 3914
26 Ga0070674_100179941 3300005356 Bacteria 1619
27 Ga0070674_100231163 3300005356 Bacteria 1443
28 Ga0070673_100091863 3300005364 Bacteria 2482
29 Ga0070673_100162981 3300005364 Bacteria 1897
30 Ga0070659_100083414 3300005366 Bacteria 2554
31 Ga0070667_100003274 3300005367 Bacteria 13837
32 Ga0070667_100084885 3300005367 Bacteria 2715
33 Ga0070714_100110858 3300005435 Bacteria 2430
34 Ga0070705_100004947 3300005440 Bacteria 6490
35 Ga0070705_100179987 3300005440 Bacteria 1431
36 Ga0070708_100284414 3300005445 Bacteria 1557
37 Ga0070663_100046306 3300005455 Bacteria 3077
38 Ga0070663_100183533 3300005455 Bacteria 1624
39 Ga0070678_100086163 3300005456 Bacteria 2395
40 Ga0070678_100144884 3300005456 Bacteria 1905
41 Ga0070678_100426463 3300005456 Bacteria 1157
42 Ga0070662_100045404 3300005457 Bacteria 3152
43 Ga0070662_100064808 3300005457 Bacteria 2676
44 Ga0068867_100004219 3300005459 Bacteria 10113
45 Ga0068867_100082111 3300005459 Bacteria 2431
46 Ga0070706_100001825 3300005467 Bacteria 22059
47 Ga0070707_100132536 3300005468 Bacteria 2424
48 Ga0070698_100259237 3300005471 Bacteria 1671
49 Ga0070699_100110978 3300005518 Bacteria 2408
50 Ga0070697_100053948 3300005536 Bacteria 3267
51 Ga0070672_100000873 3300005543 Bacteria 18042
52 Ga0070672_100023072 3300005543 Bacteria 4582
53 Ga0070672_100071128 3300005543 Bacteria 2766
54 Ga0070696_100021186 3300005546 Bacteria 4407
55 Ga0070665_100283950 3300005548 Bacteria 1657
56 Ga0070704_100064157 3300005549 Bacteria 2639
57 Ga0068857_100063712 3300005577 Bacteria 3277
58 Ga0068857_100223219 3300005577 Bacteria 1721
59 Ga0068854_100012899 3300005578 Bacteria 5473
60 Ga0068852_100203445 3300005616 Bacteria 1875
61 Ga0068864_100042218 3300005618 Bacteria 3902
62 Ga0068861_100002298 3300005719 Bacteria 12417
63 Ga0068863_100062011 3300005841 Bacteria 3536
64 Ga0068863_100096453 3300005841 Bacteria 2807
65 Ga0068858_100019100 3300005842 Bacteria 6411
66 Ga0068860_100002437 3300005843 Bacteria 19541
67 Ga0068860_100056234 3300005843 Bacteria 3741
68 Ga0068860_100071518 3300005843 Bacteria 3296
69 Ga0081539_10002066 3300005985 Bacteria 30089
70 Ga0075368_10017182 3300006042 Bacteria 2705
71 Ga0075363_100137686 3300006048 Bacteria 1373
72 Ga0075364_10002785 3300006051 Bacteria 9828
73 Ga0075364_10023466 3300006051 Bacteria 3905
74 Ga0075364_10086028 3300006051 Bacteria 2082
75 Ga0070716_100116731 3300006173 Bacteria 1664
76 Ga0075362_10022629 3300006177 Bacteria 2650
77 Ga0075362_10023089 3300006177 Bacteria 2627
78 Ga0075367_10002066 3300006178 Bacteria 8992
79 Ga0075367_10042392 3300006178 Bacteria 2663
80 Ga0075367_10097162 3300006178 Bacteria 1797
81 Ga0075367_10160280 3300006178 Bacteria 1399
82 Ga0075369_10001746 3300006186 Bacteria 7534
83 Ga0075369_10022528 3300006186 Bacteria 2598
84 Ga0075366_10000731 3300006195 Bacteria 15629
85 Ga0075366_10007300 3300006195 Bacteria 6097
86 Ga0075366_10010021 3300006195 Bacteria 5310
87 Ga0075366_10041774 3300006195 Bacteria 2715
88 Ga0075366_10061266 3300006195 Bacteria 2236
89 Ga0075366_10087246 3300006195 Bacteria 1867
90 Ga0075366_10182183 3300006195 Bacteria 1276
91 Ga0075366_10255706 3300006195 Bacteria 1069
92 Ga0097621_100029794 3300006237 Bacteria 4314
93 Ga0075370_10000323 3300006353 Bacteria 17249
94 Ga0075370_10001147 3300006353 Bacteria 11127
95 Ga0075370_10004740 3300006353 Bacteria 6649
96 Ga0075370_10017397 3300006353 Bacteria 3885
97 Ga0075370_10029020 3300006353 Bacteria 3079
98 Ga0075370_10140690 3300006353 Bacteria 1410
99 Ga0068871_100033288 3300006358 Bacteria 4081
100 Ga0075430_100045817 3300006846 Bacteria 3693
101 Ga0075430_100235096 3300006846 Bacteria 1519
102 Ga0075431_100101303 3300006847 Bacteria 2972
103 Ga0075429_100012611 3300006880 Bacteria 7328
104 Ga0068865_100083571 3300006881 Bacteria 2298
105 Ga0075436_100000407 3300006914 Bacteria 27718
106 Ga0075436_100115939 3300006914 Bacteria 1871
107 Ga0079104_1000569 3300006946 Bacteria 37494
108 Ga0079104_1001506 3300006946 Bacteria 15478
109 Ga0105245_10178842 3300009098 Bacteria 2025
110 Ga0114129_10237550 3300009147 Bacteria 2451
111 Ga0105243_10009917 3300009148 Bacteria 7243
112 Ga0105243_10013167 3300009148 Bacteria 6252
113 Ga0105243_10030887 3300009148 Bacteria 4128
114 Ga0105243_10086073 3300009148 Bacteria 2577
115 Ga0105237_10020953 3300009545 Bacteria 6730
116 Ga0105237_10057550 3300009545 Bacteria 3890
117 Ga0105238_10133701 3300009551 Bacteria 2458
118 Ga0105249_10013033 3300009553 Bacteria 7337
119 Ga0105239_10058538 3300010375 Bacteria 4228
120 Ga0105246_10116948 3300011119 Bacteria 1969
121 Ga0157374_10073931 3300013296 Bacteria 3217
122 Ga0163162_10005334 3300013306 Bacteria 12405
123 Ga0163162_10305189 3300013306 Bacteria 1724
124 Ga0163162_10401601 3300013306 Bacteria 1503
125 Ga0157375_10001965 3300013308 Bacteria 17723
126 Ga0163163_10375632 3300014325 Bacteria 1479
127 Ga0157380_10007184 3300014326 Bacteria 7893
128 Ga0157379_10031441 3300014968 Bacteria 4729
129 Ga0157379_10035370 3300014968 Bacteria 4453
130 Ga0157376_10508943 3300014969 Bacteria 1185
131 Ga0207425_1009101 3300025245 Bacteria 2493
132 Ga0209129_1000035 3300025258 Bacteria 329303
133 Ga0209673_1007003 3300025273 Bacteria 5308
134 Ga0209564_1000024 3300025295 Bacteria 535041
135 Ga0209758_1000066 3300025297 Bacteria 298620
136 Ga0209758_1000226 3300025297 Bacteria 120484
137 Ga0209050_1000266 3300025298 Bacteria 111792
138 Ga0209050_1002658 3300025298 Bacteria 14615
139 Ga0209050_1008586 3300025298 Bacteria 5413
140 Ga0209256_1000049 3300025299 Bacteria 310696
141 Ga0209051_1000247 3300025303 Bacteria 91122
142 Ga0209257_1000141 3300025304 Bacteria 201130
143 Ga0207682_10018703 3300025893 Bacteria 2709
144 Ga0207642_10174335 3300025899 Bacteria 1166
145 Ga0207645_10009923 3300025907 Bacteria 6559
146 Ga0207645_10010384 3300025907 Bacteria 6392
147 Ga0207645_10222380 3300025907 Bacteria 1245
148 Ga0207671_10011567 3300025914 Bacteria 7166
149 Ga0207662_10035767 3300025918 Bacteria 2902
150 Ga0207694_10047494 3300025924 Bacteria 3321
151 Ga0207650_10029980 3300025925 Bacteria 3915
152 Ga0207650_10053901 3300025925 Bacteria 2982
153 Ga0207659_10022831 3300025926 Bacteria 4170
154 Ga0207659_10069855 3300025926 Bacteria 2560
155 Ga0207659_10118526 3300025926 Bacteria 2025
156 Ga0207687_10200930 3300025927 Bacteria 1558
157 Ga0207644_10014556 3300025931 Bacteria 5264
158 Ga0207644_10054789 3300025931 Bacteria 2873
159 Ga0207690_10401500 3300025932 Bacteria 1093
160 Ga0207706_10011662 3300025933 Bacteria 8013
161 Ga0207706_10091267 3300025933 Bacteria 2678
162 Ga0207709_10001737 3300025935 Bacteria 14677
163 Ga0207709_10010795 3300025935 Bacteria 5029
164 Ga0207709_10042497 3300025935 Bacteria 2735
165 Ga0207669_10001772 3300025937 Bacteria 9158
166 Ga0207669_10108466 3300025937 Bacteria 1854
167 Ga0207669_10195280 3300025937 Bacteria 1464
168 Ga0207704_10074062 3300025938 Bacteria 2171
169 Ga0207691_10083335 3300025940 Bacteria 2871
170 Ga0207691_10105128 3300025940 Bacteria 2515
171 Ga0207691_10118103 3300025940 Bacteria 2353
172 Ga0207711_10024196 3300025941 Bacteria 5084
173 Ga0207689_10004154 3300025942 Bacteria 13165
174 Ga0207661_10126544 3300025944 Bacteria 2183
175 Ga0207679_10045088 3300025945 Bacteria 3187
176 Ga0207679_10362083 3300025945 Bacteria 1267
177 Ga0207668_10010323 3300025972 Bacteria 5642
178 Ga0207640_10005134 3300025981 Bacteria 7121
179 Ga0207658_10067889 3300025986 Bacteria 2688
180 Ga0207703_10001561 3300026035 Bacteria 20760
181 Ga0207639_10254374 3300026041 Bacteria 1533
182 Ga0207678_10063031 3300026067 Bacteria 3186
183 Ga0207708_10006187 3300026075 Bacteria 8870
184 Ga0207641_10008411 3300026088 Bacteria 8527
185 Ga0207648_10005645 3300026089 Bacteria 12562
186 Ga0207648_10017778 3300026089 Bacteria 6456
187 Ga0207676_10038070 3300026095 Bacteria 3669
188 Ga0207674_10099442 3300026116 Bacteria 2891
189 Ga0207674_10142323 3300026116 Bacteria 2358
190 Ga0207675_100004823 3300026118 Bacteria 12985
191 Ga0207683_10058080 3300026121 Bacteria 3397
192 Ga0207683_10158562 3300026121 Bacteria 2044
193 Ga0207698_10076321 3300026142 Bacteria 2682
194 Ga0209281_1000002 3300027111 Bacteria 1924012
195 Ga0209281_1000395 3300027111 Bacteria 67983
196 Ga0209970_1001402 3300027614 Bacteria 4206
197 Ga0209974_10007899 3300027876 Bacteria 3651
198 Ga0268266_10051320 3300028379 Bacteria 3540
199 Ga0268266_10489003 3300028379 Bacteria 1174
200 Ga0268264_10018727 3300028381 Bacteria 5662
201 Ga0268264_10027660 3300028381 Bacteria 4635
202 Ga0307517_10024101 3300028786 Bacteria 7522
203 Ga0307515_10000020 3300028794 Bacteria 411735
204 Ga0307515_10000824 3300028794 Bacteria 71229
205 Ga0307515_10010044 3300028794 Bacteria 18205
206 Ga0307515_10103415 3300028794 Bacteria 3414
207 Ga0307515_10295877 3300028794 Bacteria 1309
208 Ga0307512_10026527 3300030522 Bacteria 5116
209 Ga0307513_10000006 3300031456 Bacteria 470848
210 Ga0307513_10008272 3300031456 Bacteria 13341
211 Ga0307513_10028655 3300031456 Bacteria 6361
212 Ga0307513_10083145 3300031456 Bacteria 3293
213 Ga0307513_10165663 3300031456 Bacteria 2095
214 Ga0307513_10203274 3300031456 Bacteria 1819
215 Ga0307408_100077391 3300031548 Bacteria 2477
216 Ga0307508_10000043 3300031616 Bacteria 143889
217 Ga0307508_10001494 3300031616 Bacteria 26240
218 Ga0307514_10023994 3300031649 Bacteria 4942
219 Ga0307516_10099582 3300031730 Bacteria 2723
220 Ga0307516_10158376 3300031730 Bacteria 2017
221 Ga0307516_10254449 3300031730 Bacteria 1449
222 Ga0307405_10006965 3300031731 Bacteria 5614
223 Ga0307405_10043336 3300031731 Bacteria 2745
224 Ga0307405_10348658 3300031731 Bacteria 1141
225 Ga0307410_10024769 3300031852 Bacteria 3754
226 Ga0307410_10049786 3300031852 Bacteria 2814
227 Ga0307406_10003882 3300031901 Bacteria 8142
228 Ga0307407_10319314 3300031903 Bacteria 1089
229 Ga0307412_10023699 3300031911 Bacteria 3780
230 Ga0307412_10076021 3300031911 Bacteria 2306
231 Ga0307409_100004771 3300031995 Bacteria 7684
232 Ga0307416_100009133 3300032002 Bacteria 6464
233 Ga0307416_100631056 3300032002 Bacteria 1154
234 Ga0307414_10075739 3300032004 Bacteria 2443
235 Ga0307411_10018592 3300032005 Bacteria 3991
236 Ga0307411_10139574 3300032005 Bacteria 1785
237 Ga0307415_100045257 3300032126 Bacteria 2949
238 Ga0373937_0273825 3300036401 Bacteria 1594
239 Ga0395898_0363005 3300037466 Bacteria 1381
240 Ga0395905_0008319 3300037471 Bacteria 10234
241 Ga0395905_0011387 3300037471 Bacteria 8594
242 Ga0395905_0015349 3300037471 Bacteria 7281
243 Ga0395905_0085110 3300037471 Bacteria 2963
244 Ga0395905_0209648 3300037471 Bacteria 1825
245 Ga0451839_1501674 3300041496 Bacteria 2088
246 Ga0439431_0005875 3300041997 Bacteria 2712
247 Ga0439441_008313 3300042001 Bacteria 1692
248 Ga0439449_0021723 3300042007 Bacteria 2403
249 Ga0439455_0023581 3300042012 Bacteria 1482
250 Ga0439455_0032509 3300042012 Bacteria 1305
251 Ga0450911_001584 3300042115 Bacteria 5132
252 Ga0450919_000192 3300042121 Bacteria 6658
253 Ga0439446_0030782 3300042156 Bacteria 1552
254 Ga0439459_0025105 3300042438 Bacteria 1174
255 Ga0450918_000037 3300042531 Bacteria 26554
256 Ga0451577_0016289 3300042876 Bacteria 6887
257 Ga0451577_0149250 3300042876 Bacteria 2103
258 Ga0453684_0007496 3300044712 Bacteria 20017
259 Ga0451576_0220873 3300045051 Bacteria 1978
260 Ga0495638_0029735 3300046460 Bacteria 3523
261 Ga0495650_0013279 3300046471 Bacteria 4366
262 Ga0495650_0107468 3300046471 Bacteria 1040
263 Ga0495610_0054948 3300046512 Bacteria 1922
264 Ga0495610_0116277 3300046512 Bacteria 1178
265 Ga0495620_0099098 3300046515 Bacteria 1163
266 Ga0495632_0028132 3300046519 Bacteria 2936
267 Ga0495643_0134032 3300046522 Bacteria 1241
268 Ga0495597_0116794 3300046542 Bacteria 1115
269 Ga0495625_0001729 3300046660 Bacteria 25319
270 Ga0495625_0056474 3300046660 Bacteria 2794
271 Ga0495625_0232988 3300046660 Bacteria 1202
272 Ga0495649_0000541 3300046694 Bacteria 32077
273 Ga0495660_0047112 3300046810 Bacteria 2362
274 Ga0495687_000174 3300047443 Bacteria 95031
275 Ga0495687_013171 3300047443 Bacteria 4329
276 Ga0496102_0025442 3300048905 Bacteria 5269
277 Ga0496108_0016352 3300048911 Bacteria 6051
278 Ga0496108_0348460 3300048911 Bacteria 1292
279 Ga0496109_0081037 3300048912 Bacteria 2991
280 Ga0496114_0006230 3300048917 Bacteria 9390
281 Ga0496114_0081482 3300048917 Bacteria 2734
282 Ga0496121_0006539 3300048924 Bacteria 14404
283 Ga0496124_0050836 3300048927 Bacteria 3529
284 Ga0496125_0003980 3300048928 Bacteria 17384
285 Ga0496125_0064800 3300048928 Bacteria 2900
286 Ga0496126_0175505 3300048929 Bacteria 1823
287 Ga0501036_0231378 3300049572 Bacteria 1551
288 Ga0501076_0499036 3300049592 Bacteria 1003
289 Ga0501081_0197708 3300049743 Bacteria 1458
290 Ga0501265_003825 3300049762 Bacteria 1709
291 Ga0501266_000871 3300049763 Bacteria 3931
292 Ga0501035_0380673 3300049822 Bacteria 1177
293 nmdc:mga03683_5161_c1 3300050489 Bacteria 4391
294 nmdc:mga03n38_81187_c1 3300050490 Bacteria 1524
295 nmdc:mga00v17_21340_c1 3300050491 Bacteria 3722
296 nmdc:mga00v17_329699_c1 3300050491 Bacteria 992
297 nmdc:mga0yw44_158685_c1 3300050492 Bacteria 1480
298 nmdc:mga0k408_108937_c1 3300050493 Bacteria 1637
299 nmdc:mga0k408_1264_c1 3300050493 Bacteria 13764
300 nmdc:mga0k408_27755_c1 3300050493 Bacteria 3216
301 nmdc:mga0k408_28936_c1 3300050493 Bacteria 3152
302 nmdc:mga0k408_5135_c1 3300050493 Bacteria 3674
303 nmdc:mga0k408_9816_c1 3300050493 Bacteria 5170
304 nmdc:mga06z11_28884_c1 3300050494 Bacteria 2665
305 nmdc:mga06z11_28979_c1 3300050494 Bacteria 2662
306 nmdc:mga06z11_45715_c1 3300050494 Bacteria 2215
307 nmdc:mga06z11_80349_c1 3300050494 Bacteria 1748
308 nmdc:mga04h51_17190_c1 3300050495 Bacteria 2112
309 nmdc:mga07m45_145088_c1 3300050496 Bacteria 1376
310 nmdc:mga07m45_19535_c1 3300050496 Bacteria 3673
311 nmdc:mga07m45_293016_c1 3300050496 Bacteria 947
312 nmdc:mga07m45_309_c1 3300050496 Bacteria 19711
313 nmdc:mga07m45_4827_c1 3300050496 Bacteria 6630
314 nmdc:mga07m45_70848_c1 3300050496 Bacteria 1983
315 nmdc:mga07m45_8282_c1 3300050496 Bacteria 5335
316 nmdc:mga05p37_286272_c1 3300050507 Bacteria 1963
317 nmdc:mga09592_50920_c1 3300050508 Bacteria 3493
318 nmdc:mga0qj67_213704_c1 3300050509 Bacteria 1566
319 nmdc:mga0qj67_49483_c1 3300050509 Bacteria 3322
320 nmdc:mga08x19_76150_c1 3300050514 Bacteria 2195
321 nmdc:mga0sz30_6027_c1 3300050516 Bacteria 4479
322 Ga0500578_0000104 3300053086 Bacteria 98802
323 Ga0500646_0012091 3300053090 Bacteria 2226
324 Ga0500651_0077293 3300053093 Bacteria 2065
325 Ga0500641_0046808 3300053096 Bacteria 1767
326 Ga0500641_0065866 3300053096 Bacteria 1516
327 Ga0500650_0073259 3300053098 Bacteria 1601
328 Ga0500655_009500 3300053133 Bacteria 1755
329 Ga0500568_0017764 3300053139 Bacteria 3131
330 Ga0500577_0026637 3300053142 Bacteria 1971
331 Ga0500604_0030498 3300053151 Bacteria 1577
332 Ga0500622_0000081 3300053156 Bacteria 102191
333 Ga0500587_005677 3300053739 Bacteria 1670

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0499036 Ga0501076_0499036_195_977 258
2 3300053096 Ga0500641_0065866 Ga0500641_0065866_637_1503 286
3 3300046471 Ga0495650_0107468 Ga0495650_0107468_151_1020 288
4 3300050496 nmdc:mga07m45_293016_c1 nmdc:mga07m45_293016_c1_67_933 288
5 3300028379 Ga0268266_10489003 Ga0268266_104890032 291
6 3300005985 Ga0081539_10002066 Ga0081539_1000206630 292
7 3300042876 Ga0451577_0149250 Ga0451577_0149250_1083_2075 293
8 3300005440 Ga0070705_100179987 Ga0070705_1001799872 298
9 3300031731 Ga0307405_10348658 Ga0307405_103486582 299
10 3300050491 nmdc:mga00v17_329699_c1 nmdc:mga00v17_329699_c1_30_971 300
11 3300005435 Ga0070714_100110858 Ga0070714_1001108582 301
12 3300048924 Ga0496121_0006539 Ga0496121_0006539_12472_13443 301
13 3300048928 Ga0496125_0064800 Ga0496125_0064800_651_1622 301
14 3300042012 Ga0439455_0032509 Ga0439455_0032509_25_939 303
15 3300049743 Ga0501081_0197708 Ga0501081_0197708_349_1305 303
16 3300042007 Ga0439449_0021723 Ga0439449_0021723_984_1970 304
17 3300005456 Ga0070678_100426463 Ga0070678_1004264631 305
18 3300050496 nmdc:mga07m45_8282_c1 nmdc:mga07m45_8282_c1_2210_3184 305
19 3300046471 Ga0495650_0013279 Ga0495650_0013279_2858_3838 308
20 3300006846 Ga0075430_100235096 Ga0075430_1002350962 310
21 3300006880 Ga0075429_100012611 Ga0075429_1000126113 310
22 3300009147 Ga0114129_10237550 Ga0114129_102375502 310
23 3300025933 Ga0207706_10091267 Ga0207706_100912672 310
24 3300050507 nmdc:mga05p37_286272_c1 nmdc:mga05p37_286272_c1_413_1360 310
25 3300050508 nmdc:mga09592_50920_c1 nmdc:mga09592_50920_c1_709_1686 310
26 3300050509 nmdc:mga0qj67_213704_c1 nmdc:mga0qj67_213704_c1_334_1311 310
27 3300005328 Ga0070676_10021421 Ga0070676_100214212 311
28 3300005354 Ga0070675_100019069 Ga0070675_1000190693 311
29 3300005440 Ga0070705_100004947 Ga0070705_1000049474 311
30 3300005536 Ga0070697_100053948 Ga0070697_1000539482 311
31 3300005543 Ga0070672_100071128 Ga0070672_1000711283 311
32 3300005546 Ga0070696_100021186 Ga0070696_1000211862 311
33 3300005549 Ga0070704_100064157 Ga0070704_1000641573 311
34 3300005577 Ga0068857_100223219 Ga0068857_1002232192 311
35 3300006173 Ga0070716_100116731 Ga0070716_1001167312 311
36 3300006846 Ga0075430_100045817 Ga0075430_1000458172 311
37 3300006847 Ga0075431_100101303 Ga0075431_1001013032 311
38 3300006914 Ga0075436_100000407 Ga0075436_1000004074 311
39 3300006914 Ga0075436_100115939 Ga0075436_1001159392 311
40 3300009098 Ga0105245_10178842 Ga0105245_101788422 311
41 3300009551 Ga0105238_10133701 Ga0105238_101337012 311
42 3300011119 Ga0105246_10116948 Ga0105246_101169482 311
43 3300013306 Ga0163162_10305189 Ga0163162_103051891 311
44 3300014325 Ga0163163_10375632 Ga0163163_103756322 311
45 3300025298 Ga0209050_1000266 Ga0209050_100026686 311
46 3300025907 Ga0207645_10009923 Ga0207645_100099234 311
47 3300025924 Ga0207694_10047494 Ga0207694_100474942 311
48 3300025926 Ga0207659_10069855 Ga0207659_100698552 311
49 3300025927 Ga0207687_10200930 Ga0207687_102009302 311
50 3300025931 Ga0207644_10054789 Ga0207644_100547892 311
51 3300025940 Ga0207691_10083335 Ga0207691_100833351 311
52 3300025940 Ga0207691_10105128 Ga0207691_101051283 311
53 3300026116 Ga0207674_10099442 Ga0207674_100994422 311
54 3300050509 nmdc:mga0qj67_49483_c1 nmdc:mga0qj67_49483_c1_567_1514 311
55 3300050514 nmdc:mga08x19_76150_c1 nmdc:mga08x19_76150_c1_70_1026 311
56 3300003215 JGI25153J46596_10014835 JGI25153J46596_100148352 312
57 3300005262 Ga0065165_1002369 Ga0065165_100236912 312
58 3300005355 Ga0070671_100016741 Ga0070671_1000167412 312
59 3300005456 Ga0070678_100144884 Ga0070678_1001448841 312
60 3300005616 Ga0068852_100203445 Ga0068852_1002034452 312
61 3300006048 Ga0075363_100137686 Ga0075363_1001376862 312
62 3300006195 Ga0075366_10061266 Ga0075366_100612662 312
63 3300006237 Ga0097621_100029794 Ga0097621_1000297942 312
64 3300006353 Ga0075370_10029020 Ga0075370_100290202 312
65 3300006358 Ga0068871_100033288 Ga0068871_1000332882 312
66 3300013296 Ga0157374_10073931 Ga0157374_100739311 312
67 3300025273 Ga0209673_1007003 Ga0209673_10070035 312
68 3300025297 Ga0209758_1000226 Ga0209758_1000226103 312
69 3300025931 Ga0207644_10014556 Ga0207644_100145562 312
70 3300025941 Ga0207711_10024196 Ga0207711_100241967 312
71 3300026121 Ga0207683_10158562 Ga0207683_101585623 312
72 3300028786 Ga0307517_10024101 Ga0307517_100241012 312
73 3300031456 Ga0307513_10028655 Ga0307513_100286557 312
74 3300031456 Ga0307513_10165663 Ga0307513_101656632 312
75 3300031730 Ga0307516_10158376 Ga0307516_101583762 312
76 3300046460 Ga0495638_0029735 Ga0495638_0029735_686_1672 312
77 3300048911 Ga0496108_0348460 Ga0496108_0348460_124_1146 312
78 3300050493 nmdc:mga0k408_27755_c1 nmdc:mga0k408_27755_c1_885_1871 312
79 3300050496 nmdc:mga07m45_70848_c1 nmdc:mga07m45_70848_c1_430_1416 312
80 3300053086 Ga0500578_0000104 Ga0500578_0000104_78164_79150 312
81 3300053090 Ga0500646_0012091 Ga0500646_0012091_263_1249 312
82 3300053093 Ga0500651_0077293 Ga0500651_0077293_328_1314 312
83 3300053098 Ga0500650_0073259 Ga0500650_0073259_189_1175 312
84 3300053133 Ga0500655_009500 Ga0500655_009500_266_1252 312
85 3300053142 Ga0500577_0026637 Ga0500577_0026637_735_1721 312
86 3300053151 Ga0500604_0030498 Ga0500604_0030498_291_1277 312
87 3300053156 Ga0500622_0000081 Ga0500622_0000081_72518_73504 312
88 3300005518 Ga0070699_100110978 Ga0070699_1001109783 313
89 3300005548 Ga0070665_100283950 Ga0070665_1002839502 313
90 3300006195 Ga0075366_10182183 Ga0075366_101821832 313
91 3300013306 Ga0163162_10401601 Ga0163162_104016011 313
92 3300028379 Ga0268266_10051320 Ga0268266_100513202 313
93 3300050489 nmdc:mga03683_5161_c1 nmdc:mga03683_5161_c1_335_1372 313
94 3300050493 nmdc:mga0k408_5135_c1 nmdc:mga0k408_5135_c1_2010_3047 313
95 3300050494 nmdc:mga06z11_80349_c1 nmdc:mga06z11_80349_c1_382_1419 313
96 3300050495 nmdc:mga04h51_17190_c1 nmdc:mga04h51_17190_c1_456_1493 313
97 3300005356 Ga0070674_100231163 Ga0070674_1002311632 314
98 3300006195 Ga0075366_10087246 Ga0075366_100872462 314
99 3300006353 Ga0075370_10140690 Ga0075370_101406902 314
100 3300014969 Ga0157376_10508943 Ga0157376_105089431 314
101 3300025937 Ga0207669_10195280 Ga0207669_101952802 314
102 3300036401 Ga0373937_0273825 Ga0373937_0273825_212_1210 314
103 3300037471 Ga0395905_0209648 Ga0395905_0209648_118_1074 314
104 3300042001 Ga0439441_008313 Ga0439441_008313_98_1057 314
105 3300050496 nmdc:mga07m45_19535_c1 nmdc:mga07m45_19535_c1_93_1046 314
106 3300053096 Ga0500641_0046808 Ga0500641_0046808_371_1333 314
107 3300046660 Ga0495625_0232988 Ga0495625_0232988_126_1082 315
108 3300003323 rootH1_10196826 rootH1_101968262 316
109 3300005331 Ga0070670_100290935 Ga0070670_1002909352 316
110 3300006195 Ga0075366_10255706 Ga0075366_102557061 316
111 3300025925 Ga0207650_10029980 Ga0207650_100299803 316
112 3300027876 Ga0209974_10007899 Ga0209974_100078993 316
113 3300028794 Ga0307515_10295877 Ga0307515_102958772 316
114 3300031456 Ga0307513_10203274 Ga0307513_102032742 316
115 3300031548 Ga0307408_100077391 Ga0307408_1000773913 316
116 3300037471 Ga0395905_0008319 Ga0395905_0008319_6868_7878 316
117 3300042876 Ga0451577_0016289 Ga0451577_0016289_4958_5923 316
118 3300049572 Ga0501036_0231378 Ga0501036_0231378_533_1498 316
119 3300049822 Ga0501035_0380673 Ga0501035_0380673_200_1165 316
120 3300006178 Ga0075367_10097162 Ga0075367_100971622 317
121 3300031456 Ga0307513_10000006 Ga0307513_1000000612 317
122 3300042115 Ga0450911_001584 Ga0450911_001584_3625_4596 317
123 3300048927 Ga0496124_0050836 Ga0496124_0050836_1530_2501 317
124 3300048928 Ga0496125_0003980 Ga0496125_0003980_7524_8495 317
125 3300048929 Ga0496126_0175505 Ga0496126_0175505_130_1101 317
126 3300050490 nmdc:mga03n38_81187_c1 nmdc:mga03n38_81187_c1_406_1371 317
127 3300050494 nmdc:mga06z11_28884_c1 nmdc:mga06z11_28884_c1_729_1694 317
128 iso_pu_bacteria 2721755523 2722885741 317
129 iso_pu_bacteria 2839138175 2839138613 317
130 iso_pu_bacteria 2974320154 2974322083 317
131 3300006051 Ga0075364_10002785 Ga0075364_1000278511 318
132 3300006178 Ga0075367_10042392 Ga0075367_100423922 318
133 3300042438 Ga0439459_0025105 Ga0439459_0025105_108_1085 318
134 3300049762 Ga0501265_003825 Ga0501265_003825_271_1242 318
135 3300050491 nmdc:mga00v17_21340_c1 nmdc:mga00v17_21340_c1_1735_2706 318
136 3300050492 nmdc:mga0yw44_158685_c1 nmdc:mga0yw44_158685_c1_371_1342 318
137 3300050494 nmdc:mga06z11_28979_c1 nmdc:mga06z11_28979_c1_524_1495 318
138 3300031911 Ga0307412_10076021 Ga0307412_100760212 319
139 3300032005 Ga0307411_10139574 Ga0307411_101395742 319
140 3300045051 Ga0451576_0220873 Ga0451576_0220873_538_1590 319
141 3300005843 Ga0068860_100071518 Ga0068860_1000715182 320
142 3300006051 Ga0075364_10086028 Ga0075364_100860282 320
143 3300006946 Ga0079104_1001506 Ga0079104_10015062 320
144 3300009148 Ga0105243_10009917 Ga0105243_100099172 320
145 3300014968 Ga0157379_10031441 Ga0157379_100314414 320
146 3300025935 Ga0207709_10001737 Ga0207709_100017372 320
147 3300027111 Ga0209281_1000002 Ga0209281_1000002774 320
148 3300028381 Ga0268264_10018727 Ga0268264_100187274 320
149 3300037466 Ga0395898_0363005 Ga0395898_0363005_18_995 320
150 3300037471 Ga0395905_0011387 Ga0395905_0011387_4801_5778 320
151 3300037471 Ga0395905_0015349 Ga0395905_0015349_2349_3326 320
152 3300037471 Ga0395905_0085110 Ga0395905_0085110_710_1687 320
153 3300041997 Ga0439431_0005875 Ga0439431_0005875_94_1068 320
154 3300042156 Ga0439446_0030782 Ga0439446_0030782_49_1023 320
155 3300048911 Ga0496108_0016352 Ga0496108_0016352_1150_2181 320
156 3300048912 Ga0496109_0081037 Ga0496109_0081037_63_1094 320
157 3300049763 Ga0501266_000871 Ga0501266_000871_2235_3212 320
158 3300050493 nmdc:mga0k408_28936_c1 nmdc:mga0k408_28936_c1_650_1618 320
159 iso_pu_bacteria 2643221644 2644244799 320
160 3300005364 Ga0070673_100091863 Ga0070673_1000918633 321
161 3300005841 Ga0068863_100062011 Ga0068863_1000620113 321
162 3300013308 Ga0157375_10001965 Ga0157375_100019656 321
163 iso_pu_bacteria 2643221654 2644301156 321
164 3300003775 Ga0055524_1000420 Ga0055524_100042030 322
165 3300003791 Ga0055530_10001480 Ga0055530_100014807 322
166 3300003792 Ga0055540_1000308 Ga0055540_100030812 322
167 3300005262 Ga0065165_1034655 Ga0065165_10346552 322
168 3300006946 Ga0079104_1000569 Ga0079104_100056912 322
169 3300025298 Ga0209050_1002658 Ga0209050_10026585 322
170 3300025298 Ga0209050_1008586 Ga0209050_10085865 322
171 3300025299 Ga0209256_1000049 Ga0209256_1000049102 322
172 3300025303 Ga0209051_1000247 Ga0209051_100024783 322
173 3300025304 Ga0209257_1000141 Ga0209257_100014183 322
174 3300027111 Ga0209281_1000395 Ga0209281_100039512 322
175 3300048917 Ga0496114_0006230 Ga0496114_0006230_782_1759 322
176 iso_pu_bacteria 2585428058 2587732711 322
177 iso_pu_bacteria 2585428062 2587760138 322
178 iso_pu_bacteria 2588253510 2588290307 322
179 iso_pu_bacteria 2643221592 2643967622 322
180 iso_pu_bacteria 2643221625 2644140444 322
181 iso_pu_bacteria 2643221648 2644273411 322
182 3300005354 Ga0070675_100065171 Ga0070675_1000651713 323
183 3300005543 Ga0070672_100023072 Ga0070672_1000230724 323
184 3300006051 Ga0075364_10023466 Ga0075364_100234662 323
185 3300009148 Ga0105243_10086073 Ga0105243_100860732 323
186 3300025926 Ga0207659_10118526 Ga0207659_101185262 323
187 3300025940 Ga0207691_10118103 Ga0207691_101181032 323
188 3300042121 Ga0450919_000192 Ga0450919_000192_2770_3744 323
189 3300042531 Ga0450918_000037 Ga0450918_000037_5193_6167 323
190 3300005295 Ga0065707_10093597 Ga0065707_100935972 324
191 3300005367 Ga0070667_100084885 Ga0070667_1000848852 324
192 3300005445 Ga0070708_100284414 Ga0070708_1002844141 324
193 3300005467 Ga0070706_100001825 Ga0070706_10000182516 324
194 3300005468 Ga0070707_100132536 Ga0070707_1001325362 324
195 3300005471 Ga0070698_100259237 Ga0070698_1002592371 324
196 3300005843 Ga0068860_100056234 Ga0068860_1000562342 324
197 3300009545 Ga0105237_10057550 Ga0105237_100575504 324
198 3300025986 Ga0207658_10067889 Ga0207658_100678893 324
199 3300028794 Ga0307515_10000020 Ga0307515_10000020185 324
200 3300028794 Ga0307515_10103415 Ga0307515_101034152 324
201 3300031616 Ga0307508_10001494 Ga0307508_100014945 324
202 3300050494 nmdc:mga06z11_45715_c1 nmdc:mga06z11_45715_c1_1214_2197 324
203 3300006195 Ga0075366_10041774 Ga0075366_100417743 325
204 3300042012 Ga0439455_0023581 Ga0439455_0023581_359_1354 325
205 3300046512 Ga0495610_0054948 Ga0495610_0054948_301_1290 325
206 3300046515 Ga0495620_0099098 Ga0495620_0099098_115_1104 325
207 3300046660 Ga0495625_0056474 Ga0495625_0056474_1048_2037 325
208 3300046694 Ga0495649_0000541 Ga0495649_0000541_7758_8747 325
209 3300046810 Ga0495660_0047112 Ga0495660_0047112_1032_2021 325
210 3300047443 Ga0495687_013171 Ga0495687_013171_2561_3550 325
211 3300053139 Ga0500568_0017764 Ga0500568_0017764_984_1973 325
212 3300003322 rootL2_10056964 rootL2_100569641 326
213 3300005334 Ga0068869_100027292 Ga0068869_1000272923 326
214 3300005455 Ga0070663_100046306 Ga0070663_1000463064 326
215 3300005456 Ga0070678_100086163 Ga0070678_1000861632 326
216 3300005457 Ga0070662_100045404 Ga0070662_1000454043 326
217 3300005459 Ga0068867_100082111 Ga0068867_1000821112 326
218 3300005577 Ga0068857_100063712 Ga0068857_1000637124 326
219 3300005578 Ga0068854_100012899 Ga0068854_1000128994 326
220 3300006042 Ga0075368_10017182 Ga0075368_100171822 326
221 3300006177 Ga0075362_10022629 Ga0075362_100226292 326
222 3300006177 Ga0075362_10023089 Ga0075362_100230891 326
223 3300006178 Ga0075367_10002066 Ga0075367_100020669 326
224 3300006178 Ga0075367_10160280 Ga0075367_101602801 326
225 3300006186 Ga0075369_10001746 Ga0075369_100017462 326
226 3300006186 Ga0075369_10022528 Ga0075369_100225282 326
227 3300006195 Ga0075366_10007300 Ga0075366_100073005 326
228 3300006195 Ga0075366_10010021 Ga0075366_100100212 326
229 3300006353 Ga0075370_10000323 Ga0075370_1000032317 326
230 3300006353 Ga0075370_10001147 Ga0075370_1000114711 326
231 3300006353 Ga0075370_10004740 Ga0075370_100047405 326
232 3300006353 Ga0075370_10017397 Ga0075370_100173973 326
233 3300009148 Ga0105243_10030887 Ga0105243_100308874 326
234 3300009545 Ga0105237_10020953 Ga0105237_100209537 326
235 3300010375 Ga0105239_10058538 Ga0105239_100585384 326
236 3300025907 Ga0207645_10222380 Ga0207645_102223802 326
237 3300025914 Ga0207671_10011567 Ga0207671_100115677 326
238 3300025933 Ga0207706_10011662 Ga0207706_100116622 326
239 3300025935 Ga0207709_10010795 Ga0207709_100107952 326
240 3300025945 Ga0207679_10362083 Ga0207679_103620832 326
241 3300025981 Ga0207640_10005134 Ga0207640_100051342 326
242 3300026041 Ga0207639_10254374 Ga0207639_102543742 326
243 3300026067 Ga0207678_10063031 Ga0207678_100630312 326
244 3300026089 Ga0207648_10017778 Ga0207648_100177786 326
245 3300026116 Ga0207674_10142323 Ga0207674_101423233 326
246 3300026121 Ga0207683_10058080 Ga0207683_100580802 326
247 3300028794 Ga0307515_10010044 Ga0307515_100100447 326
248 3300031730 Ga0307516_10099582 Ga0307516_100995822 326
249 3300031730 Ga0307516_10254449 Ga0307516_102544492 326
250 3300031731 Ga0307405_10043336 Ga0307405_100433362 326
251 3300031852 Ga0307410_10049786 Ga0307410_100497863 326
252 3300032002 Ga0307416_100009133 Ga0307416_1000091334 326
253 3300041496 Ga0451839_1501674 Ga0451839_1501674_1019_2011 326
254 3300046512 Ga0495610_0116277 Ga0495610_0116277_148_1137 326
255 3300046519 Ga0495632_0028132 Ga0495632_0028132_273_1262 326
256 3300046522 Ga0495643_0134032 Ga0495643_0134032_185_1174 326
257 3300046542 Ga0495597_0116794 Ga0495597_0116794_67_1056 326
258 3300046660 Ga0495625_0001729 Ga0495625_0001729_180_1169 326
259 3300047443 Ga0495687_000174 Ga0495687_000174_86843_87889 326
260 3300048917 Ga0496114_0081482 Ga0496114_0081482_528_1523 326
261 3300050493 nmdc:mga0k408_108937_c1 nmdc:mga0k408_108937_c1_315_1307 326
262 3300050493 nmdc:mga0k408_1264_c1 nmdc:mga0k408_1264_c1_2485_3477 326
263 3300050493 nmdc:mga0k408_9816_c1 nmdc:mga0k408_9816_c1_1111_2103 326
264 3300050496 nmdc:mga07m45_145088_c1 nmdc:mga07m45_145088_c1_196_1233 326
265 3300050496 nmdc:mga07m45_309_c1 nmdc:mga07m45_309_c1_7046_8038 326
266 3300050496 nmdc:mga07m45_4827_c1 nmdc:mga07m45_4827_c1_4054_5073 326
267 3300050516 nmdc:mga0sz30_6027_c1 nmdc:mga0sz30_6027_c1_1707_2744 326
268 3300053739 Ga0500587_005677 Ga0500587_005677_146_1135 326
269 3300005329 Ga0070683_100323583 Ga0070683_1003235832 327
270 3300005331 Ga0070670_100037992 Ga0070670_1000379926 327
271 3300005334 Ga0068869_100047832 Ga0068869_1000478324 327
272 3300005335 Ga0070666_10020325 Ga0070666_100203256 327
273 3300005354 Ga0070675_100076228 Ga0070675_1000762282 327
274 3300005356 Ga0070674_100012116 Ga0070674_1000121163 327
275 3300005356 Ga0070674_100179941 Ga0070674_1001799412 327
276 3300005364 Ga0070673_100162981 Ga0070673_1001629812 327
277 3300005366 Ga0070659_100083414 Ga0070659_1000834142 327
278 3300005367 Ga0070667_100003274 Ga0070667_10000327411 327
279 3300005455 Ga0070663_100183533 Ga0070663_1001835332 327
280 3300005457 Ga0070662_100064808 Ga0070662_1000648082 327
281 3300005459 Ga0068867_100004219 Ga0068867_1000042196 327
282 3300005543 Ga0070672_100000873 Ga0070672_1000008739 327
283 3300005618 Ga0068864_100042218 Ga0068864_1000422181 327
284 3300005719 Ga0068861_100002298 Ga0068861_1000022982 327
285 3300005841 Ga0068863_100096453 Ga0068863_1000964532 327
286 3300005842 Ga0068858_100019100 Ga0068858_1000191008 327
287 3300005843 Ga0068860_100002437 Ga0068860_10000243711 327
288 3300006195 Ga0075366_10000731 Ga0075366_1000073115 327
289 3300006881 Ga0068865_100083571 Ga0068865_1000835713 327
290 3300009148 Ga0105243_10013167 Ga0105243_100131677 327
291 3300009553 Ga0105249_10013033 Ga0105249_100130332 327
292 3300013306 Ga0163162_10005334 Ga0163162_100053342 327
293 3300014326 Ga0157380_10007184 Ga0157380_100071849 327
294 3300014968 Ga0157379_10035370 Ga0157379_100353706 327
295 3300025893 Ga0207682_10018703 Ga0207682_100187032 327
296 3300025899 Ga0207642_10174335 Ga0207642_101743351 327
297 3300025907 Ga0207645_10010384 Ga0207645_100103842 327
298 3300025918 Ga0207662_10035767 Ga0207662_100357672 327
299 3300025926 Ga0207659_10022831 Ga0207659_100228312 327
300 3300025932 Ga0207690_10401500 Ga0207690_104015001 327
301 3300025935 Ga0207709_10042497 Ga0207709_100424972 327
302 3300025937 Ga0207669_10001772 Ga0207669_100017726 327
303 3300025937 Ga0207669_10108466 Ga0207669_101084662 327
304 3300025938 Ga0207704_10074062 Ga0207704_100740622 327
305 3300025942 Ga0207689_10004154 Ga0207689_1000415411 327
306 3300025944 Ga0207661_10126544 Ga0207661_101265442 327
307 3300025945 Ga0207679_10045088 Ga0207679_100450882 327
308 3300025972 Ga0207668_10010323 Ga0207668_100103232 327
309 3300026035 Ga0207703_10001561 Ga0207703_100015617 327
310 3300026075 Ga0207708_10006187 Ga0207708_1000618710 327
311 3300026088 Ga0207641_10008411 Ga0207641_1000841110 327
312 3300026089 Ga0207648_10005645 Ga0207648_100056452 327
313 3300026095 Ga0207676_10038070 Ga0207676_100380702 327
314 3300026118 Ga0207675_100004823 Ga0207675_10000482311 327
315 3300026142 Ga0207698_10076321 Ga0207698_100763213 327
316 3300027614 Ga0209970_1001402 Ga0209970_10014023 327
317 3300028381 Ga0268264_10027660 Ga0268264_100276603 327
318 3300028794 Ga0307515_10000824 Ga0307515_1000082425 327
319 3300030522 Ga0307512_10026527 Ga0307512_100265276 327
320 3300031456 Ga0307513_10008272 Ga0307513_100082726 327
321 3300031456 Ga0307513_10083145 Ga0307513_100831452 327
322 3300031616 Ga0307508_10000043 Ga0307508_100000432 327
323 3300031649 Ga0307514_10023994 Ga0307514_100239942 327
324 3300048905 Ga0496102_0025442 Ga0496102_0025442_869_1861 327
325 3300005356 Ga0070674_100024551 Ga0070674_1000245513 328
326 3300025925 Ga0207650_10053901 Ga0207650_100539012 328
327 3300031731 Ga0307405_10006965 Ga0307405_100069655 328
328 3300031852 Ga0307410_10024769 Ga0307410_100247692 328
329 3300031901 Ga0307406_10003882 Ga0307406_100038826 328
330 3300031903 Ga0307407_10319314 Ga0307407_103193141 328
331 3300031911 Ga0307412_10023699 Ga0307412_100236992 328
332 3300031995 Ga0307409_100004771 Ga0307409_1000047717 328
333 3300032002 Ga0307416_100631056 Ga0307416_1006310561 328
334 3300032004 Ga0307414_10075739 Ga0307414_100757392 328
335 3300032005 Ga0307411_10018592 Ga0307411_100185922 328
336 3300032126 Ga0307415_100045257 Ga0307415_1000452572 328
337 3300005353 Ga0070669_100167574 Ga0070669_1001675742 329
338 3300044712 Ga0453684_0007496 Ga0453684_0007496_15545_16558 329
339 3300003215 JGI25153J46596_10000973 JGI25153J46596_1000097314 330
340 3300003771 Ga0055526_1001927 Ga0055526_10019277 330
341 3300025245 Ga0207425_1009101 Ga0207425_10091013 330
342 3300025258 Ga0209129_1000035 Ga0209129_100003556 330
343 3300025295 Ga0209564_1000024 Ga0209564_1000024250 330
344 3300025297 Ga0209758_1000066 Ga0209758_1000066262 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

74

345

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9562 36 328
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9428 36 330
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9417 36 328
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9348 36 322
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9345 36 328
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9306 135 255 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.919 135 255 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9159 135 255 3.40.190.10
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9138 36 328 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9073 36 330 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A807DXQ0-F1-model_v4 deleted 0.9697 23 330
AF-A0A1F3ZG10-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9657 30 330
AF-A0A1F4DA25-F1-model_v4 LacI family transcriptional regulator 0.9643 26 330
AF-A0A1H8LZS6-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9577 30 330
AF-A0A4Z0BRZ8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein BugE 0.957 29 330

Feature Viewer

pLDDT pTM Quality
89.44 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map