F415429
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 222 | 312 | 344 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100168431|Ga0070683_1001684314 |
| Length | 352 |
| Sequence | MEKPYVPNPTRYDQANFRRCGRSGLVLPAITLGLWQNFGGADVFETGRAMIRRAFDRGVTHFDLANNYGPPYGSAEENFGLILRKDFGVTKRSSGLRNELLISTKAGWDMWPGPYGIGASRKYLLASLDDSLRRMGLDYVDIFYAHRPWANAPLEETMGALATAVHQGKALYVGISSYSPERTRQAAEILKSMGVPLLIHQPSYSMLNRWIEHGLLDTLAELGVGCIGFSPLAQGMLTTKYLNGVPTDSRAALGNSSLLKEFLTEKNIEQVRHLNQIAIRRGQSLPQMAIAWVLRDARVTSALIGARNIEQLDDSLDALNKLEFSPAELEEIDHHAKDVGIDLWRAARMNMV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 2 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 3 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 4 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 5 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 6 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 7 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 8 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 9 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 10 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 11 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 12 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 13 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 14 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 15 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 16 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 17 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 18 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 19 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 20 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 21 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 22 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 23 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 24 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 25 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 26 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 27 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 28 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 29 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 30 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 31 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 32 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 33 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 34 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 35 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 144 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 161 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 162 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 169 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 176 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 180 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 181 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 182 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 183 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 210 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 211 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 212 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 217 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 218 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 219 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 220 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.67 |
| Metatranscriptomes | 0.29 |
| Isolates | 9.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.5 |
| Nodule | 0.29 |
| Rhizoplane | 1.75 |
| Rhizosphere | 73.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002031 | 3300000546 | Bacteria | 2586 |
| 2 | JGI25152J39213_1000240 | 3300002773 | Bacteria | 36681 |
| 3 | JGI25150J39212_1000170 | 3300002774 | Bacteria | 36653 |
| 4 | JGI25151J46595_10000109 | 3300003187 | Bacteria | 112044 |
| 5 | JGI25153J46596_10000084 | 3300003215 | Bacteria | 112044 |
| 6 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 7 | Ga0055539_1000031 | 3300003752 | Bacteria | 241526 |
| 8 | Ga0055533_1000041 | 3300003756 | Bacteria | 241526 |
| 9 | Ga0055525_1000049 | 3300003759 | Bacteria | 241526 |
| 10 | Ga0055541_1000022 | 3300003841 | Bacteria | 241526 |
| 11 | Ga0070658_10000199 | 3300005327 | Bacteria | 52822 |
| 12 | Ga0070658_10031456 | 3300005327 | Bacteria | 4261 |
| 13 | Ga0070658_10119267 | 3300005327 | Bacteria | 2191 |
| 14 | Ga0070683_100044840 | 3300005329 | Bacteria | 4079 |
| 15 | Ga0070683_100168431 | 3300005329 | Bacteria | 2079 |
| 16 | Ga0070680_100033451 | 3300005336 | Bacteria | 4145 |
| 17 | Ga0068868_100149132 | 3300005338 | Bacteria | 1925 |
| 18 | Ga0070660_100288882 | 3300005339 | Bacteria | 1343 |
| 19 | Ga0070691_10149534 | 3300005341 | Bacteria | 1196 |
| 20 | Ga0070661_100000006 | 3300005344 | Bacteria | 216544 |
| 21 | Ga0070668_100012366 | 3300005347 | Bacteria | 6356 |
| 22 | Ga0070659_100036033 | 3300005366 | Bacteria | 3855 |
| 23 | Ga0070659_100201627 | 3300005366 | Bacteria | 1638 |
| 24 | Ga0070713_100160570 | 3300005436 | Bacteria | 2006 |
| 25 | Ga0070713_100257202 | 3300005436 | Bacteria | 1595 |
| 26 | Ga0070700_100020375 | 3300005441 | Bacteria | 3841 |
| 27 | Ga0070663_100058919 | 3300005455 | Bacteria | 2759 |
| 28 | Ga0070662_100117925 | 3300005457 | Bacteria | 2031 |
| 29 | Ga0070681_10012753 | 3300005458 | Bacteria | 8340 |
| 30 | Ga0070681_10039368 | 3300005458 | Bacteria | 4739 |
| 31 | Ga0070679_100000281 | 3300005530 | Bacteria | 43079 |
| 32 | Ga0070679_100140261 | 3300005530 | Bacteria | 2397 |
| 33 | Ga0070684_100005710 | 3300005535 | Bacteria | 9558 |
| 34 | Ga0070684_100066582 | 3300005535 | Bacteria | 3162 |
| 35 | Ga0068855_100003216 | 3300005563 | Bacteria | 19987 |
| 36 | Ga0068855_100004458 | 3300005563 | Bacteria | 17112 |
| 37 | Ga0068855_100005621 | 3300005563 | Bacteria | 15293 |
| 38 | Ga0068855_100015967 | 3300005563 | Bacteria | 9031 |
| 39 | Ga0068855_100033215 | 3300005563 | Bacteria | 6160 |
| 40 | Ga0068855_100409738 | 3300005563 | Bacteria | 1484 |
| 41 | Ga0070664_100015767 | 3300005564 | Bacteria | 6185 |
| 42 | Ga0070664_100056065 | 3300005564 | Bacteria | 3348 |
| 43 | Ga0068857_100030614 | 3300005577 | Bacteria | 4753 |
| 44 | Ga0068854_100017634 | 3300005578 | Bacteria | 4780 |
| 45 | Ga0068854_100052253 | 3300005578 | Bacteria | 2930 |
| 46 | Ga0068854_100261863 | 3300005578 | Bacteria | 1385 |
| 47 | Ga0068856_100033278 | 3300005614 | Bacteria | 5046 |
| 48 | Ga0068852_100001995 | 3300005616 | Bacteria | 13909 |
| 49 | Ga0068866_10024620 | 3300005718 | Bacteria | 2819 |
| 50 | Ga0068861_100124354 | 3300005719 | Bacteria | 2085 |
| 51 | Ga0068851_10100141 | 3300005834 | Bacteria | 1537 |
| 52 | Ga0068851_10124297 | 3300005834 | Bacteria | 1390 |
| 53 | Ga0081540_1075525 | 3300005983 | Bacteria | 1540 |
| 54 | Ga0075365_10035810 | 3300006038 | Bacteria | 3213 |
| 55 | Ga0075365_10067873 | 3300006038 | Bacteria | 2395 |
| 56 | Ga0075366_10051672 | 3300006195 | Bacteria | 2442 |
| 57 | Ga0075370_10221356 | 3300006353 | Bacteria | 1119 |
| 58 | Ga0068871_100295223 | 3300006358 | Bacteria | 1421 |
| 59 | Ga0075434_100046865 | 3300006871 | Bacteria | 4289 |
| 60 | Ga0105244_10033895 | 3300009036 | Bacteria | 2690 |
| 61 | Ga0105240_10001240 | 3300009093 | Bacteria | 44296 |
| 62 | Ga0105240_10035479 | 3300009093 | Bacteria | 6426 |
| 63 | Ga0105240_10139807 | 3300009093 | Bacteria | 2896 |
| 64 | Ga0105240_10239393 | 3300009093 | Bacteria | 2105 |
| 65 | Ga0114129_10176761 | 3300009147 | Bacteria | 2908 |
| 66 | Ga0105243_10067369 | 3300009148 | Bacteria | 2882 |
| 67 | Ga0105242_10113588 | 3300009176 | Bacteria | 2313 |
| 68 | Ga0105237_10016078 | 3300009545 | Bacteria | 7782 |
| 69 | Ga0105237_10023373 | 3300009545 | Bacteria | 6334 |
| 70 | Ga0105237_10026893 | 3300009545 | Bacteria | 5879 |
| 71 | Ga0105238_10000355 | 3300009551 | Bacteria | 49268 |
| 72 | Ga0105238_10000624 | 3300009551 | Bacteria | 37245 |
| 73 | Ga0105238_10044116 | 3300009551 | Bacteria | 4510 |
| 74 | Ga0105238_10363640 | 3300009551 | Bacteria | 1436 |
| 75 | Ga0105239_10013108 | 3300010375 | Bacteria | 9213 |
| 76 | Ga0105239_10114431 | 3300010375 | Bacteria | 2992 |
| 77 | Ga0157371_10236242 | 3300013102 | Bacteria | 1314 |
| 78 | Ga0157370_10001834 | 3300013104 | Bacteria | 26190 |
| 79 | Ga0157370_10142932 | 3300013104 | Bacteria | 2229 |
| 80 | Ga0157369_10001712 | 3300013105 | Bacteria | 26704 |
| 81 | Ga0157369_10014477 | 3300013105 | Bacteria | 8902 |
| 82 | Ga0157369_10052790 | 3300013105 | Bacteria | 4396 |
| 83 | Ga0157369_10318418 | 3300013105 | Bacteria | 1617 |
| 84 | Ga0157374_10002741 | 3300013296 | Bacteria | 14798 |
| 85 | Ga0163162_10000443 | 3300013306 | Bacteria | 38255 |
| 86 | Ga0163162_10181881 | 3300013306 | Bacteria | 2228 |
| 87 | Ga0157372_10000134 | 3300013307 | Bacteria | 81431 |
| 88 | Ga0157372_10054919 | 3300013307 | Bacteria | 4446 |
| 89 | Ga0163163_10208125 | 3300014325 | Bacteria | 2005 |
| 90 | Ga0157380_10043879 | 3300014326 | Bacteria | 3502 |
| 91 | Ga0157379_10248528 | 3300014968 | Bacteria | 1614 |
| 92 | Ga0157376_10023921 | 3300014969 | Bacteria | 4790 |
| 93 | Ga0157376_10124200 | 3300014969 | Bacteria | 2292 |
| 94 | Ga0182006_1012269 | 3300015261 | Bacteria | 3748 |
| 95 | Ga0206349_1264054 | 3300020075 | Bacteria | 1162 |
| 96 | Ga0213872_10000181 | 3300021361 | Bacteria | 56542 |
| 97 | Ga0213872_10043198 | 3300021361 | Bacteria | 2054 |
| 98 | Ga0213876_10001649 | 3300021384 | Bacteria | 13615 |
| 99 | Ga0213875_10024051 | 3300021388 | Bacteria | 2906 |
| 100 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 101 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 102 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 103 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 104 | Ga0207425_1000290 | 3300025245 | Bacteria | 36693 |
| 105 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 106 | Ga0209129_1000202 | 3300025258 | Bacteria | 72795 |
| 107 | Ga0209565_1003537 | 3300025263 | Bacteria | 5009 |
| 108 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 109 | Ga0209025_1000416 | 3300025294 | Bacteria | 85510 |
| 110 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 111 | Ga0209051_1006470 | 3300025303 | Bacteria | 6598 |
| 112 | Ga0207656_10021178 | 3300025321 | Bacteria | 2594 |
| 113 | Ga0207656_10086520 | 3300025321 | Bacteria | 1417 |
| 114 | Ga0207647_10000056 | 3300025904 | Bacteria | 86476 |
| 115 | Ga0207647_10062089 | 3300025904 | Bacteria | 2277 |
| 116 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 117 | Ga0207705_10005367 | 3300025909 | Bacteria | 9583 |
| 118 | Ga0207705_10038006 | 3300025909 | Bacteria | 3445 |
| 119 | Ga0207705_10050433 | 3300025909 | Bacteria | 2996 |
| 120 | Ga0207705_10074813 | 3300025909 | Bacteria | 2459 |
| 121 | Ga0207705_10104647 | 3300025909 | Bacteria | 2085 |
| 122 | Ga0207705_10200748 | 3300025909 | Bacteria | 1511 |
| 123 | Ga0207707_10001224 | 3300025912 | Bacteria | 24099 |
| 124 | Ga0207695_10003906 | 3300025913 | Bacteria | 20624 |
| 125 | Ga0207695_10006566 | 3300025913 | Bacteria | 15055 |
| 126 | Ga0207695_10030343 | 3300025913 | Bacteria | 5953 |
| 127 | Ga0207695_10260361 | 3300025913 | Bacteria | 1632 |
| 128 | Ga0207671_10002093 | 3300025914 | Bacteria | 21844 |
| 129 | Ga0207671_10022412 | 3300025914 | Bacteria | 4776 |
| 130 | Ga0207657_10006538 | 3300025919 | Bacteria | 12072 |
| 131 | Ga0207657_10219672 | 3300025919 | Bacteria | 1523 |
| 132 | Ga0207649_10000058 | 3300025920 | Bacteria | 100911 |
| 133 | Ga0207649_10129671 | 3300025920 | Bacteria | 1711 |
| 134 | Ga0207652_10071658 | 3300025921 | Bacteria | 3011 |
| 135 | Ga0207681_10306074 | 3300025923 | Bacteria | 1259 |
| 136 | Ga0207694_10000236 | 3300025924 | Bacteria | 52960 |
| 137 | Ga0207694_10002817 | 3300025924 | Bacteria | 14029 |
| 138 | Ga0207706_10039254 | 3300025933 | Bacteria | 4197 |
| 139 | Ga0207665_10183236 | 3300025939 | Bacteria | 1517 |
| 140 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 141 | Ga0207661_10022517 | 3300025944 | Bacteria | 4748 |
| 142 | Ga0207661_10148653 | 3300025944 | Bacteria | 2023 |
| 143 | Ga0207667_10000044 | 3300025949 | Bacteria | 248251 |
| 144 | Ga0207667_10000390 | 3300025949 | Bacteria | 59216 |
| 145 | Ga0207667_10016742 | 3300025949 | Bacteria | 8271 |
| 146 | Ga0207667_10029725 | 3300025949 | Bacteria | 5920 |
| 147 | Ga0207667_10039384 | 3300025949 | Bacteria | 5037 |
| 148 | Ga0207668_10090605 | 3300025972 | Bacteria | 2245 |
| 149 | Ga0207640_10012327 | 3300025981 | Bacteria | 4865 |
| 150 | Ga0207640_10068954 | 3300025981 | Bacteria | 2372 |
| 151 | Ga0207639_10102736 | 3300026041 | Bacteria | 2314 |
| 152 | Ga0207678_10055037 | 3300026067 | Bacteria | 3427 |
| 153 | Ga0207702_10012160 | 3300026078 | Bacteria | 7162 |
| 154 | Ga0207702_10275233 | 3300026078 | Bacteria | 1589 |
| 155 | Ga0207641_10072485 | 3300026088 | Bacteria | 2966 |
| 156 | Ga0207674_10010381 | 3300026116 | Bacteria | 10554 |
| 157 | Ga0207675_100014410 | 3300026118 | Bacteria | 7370 |
| 158 | Ga0207698_10005494 | 3300026142 | Bacteria | 7842 |
| 159 | Ga0209371_1000513 | 3300027312 | Bacteria | 36998 |
| 160 | Ga0265356_1005464 | 3300028017 | Bacteria | 1515 |
| 161 | Ga0268266_10093672 | 3300028379 | Bacteria | 2636 |
| 162 | Ga0268266_10359699 | 3300028379 | Bacteria | 1369 |
| 163 | Ga0265334_10043857 | 3300028573 | Bacteria | 1739 |
| 164 | Ga0265336_10014015 | 3300028666 | Bacteria | 2663 |
| 165 | Ga0265338_10002352 | 3300028800 | Bacteria | 28548 |
| 166 | Ga0265338_10002845 | 3300028800 | Bacteria | 25287 |
| 167 | Ga0265338_10032103 | 3300028800 | Bacteria | 5132 |
| 168 | Ga0265338_10061447 | 3300028800 | Bacteria | 3293 |
| 169 | Ga0268256_1000441 | 3300030500 | Bacteria | 36967 |
| 170 | Ga0265330_10000252 | 3300031235 | Bacteria | 40011 |
| 171 | Ga0265330_10000498 | 3300031235 | Bacteria | 26268 |
| 172 | Ga0265332_10002353 | 3300031238 | Bacteria | 9645 |
| 173 | Ga0265332_10063477 | 3300031238 | Bacteria | 1578 |
| 174 | Ga0265328_10002804 | 3300031239 | Bacteria | 7801 |
| 175 | Ga0265328_10002920 | 3300031239 | Bacteria | 7628 |
| 176 | Ga0265320_10049291 | 3300031240 | Bacteria | 2051 |
| 177 | Ga0265325_10000356 | 3300031241 | Bacteria | 32238 |
| 178 | Ga0265325_10002088 | 3300031241 | Bacteria | 13652 |
| 179 | Ga0265325_10048286 | 3300031241 | Bacteria | 2200 |
| 180 | Ga0265325_10083445 | 3300031241 | Bacteria | 1585 |
| 181 | Ga0265340_10002404 | 3300031247 | Bacteria | 10648 |
| 182 | Ga0265339_10000100 | 3300031249 | Bacteria | 72186 |
| 183 | Ga0265339_10000235 | 3300031249 | Bacteria | 44859 |
| 184 | Ga0265339_10000447 | 3300031249 | Bacteria | 32333 |
| 185 | Ga0265339_10009080 | 3300031249 | Bacteria | 6281 |
| 186 | Ga0265339_10032988 | 3300031249 | Bacteria | 2919 |
| 187 | Ga0265316_10000483 | 3300031344 | Bacteria | 45211 |
| 188 | Ga0265316_10002001 | 3300031344 | Bacteria | 21464 |
| 189 | Ga0265316_10062503 | 3300031344 | Bacteria | 2889 |
| 190 | Ga0265316_10070495 | 3300031344 | Bacteria | 2696 |
| 191 | Ga0265313_10001676 | 3300031595 | Bacteria | 20495 |
| 192 | Ga0265313_10002317 | 3300031595 | Bacteria | 16687 |
| 193 | Ga0265313_10030254 | 3300031595 | Bacteria | 2790 |
| 194 | Ga0265314_10000195 | 3300031711 | Bacteria | 90391 |
| 195 | Ga0265314_10002098 | 3300031711 | Bacteria | 20978 |
| 196 | Ga0265314_10073980 | 3300031711 | Bacteria | 2270 |
| 197 | Ga0265342_10000469 | 3300031712 | Bacteria | 43738 |
| 198 | Ga0265342_10001091 | 3300031712 | Bacteria | 26110 |
| 199 | Ga0265342_10015378 | 3300031712 | Bacteria | 5035 |
| 200 | Ga0265342_10068220 | 3300031712 | Bacteria | 2079 |
| 201 | Ga0265342_10108199 | 3300031712 | Bacteria | 1576 |
| 202 | Ga0265342_10149621 | 3300031712 | Bacteria | 1297 |
| 203 | Ga0395899_0204578 | 3300037312 | Bacteria | 1374 |
| 204 | Ga0395900_0035364 | 3300037418 | Bacteria | 5144 |
| 205 | Ga0395900_0098645 | 3300037418 | Bacteria | 3002 |
| 206 | Ga0395900_0325672 | 3300037418 | Bacteria | 1516 |
| 207 | Ga0395898_0356147 | 3300037466 | Bacteria | 1395 |
| 208 | Ga0395905_0000690 | 3300037471 | Bacteria | 44713 |
| 209 | Ga0395905_0117059 | 3300037471 | Bacteria | 2504 |
| 210 | Ga0395905_0118093 | 3300037471 | Bacteria | 2493 |
| 211 | Ga0395905_0211907 | 3300037471 | Bacteria | 1815 |
| 212 | Ga0395905_0226666 | 3300037471 | Bacteria | 1748 |
| 213 | Ga0395905_0258972 | 3300037471 | Bacteria | 1624 |
| 214 | Ga0436364_0764407 | 3300037853 | Bacteria | 11998 |
| 215 | Ga0436364_1519815 | 3300037853 | Bacteria | 1749 |
| 216 | Ga0395901_0029295 | 3300038443 | Bacteria | 5666 |
| 217 | Ga0395901_0032436 | 3300038443 | Bacteria | 5389 |
| 218 | Ga0395901_0367065 | 3300038443 | Bacteria | 1483 |
| 219 | Ga0237819_00250 | 3300038705 | Bacteria | 19601 |
| 220 | Ga0436365_0794411 | 3300039437 | Bacteria | 78184 |
| 221 | Ga0436365_1592832 | 3300039437 | Bacteria | 3187 |
| 222 | Ga0436361_0284344 | 3300039447 | Bacteria | 76533 |
| 223 | Ga0436363_1126952 | 3300039450 | Bacteria | 1834 |
| 224 | Ga0439462_0058069 | 3300042015 | Bacteria | 1045 |
| 225 | Ga0466968_0000819 | 3300044735 | Bacteria | 10822 |
| 226 | Ga0495643_0157587 | 3300046522 | Bacteria | 1119 |
| 227 | Ga0495645_0218783 | 3300046543 | Bacteria | 1282 |
| 228 | Ga0495645_0253694 | 3300046543 | Bacteria | 1168 |
| 229 | Ga0495636_0022446 | 3300047318 | Bacteria | 2551 |
| 230 | Ga0495672_0040014 | 3300047320 | Bacteria | 2846 |
| 231 | Ga0495686_0000026 | 3300047472 | Bacteria | 383637 |
| 232 | Ga0495686_0043061 | 3300047472 | Bacteria | 2865 |
| 233 | Ga0496102_0199068 | 3300048905 | Bacteria | 1888 |
| 234 | Ga0496104_0074492 | 3300048907 | Bacteria | 3232 |
| 235 | Ga0496105_0092520 | 3300048908 | Bacteria | 2497 |
| 236 | Ga0496106_0384177 | 3300048909 | Bacteria | 1128 |
| 237 | Ga0496111_0196438 | 3300048914 | Bacteria | 1500 |
| 238 | Ga0496115_0107365 | 3300048918 | Bacteria | 2292 |
| 239 | Ga0496117_0001262 | 3300048920 | Bacteria | 37592 |
| 240 | Ga0496117_0066387 | 3300048920 | Bacteria | 2448 |
| 241 | Ga0496118_0000228 | 3300048921 | Bacteria | 98198 |
| 242 | Ga0496118_0008099 | 3300048921 | Bacteria | 10954 |
| 243 | Ga0496118_0043706 | 3300048921 | Bacteria | 3518 |
| 244 | Ga0496119_0000091 | 3300048922 | Bacteria | 133090 |
| 245 | Ga0496120_0005081 | 3300048923 | Bacteria | 10647 |
| 246 | Ga0496121_0000044 | 3300048924 | Bacteria | 337672 |
| 247 | Ga0496122_0000770 | 3300048925 | Bacteria | 61729 |
| 248 | Ga0496122_0038415 | 3300048925 | Bacteria | 3837 |
| 249 | Ga0496122_0064712 | 3300048925 | Bacteria | 2658 |
| 250 | Ga0496122_0071923 | 3300048925 | Bacteria | 2462 |
| 251 | Ga0496123_0000018 | 3300048926 | Bacteria | 404553 |
| 252 | Ga0496123_0042610 | 3300048926 | Bacteria | 3130 |
| 253 | Ga0496123_0052593 | 3300048926 | Bacteria | 2701 |
| 254 | Ga0496124_0003217 | 3300048927 | Bacteria | 20178 |
| 255 | Ga0496125_0000145 | 3300048928 | Bacteria | 156267 |
| 256 | Ga0496125_0000575 | 3300048928 | Bacteria | 62850 |
| 257 | Ga0496125_0001173 | 3300048928 | Bacteria | 39668 |
| 258 | Ga0496125_0003607 | 3300048928 | Bacteria | 18580 |
| 259 | Ga0496125_0080859 | 3300048928 | Bacteria | 2485 |
| 260 | Ga0496126_0000018 | 3300048929 | Bacteria | 581170 |
| 261 | Ga0496126_0001062 | 3300048929 | Bacteria | 46308 |
| 262 | Ga0496126_0138324 | 3300048929 | Bacteria | 2098 |
| 263 | Ga0496126_0172562 | 3300048929 | Bacteria | 1841 |
| 264 | Ga0501031_0026807 | 3300049568 | Bacteria | 3756 |
| 265 | Ga0501032_0034759 | 3300049569 | Bacteria | 3448 |
| 266 | Ga0501032_0043696 | 3300049569 | Bacteria | 3033 |
| 267 | Ga0501033_0002968 | 3300049570 | Bacteria | 14169 |
| 268 | Ga0501033_0050306 | 3300049570 | Bacteria | 3092 |
| 269 | Ga0501034_0093510 | 3300049571 | Bacteria | 3003 |
| 270 | Ga0501034_0144013 | 3300049571 | Bacteria | 2361 |
| 271 | Ga0501036_0139056 | 3300049572 | Bacteria | 2049 |
| 272 | Ga0501036_0141144 | 3300049572 | Bacteria | 2033 |
| 273 | Ga0501037_0008956 | 3300049573 | Bacteria | 7333 |
| 274 | Ga0501038_0007372 | 3300049574 | Bacteria | 10146 |
| 275 | Ga0501040_0080040 | 3300049576 | Bacteria | 2262 |
| 276 | Ga0501042_0090064 | 3300049578 | Bacteria | 2201 |
| 277 | Ga0501043_0005468 | 3300049579 | Bacteria | 10270 |
| 278 | Ga0501046_0085081 | 3300049580 | Bacteria | 2438 |
| 279 | Ga0501048_0053861 | 3300049582 | Bacteria | 2858 |
| 280 | Ga0501068_0012223 | 3300049584 | Bacteria | 4856 |
| 281 | Ga0501070_0250046 | 3300049586 | Bacteria | 1450 |
| 282 | Ga0501071_0094555 | 3300049587 | Bacteria | 2198 |
| 283 | Ga0501073_0000087 | 3300049589 | Bacteria | 58557 |
| 284 | Ga0501073_0064394 | 3300049589 | Bacteria | 2556 |
| 285 | Ga0501074_0014520 | 3300049590 | Bacteria | 5730 |
| 286 | Ga0501075_0101722 | 3300049591 | Bacteria | 2182 |
| 287 | Ga0501077_0015186 | 3300049593 | Bacteria | 4843 |
| 288 | Ga0501079_0065520 | 3300049741 | Bacteria | 2802 |
| 289 | Ga0501080_0044152 | 3300049742 | Bacteria | 4149 |
| 290 | Ga0501081_0243175 | 3300049743 | Bacteria | 1312 |
| 291 | Ga0501083_0009631 | 3300049744 | Bacteria | 6825 |
| 292 | Ga0501035_0006965 | 3300049822 | Bacteria | 10558 |
| 293 | Ga0501035_0091412 | 3300049822 | Bacteria | 2679 |
| 294 | Ga0501044_0002558 | 3300049823 | Bacteria | 20715 |
| 295 | Ga0501045_0083057 | 3300049824 | Bacteria | 2362 |
| 296 | nmdc:mga03683_53129_c1 | 3300050489 | Bacteria | 1695 |
| 297 | nmdc:mga0yw44_11478_c1 | 3300050492 | Bacteria | 4576 |
| 298 | nmdc:mga0k408_41045_c1 | 3300050493 | Bacteria | 2663 |
| 299 | nmdc:mga05p37_98139_c1 | 3300050507 | Bacteria | 3608 |
| 300 | nmdc:mga0n895_289246_c1 | 3300050512 | Bacteria | 1661 |
| 301 | nmdc:mga0n895_49801_c1 | 3300050512 | Bacteria | 4106 |
| 302 | nmdc:mga0a205_274345_c1 | 3300050515 | Bacteria | 1563 |
| 303 | nmdc:mga0sz30_15592_c1 | 3300050516 | Bacteria | 3005 |
| 304 | nmdc:mga0sz30_91425_c1 | 3300050516 | Bacteria | 1324 |
| 305 | Ga0500562_002952 | 3300053108 | Bacteria | 4243 |
| 306 | Ga0500572_051091 | 3300053111 | Bacteria | 1232 |
| 307 | Ga0500568_0000156 | 3300053139 | Bacteria | 59014 |
| 308 | Ga0500568_0012335 | 3300053139 | Bacteria | 3935 |
| 309 | Ga0500577_0021639 | 3300053142 | Bacteria | 2122 |
| 310 | Ga0500616_0000245 | 3300053153 | Bacteria | 84999 |
| 311 | Ga0501082_0261094 | 3300060353 | Bacteria | 1507 |
| 312 | Ga0530510_0209706 | 3300061734 | Bacteria | 1447 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2852618963 | 2852619120 | 276 |
| 2 | 3300048909 | Ga0496106_0384177 | Ga0496106_0384177_10_984 | 320 |
| 3 | 3300038705 | Ga0237819_00250 | Ga0237819_00250_1191_2243 | 323 |
| 4 | 3300005344 | Ga0070661_100000006 | Ga0070661_10000000661 | 324 |
| 5 | 3300025920 | Ga0207649_10000058 | Ga0207649_1000005864 | 324 |
| 6 | 3300048922 | Ga0496119_0000091 | Ga0496119_0000091_99781_100773 | 328 |
| 7 | 3300048923 | Ga0496120_0005081 | Ga0496120_0005081_781_1773 | 328 |
| 8 | 3300042015 | Ga0439462_0058069 | Ga0439462_0058069_10_1011 | 330 |
| 9 | 3300006038 | Ga0075365_10035810 | Ga0075365_100358102 | 332 |
| 10 | 3300006038 | Ga0075365_10067873 | Ga0075365_100678732 | 332 |
| 11 | 3300048929 | Ga0496126_0172562 | Ga0496126_0172562_359_1375 | 332 |
| 12 | 3300050492 | nmdc:mga0yw44_11478_c1 | nmdc:mga0yw44_11478_c1_2707_3723 | 332 |
| 13 | 3300053108 | Ga0500562_002952 | Ga0500562_002952_2586_3602 | 332 |
| 14 | 3300049569 | Ga0501032_0034759 | Ga0501032_0034759_393_1397 | 333 |
| 15 | 3300049570 | Ga0501033_0050306 | Ga0501033_0050306_1009_2013 | 333 |
| 16 | 3300049571 | Ga0501034_0144013 | Ga0501034_0144013_208_1212 | 333 |
| 17 | 3300049572 | Ga0501036_0141144 | Ga0501036_0141144_382_1386 | 333 |
| 18 | 3300049574 | Ga0501038_0007372 | Ga0501038_0007372_359_1363 | 333 |
| 19 | 3300049589 | Ga0501073_0000087 | Ga0501073_0000087_48823_49842 | 333 |
| 20 | 3300050516 | nmdc:mga0sz30_15592_c1 | nmdc:mga0sz30_15592_c1_1150_2169 | 333 |
| 21 | 3300053139 | Ga0500568_0012335 | Ga0500568_0012335_1978_2994 | 333 |
| 22 | 3300005338 | Ga0068868_100149132 | Ga0068868_1001491322 | 334 |
| 23 | 3300005563 | Ga0068855_100005621 | Ga0068855_10000562116 | 334 |
| 24 | 3300005563 | Ga0068855_100015967 | Ga0068855_1000159679 | 334 |
| 25 | 3300009545 | Ga0105237_10023373 | Ga0105237_100233734 | 334 |
| 26 | 3300025914 | Ga0207671_10022412 | Ga0207671_100224124 | 334 |
| 27 | 3300025949 | Ga0207667_10039384 | Ga0207667_100393845 | 334 |
| 28 | 3300048921 | Ga0496118_0043706 | Ga0496118_0043706_1841_2878 | 334 |
| 29 | iso_pu_bacteria | 2909399089 | 2909400564 | 334 |
| 30 | iso_pu_bacteria | 2751185800 | 2753360973 | 336 |
| 31 | iso_pu_bacteria | 2758568016 | 2758637807 | 336 |
| 32 | iso_pu_bacteria | 2891373044 | 2891376838 | 336 |
| 33 | iso_pu_bacteria | 2898795034 | 2898797914 | 336 |
| 34 | 3300037418 | Ga0395900_0325672 | Ga0395900_0325672_430_1476 | 337 |
| 35 | 3300037471 | Ga0395905_0118093 | Ga0395905_0118093_197_1243 | 337 |
| 36 | 3300050512 | nmdc:mga0n895_49801_c1 | nmdc:mga0n895_49801_c1_2673_3689 | 337 |
| 37 | iso_pu_bacteria | 2521172590 | 2521560470 | 337 |
| 38 | iso_pu_bacteria | 2551306416 | 2553005590 | 337 |
| 39 | iso_pu_bacteria | 2765235838 | 2765571705 | 337 |
| 40 | iso_pu_bacteria | 2808606386 | 2808982237 | 337 |
| 41 | iso_pu_bacteria | 2808606415 | 2809129963 | 337 |
| 42 | iso_pu_bacteria | 2808606419 | 2809148982 | 337 |
| 43 | iso_pu_bacteria | 2818991449 | 2819617138 | 337 |
| 44 | iso_pu_bacteria | 2839094727 | 2839098570 | 337 |
| 45 | iso_pu_bacteria | 2904439833 | 2904442768 | 337 |
| 46 | iso_pu_bacteria | 2904530477 | 2904535019 | 337 |
| 47 | iso_pu_bacteria | 2904584206 | 2904588643 | 337 |
| 48 | iso_pu_bacteria | 2904589729 | 2904594283 | 337 |
| 49 | iso_pu_bacteria | 2904601388 | 2904604875 | 337 |
| 50 | iso_pu_bacteria | 2919046199 | 2919048708 | 337 |
| 51 | iso_pu_bacteria | 2919079590 | 2919083113 | 337 |
| 52 | iso_pu_bacteria | 2923510766 | 2923514259 | 337 |
| 53 | iso_pu_bacteria | 2928130867 | 2928132970 | 337 |
| 54 | iso_pu_bacteria | 2728369276 | 2729909348 | 338 |
| 55 | iso_pu_bacteria | 2818991440 | 2819562858 | 338 |
| 56 | iso_pu_bacteria | 2884338543 | 2884340629 | 338 |
| 57 | iso_pu_bacteria | 2904463128 | 2904463469 | 338 |
| 58 | iso_pu_bacteria | 2941471342 | 2941475895 | 338 |
| 59 | 3300039450 | Ga0436363_1126952 | Ga0436363_1126952_84_1112 | 339 |
| 60 | iso_pu_bacteria | 2808606384 | 2808973570 | 339 |
| 61 | iso_pu_bacteria | 2808606390 | 2809008419 | 339 |
| 62 | iso_pu_bacteria | 2808606391 | 2809015243 | 339 |
| 63 | 3300006195 | Ga0075366_10051672 | Ga0075366_100516722 | 340 |
| 64 | 3300006353 | Ga0075370_10221356 | Ga0075370_102213561 | 340 |
| 65 | 3300006871 | Ga0075434_100046865 | Ga0075434_1000468651 | 340 |
| 66 | 3300009147 | Ga0114129_10176761 | Ga0114129_101767613 | 340 |
| 67 | 3300021361 | Ga0213872_10043198 | Ga0213872_100431982 | 340 |
| 68 | 3300025294 | Ga0209025_1000416 | Ga0209025_100041644 | 340 |
| 69 | 3300028379 | Ga0268266_10093672 | Ga0268266_100936721 | 340 |
| 70 | 3300031344 | Ga0265316_10070495 | Ga0265316_100704953 | 340 |
| 71 | 3300031711 | Ga0265314_10073980 | Ga0265314_100739801 | 340 |
| 72 | 3300031712 | Ga0265342_10108199 | Ga0265342_101081991 | 340 |
| 73 | 3300046522 | Ga0495643_0157587 | Ga0495643_0157587_48_1073 | 340 |
| 74 | 3300047318 | Ga0495636_0022446 | Ga0495636_0022446_865_1890 | 340 |
| 75 | 3300047320 | Ga0495672_0040014 | Ga0495672_0040014_280_1305 | 340 |
| 76 | 3300048914 | Ga0496111_0196438 | Ga0496111_0196438_194_1222 | 340 |
| 77 | 3300048918 | Ga0496115_0107365 | Ga0496115_0107365_657_1682 | 340 |
| 78 | 3300048920 | Ga0496117_0001262 | Ga0496117_0001262_23230_24255 | 340 |
| 79 | 3300048925 | Ga0496122_0000770 | Ga0496122_0000770_38507_39532 | 340 |
| 80 | 3300048925 | Ga0496122_0038415 | Ga0496122_0038415_67_1092 | 340 |
| 81 | 3300048925 | Ga0496122_0064712 | Ga0496122_0064712_377_1402 | 340 |
| 82 | 3300048926 | Ga0496123_0000018 | Ga0496123_0000018_154950_155975 | 340 |
| 83 | 3300048927 | Ga0496124_0003217 | Ga0496124_0003217_18654_19679 | 340 |
| 84 | 3300048928 | Ga0496125_0000145 | Ga0496125_0000145_102685_103710 | 340 |
| 85 | 3300048928 | Ga0496125_0000575 | Ga0496125_0000575_40557_41582 | 340 |
| 86 | 3300048928 | Ga0496125_0001173 | Ga0496125_0001173_16375_17400 | 340 |
| 87 | 3300048928 | Ga0496125_0003607 | Ga0496125_0003607_10391_11416 | 340 |
| 88 | 3300048929 | Ga0496126_0001062 | Ga0496126_0001062_2685_3710 | 340 |
| 89 | 3300049568 | Ga0501031_0026807 | Ga0501031_0026807_759_1784 | 340 |
| 90 | 3300049569 | Ga0501032_0043696 | Ga0501032_0043696_1178_2203 | 340 |
| 91 | 3300049570 | Ga0501033_0002968 | Ga0501033_0002968_6463_7488 | 340 |
| 92 | 3300049572 | Ga0501036_0139056 | Ga0501036_0139056_795_1820 | 340 |
| 93 | 3300049573 | Ga0501037_0008956 | Ga0501037_0008956_298_1323 | 340 |
| 94 | 3300049576 | Ga0501040_0080040 | Ga0501040_0080040_254_1279 | 340 |
| 95 | 3300049578 | Ga0501042_0090064 | Ga0501042_0090064_759_1784 | 340 |
| 96 | 3300049579 | Ga0501043_0005468 | Ga0501043_0005468_7142_8167 | 340 |
| 97 | 3300049580 | Ga0501046_0085081 | Ga0501046_0085081_631_1656 | 340 |
| 98 | 3300049582 | Ga0501048_0053861 | Ga0501048_0053861_1051_2076 | 340 |
| 99 | 3300049584 | Ga0501068_0012223 | Ga0501068_0012223_1639_2664 | 340 |
| 100 | 3300049587 | Ga0501071_0094555 | Ga0501071_0094555_391_1416 | 340 |
| 101 | 3300049589 | Ga0501073_0064394 | Ga0501073_0064394_927_1952 | 340 |
| 102 | 3300049590 | Ga0501074_0014520 | Ga0501074_0014520_3821_4846 | 340 |
| 103 | 3300049591 | Ga0501075_0101722 | Ga0501075_0101722_236_1261 | 340 |
| 104 | 3300049593 | Ga0501077_0015186 | Ga0501077_0015186_126_1151 | 340 |
| 105 | 3300049741 | Ga0501079_0065520 | Ga0501079_0065520_794_1819 | 340 |
| 106 | 3300049742 | Ga0501080_0044152 | Ga0501080_0044152_1334_2359 | 340 |
| 107 | 3300049743 | Ga0501081_0243175 | Ga0501081_0243175_11_1036 | 340 |
| 108 | 3300049744 | Ga0501083_0009631 | Ga0501083_0009631_602_1627 | 340 |
| 109 | 3300049822 | Ga0501035_0006965 | Ga0501035_0006965_2321_3346 | 340 |
| 110 | 3300049824 | Ga0501045_0083057 | Ga0501045_0083057_1069_2094 | 340 |
| 111 | 3300050489 | nmdc:mga03683_53129_c1 | nmdc:mga03683_53129_c1_265_1290 | 340 |
| 112 | 3300050493 | nmdc:mga0k408_41045_c1 | nmdc:mga0k408_41045_c1_1308_2333 | 340 |
| 113 | 3300050507 | nmdc:mga05p37_98139_c1 | nmdc:mga05p37_98139_c1_770_1798 | 340 |
| 114 | 3300050512 | nmdc:mga0n895_289246_c1 | nmdc:mga0n895_289246_c1_163_1197 | 340 |
| 115 | 3300050515 | nmdc:mga0a205_274345_c1 | nmdc:mga0a205_274345_c1_368_1396 | 340 |
| 116 | 3300050516 | nmdc:mga0sz30_91425_c1 | nmdc:mga0sz30_91425_c1_125_1150 | 340 |
| 117 | 3300053139 | Ga0500568_0000156 | Ga0500568_0000156_28923_29948 | 340 |
| 118 | 3300053142 | Ga0500577_0021639 | Ga0500577_0021639_298_1323 | 340 |
| 119 | 3300053153 | Ga0500616_0000245 | Ga0500616_0000245_40035_41060 | 340 |
| 120 | 3300061734 | Ga0530510_0209706 | Ga0530510_0209706_269_1294 | 340 |
| 121 | 3300003751 | Ga0055538_1000024 | Ga0055538_1000024225 | 341 |
| 122 | 3300003752 | Ga0055539_1000031 | Ga0055539_1000031225 | 341 |
| 123 | 3300003756 | Ga0055533_1000041 | Ga0055533_1000041225 | 341 |
| 124 | 3300003759 | Ga0055525_1000049 | Ga0055525_1000049225 | 341 |
| 125 | 3300003841 | Ga0055541_1000022 | Ga0055541_1000022225 | 341 |
| 126 | 3300005563 | Ga0068855_100004458 | Ga0068855_1000044582 | 341 |
| 127 | 3300005578 | Ga0068854_100052253 | Ga0068854_1000522532 | 341 |
| 128 | 3300005834 | Ga0068851_10100141 | Ga0068851_101001412 | 341 |
| 129 | 3300005834 | Ga0068851_10124297 | Ga0068851_101242972 | 341 |
| 130 | 3300009036 | Ga0105244_10033895 | Ga0105244_100338951 | 341 |
| 131 | 3300009093 | Ga0105240_10139807 | Ga0105240_101398072 | 341 |
| 132 | 3300009093 | Ga0105240_10239393 | Ga0105240_102393932 | 341 |
| 133 | 3300009545 | Ga0105237_10016078 | Ga0105237_100160786 | 341 |
| 134 | 3300009551 | Ga0105238_10000355 | Ga0105238_1000035547 | 341 |
| 135 | 3300009551 | Ga0105238_10363640 | Ga0105238_103636402 | 341 |
| 136 | 3300010375 | Ga0105239_10013108 | Ga0105239_100131088 | 341 |
| 137 | 3300010375 | Ga0105239_10114431 | Ga0105239_101144313 | 341 |
| 138 | 3300015261 | Ga0182006_1012269 | Ga0182006_10122694 | 341 |
| 139 | 3300021388 | Ga0213875_10024051 | Ga0213875_100240512 | 341 |
| 140 | 3300025224 | Ga0209784_100018 | Ga0209784_100018224 | 341 |
| 141 | 3300025225 | Ga0209566_100016 | Ga0209566_100016224 | 341 |
| 142 | 3300025226 | Ga0209674_100030 | Ga0209674_100030224 | 341 |
| 143 | 3300025230 | Ga0209563_100034 | Ga0209563_100034224 | 341 |
| 144 | 3300025253 | Ga0209677_100019 | Ga0209677_100019224 | 341 |
| 145 | 3300025321 | Ga0207656_10021178 | Ga0207656_100211782 | 341 |
| 146 | 3300025321 | Ga0207656_10086520 | Ga0207656_100865201 | 341 |
| 147 | 3300025913 | Ga0207695_10003906 | Ga0207695_1000390615 | 341 |
| 148 | 3300025913 | Ga0207695_10030343 | Ga0207695_100303432 | 341 |
| 149 | 3300025913 | Ga0207695_10260361 | Ga0207695_102603612 | 341 |
| 150 | 3300025914 | Ga0207671_10002093 | Ga0207671_100020936 | 341 |
| 151 | 3300025924 | Ga0207694_10000236 | Ga0207694_100002367 | 341 |
| 152 | 3300025949 | Ga0207667_10000044 | Ga0207667_10000044212 | 341 |
| 153 | 3300025949 | Ga0207667_10029725 | Ga0207667_100297255 | 341 |
| 154 | 3300025981 | Ga0207640_10012327 | Ga0207640_100123274 | 341 |
| 155 | 3300037853 | Ga0436364_0764407 | Ga0436364_0764407_4998_6026 | 341 |
| 156 | 3300048926 | Ga0496123_0052593 | Ga0496123_0052593_187_1263 | 341 |
| 157 | 3300002773 | JGI25152J39213_1000240 | JGI25152J39213_100024034 | 342 |
| 158 | 3300002774 | JGI25150J39212_1000170 | JGI25150J39212_100017034 | 342 |
| 159 | 3300003187 | JGI25151J46595_10000109 | JGI25151J46595_100001092 | 342 |
| 160 | 3300003215 | JGI25153J46596_10000084 | JGI25153J46596_100000842 | 342 |
| 161 | 3300005327 | Ga0070658_10000199 | Ga0070658_1000019920 | 342 |
| 162 | 3300005327 | Ga0070658_10119267 | Ga0070658_101192672 | 342 |
| 163 | 3300005347 | Ga0070668_100012366 | Ga0070668_1000123665 | 342 |
| 164 | 3300005366 | Ga0070659_100201627 | Ga0070659_1002016271 | 342 |
| 165 | 3300005441 | Ga0070700_100020375 | Ga0070700_1000203753 | 342 |
| 166 | 3300005457 | Ga0070662_100117925 | Ga0070662_1001179251 | 342 |
| 167 | 3300005563 | Ga0068855_100033215 | Ga0068855_1000332154 | 342 |
| 168 | 3300005564 | Ga0070664_100056065 | Ga0070664_1000560653 | 342 |
| 169 | 3300005578 | Ga0068854_100261863 | Ga0068854_1002618632 | 342 |
| 170 | 3300005614 | Ga0068856_100033278 | Ga0068856_1000332785 | 342 |
| 171 | 3300005718 | Ga0068866_10024620 | Ga0068866_100246203 | 342 |
| 172 | 3300005719 | Ga0068861_100124354 | Ga0068861_1001243542 | 342 |
| 173 | 3300005983 | Ga0081540_1075525 | Ga0081540_10755251 | 342 |
| 174 | 3300006358 | Ga0068871_100295223 | Ga0068871_1002952231 | 342 |
| 175 | 3300009148 | Ga0105243_10067369 | Ga0105243_100673692 | 342 |
| 176 | 3300009176 | Ga0105242_10113588 | Ga0105242_101135882 | 342 |
| 177 | 3300013102 | Ga0157371_10236242 | Ga0157371_102362422 | 342 |
| 178 | 3300013104 | Ga0157370_10142932 | Ga0157370_101429321 | 342 |
| 179 | 3300013105 | Ga0157369_10001712 | Ga0157369_1000171226 | 342 |
| 180 | 3300013105 | Ga0157369_10014477 | Ga0157369_1001447710 | 342 |
| 181 | 3300013306 | Ga0163162_10181881 | Ga0163162_101818812 | 342 |
| 182 | 3300013307 | Ga0157372_10054919 | Ga0157372_100549193 | 342 |
| 183 | 3300014326 | Ga0157380_10043879 | Ga0157380_100438793 | 342 |
| 184 | 3300020075 | Ga0206349_1264054 | Ga0206349_12640541 | 342 |
| 185 | 3300021361 | Ga0213872_10000181 | Ga0213872_100001814 | 342 |
| 186 | 3300021384 | Ga0213876_10001649 | Ga0213876_100016496 | 342 |
| 187 | 3300025245 | Ga0207425_1000290 | Ga0207425_10002902 | 342 |
| 188 | 3300025258 | Ga0209129_1000202 | Ga0209129_10002022 | 342 |
| 189 | 3300025263 | Ga0209565_1003537 | Ga0209565_10035374 | 342 |
| 190 | 3300025294 | Ga0209025_1000013 | Ga0209025_10000132 | 342 |
| 191 | 3300025297 | Ga0209758_1000014 | Ga0209758_10000142 | 342 |
| 192 | 3300025303 | Ga0209051_1006470 | Ga0209051_10064709 | 342 |
| 193 | 3300025904 | Ga0207647_10000056 | Ga0207647_1000005672 | 342 |
| 194 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002715 | 342 |
| 195 | 3300025909 | Ga0207705_10038006 | Ga0207705_100380064 | 342 |
| 196 | 3300025909 | Ga0207705_10074813 | Ga0207705_100748132 | 342 |
| 197 | 3300025909 | Ga0207705_10104647 | Ga0207705_101046472 | 342 |
| 198 | 3300025909 | Ga0207705_10200748 | Ga0207705_102007482 | 342 |
| 199 | 3300025919 | Ga0207657_10219672 | Ga0207657_102196722 | 342 |
| 200 | 3300025920 | Ga0207649_10129671 | Ga0207649_101296711 | 342 |
| 201 | 3300025923 | Ga0207681_10306074 | Ga0207681_103060741 | 342 |
| 202 | 3300025933 | Ga0207706_10039254 | Ga0207706_100392543 | 342 |
| 203 | 3300025972 | Ga0207668_10090605 | Ga0207668_100906052 | 342 |
| 204 | 3300026041 | Ga0207639_10102736 | Ga0207639_101027362 | 342 |
| 205 | 3300026067 | Ga0207678_10055037 | Ga0207678_100550373 | 342 |
| 206 | 3300026078 | Ga0207702_10275233 | Ga0207702_102752331 | 342 |
| 207 | 3300026118 | Ga0207675_100014410 | Ga0207675_1000144107 | 342 |
| 208 | 3300027312 | Ga0209371_1000513 | Ga0209371_100051320 | 342 |
| 209 | 3300028017 | Ga0265356_1005464 | Ga0265356_10054641 | 342 |
| 210 | 3300030500 | Ga0268256_1000441 | Ga0268256_100044120 | 342 |
| 211 | 3300031241 | Ga0265325_10048286 | Ga0265325_100482863 | 342 |
| 212 | 3300031595 | Ga0265313_10030254 | Ga0265313_100302544 | 342 |
| 213 | 3300031712 | Ga0265342_10068220 | Ga0265342_100682202 | 342 |
| 214 | 3300037312 | Ga0395899_0204578 | Ga0395899_0204578_121_1170 | 342 |
| 215 | 3300037418 | Ga0395900_0035364 | Ga0395900_0035364_1716_2765 | 342 |
| 216 | 3300037418 | Ga0395900_0098645 | Ga0395900_0098645_1536_2585 | 342 |
| 217 | 3300037466 | Ga0395898_0356147 | Ga0395898_0356147_216_1265 | 342 |
| 218 | 3300037471 | Ga0395905_0000690 | Ga0395905_0000690_3626_4672 | 342 |
| 219 | 3300037471 | Ga0395905_0117059 | Ga0395905_0117059_909_1955 | 342 |
| 220 | 3300037471 | Ga0395905_0211907 | Ga0395905_0211907_362_1411 | 342 |
| 221 | 3300037471 | Ga0395905_0226666 | Ga0395905_0226666_311_1357 | 342 |
| 222 | 3300037471 | Ga0395905_0258972 | Ga0395905_0258972_310_1377 | 342 |
| 223 | 3300038443 | Ga0395901_0029295 | Ga0395901_0029295_1159_2208 | 342 |
| 224 | 3300038443 | Ga0395901_0032436 | Ga0395901_0032436_4162_5211 | 342 |
| 225 | 3300038443 | Ga0395901_0367065 | Ga0395901_0367065_101_1147 | 342 |
| 226 | 3300039437 | Ga0436365_0794411 | Ga0436365_0794411_44111_45157 | 342 |
| 227 | 3300039447 | Ga0436361_0284344 | Ga0436361_0284344_30498_31544 | 342 |
| 228 | 3300044735 | Ga0466968_0000819 | Ga0466968_0000819_3970_5037 | 342 |
| 229 | 3300046543 | Ga0495645_0253694 | Ga0495645_0253694_98_1129 | 342 |
| 230 | 3300047472 | Ga0495686_0000026 | Ga0495686_0000026_57790_58830 | 342 |
| 231 | 3300047472 | Ga0495686_0043061 | Ga0495686_0043061_267_1319 | 342 |
| 232 | 3300048905 | Ga0496102_0199068 | Ga0496102_0199068_725_1765 | 342 |
| 233 | 3300048920 | Ga0496117_0066387 | Ga0496117_0066387_42_1082 | 342 |
| 234 | 3300048921 | Ga0496118_0000228 | Ga0496118_0000228_89079_90119 | 342 |
| 235 | 3300048921 | Ga0496118_0008099 | Ga0496118_0008099_1401_2441 | 342 |
| 236 | 3300048924 | Ga0496121_0000044 | Ga0496121_0000044_315603_316646 | 342 |
| 237 | 3300048925 | Ga0496122_0071923 | Ga0496122_0071923_41_1081 | 342 |
| 238 | 3300048926 | Ga0496123_0042610 | Ga0496123_0042610_2017_3057 | 342 |
| 239 | 3300048928 | Ga0496125_0080859 | Ga0496125_0080859_1389_2429 | 342 |
| 240 | 3300048929 | Ga0496126_0138324 | Ga0496126_0138324_32_1072 | 342 |
| 241 | 3300049571 | Ga0501034_0093510 | Ga0501034_0093510_1043_2089 | 342 |
| 242 | 3300000546 | LJNas_1002031 | LJNas_10020311 | 343 |
| 243 | 3300005327 | Ga0070658_10031456 | Ga0070658_100314562 | 343 |
| 244 | 3300005329 | Ga0070683_100044840 | Ga0070683_1000448402 | 343 |
| 245 | 3300005329 | Ga0070683_100168431 | Ga0070683_1001684314 | 343 |
| 246 | 3300005336 | Ga0070680_100033451 | Ga0070680_1000334514 | 343 |
| 247 | 3300005339 | Ga0070660_100288882 | Ga0070660_1002888821 | 343 |
| 248 | 3300005341 | Ga0070691_10149534 | Ga0070691_101495341 | 343 |
| 249 | 3300005366 | Ga0070659_100036033 | Ga0070659_1000360331 | 343 |
| 250 | 3300005436 | Ga0070713_100160570 | Ga0070713_1001605703 | 343 |
| 251 | 3300005436 | Ga0070713_100257202 | Ga0070713_1002572022 | 343 |
| 252 | 3300005455 | Ga0070663_100058919 | Ga0070663_1000589192 | 343 |
| 253 | 3300005458 | Ga0070681_10012753 | Ga0070681_100127532 | 343 |
| 254 | 3300005458 | Ga0070681_10039368 | Ga0070681_100393682 | 343 |
| 255 | 3300005530 | Ga0070679_100000281 | Ga0070679_10000028125 | 343 |
| 256 | 3300005530 | Ga0070679_100140261 | Ga0070679_1001402612 | 343 |
| 257 | 3300005535 | Ga0070684_100005710 | Ga0070684_1000057106 | 343 |
| 258 | 3300005535 | Ga0070684_100066582 | Ga0070684_1000665821 | 343 |
| 259 | 3300005563 | Ga0068855_100003216 | Ga0068855_10000321613 | 343 |
| 260 | 3300005563 | Ga0068855_100409738 | Ga0068855_1004097381 | 343 |
| 261 | 3300005564 | Ga0070664_100015767 | Ga0070664_1000157675 | 343 |
| 262 | 3300005577 | Ga0068857_100030614 | Ga0068857_1000306141 | 343 |
| 263 | 3300005578 | Ga0068854_100017634 | Ga0068854_1000176342 | 343 |
| 264 | 3300005616 | Ga0068852_100001995 | Ga0068852_1000019955 | 343 |
| 265 | 3300009093 | Ga0105240_10001240 | Ga0105240_1000124018 | 343 |
| 266 | 3300009093 | Ga0105240_10035479 | Ga0105240_100354793 | 343 |
| 267 | 3300009545 | Ga0105237_10026893 | Ga0105237_100268934 | 343 |
| 268 | 3300009551 | Ga0105238_10000624 | Ga0105238_1000062420 | 343 |
| 269 | 3300009551 | Ga0105238_10044116 | Ga0105238_100441164 | 343 |
| 270 | 3300013104 | Ga0157370_10001834 | Ga0157370_1000183412 | 343 |
| 271 | 3300013105 | Ga0157369_10052790 | Ga0157369_100527901 | 343 |
| 272 | 3300013105 | Ga0157369_10318418 | Ga0157369_103184181 | 343 |
| 273 | 3300013296 | Ga0157374_10002741 | Ga0157374_1000274113 | 343 |
| 274 | 3300013306 | Ga0163162_10000443 | Ga0163162_100004436 | 343 |
| 275 | 3300013307 | Ga0157372_10000134 | Ga0157372_1000013437 | 343 |
| 276 | 3300014325 | Ga0163163_10208125 | Ga0163163_102081252 | 343 |
| 277 | 3300014968 | Ga0157379_10248528 | Ga0157379_102485281 | 343 |
| 278 | 3300014969 | Ga0157376_10023921 | Ga0157376_100239213 | 343 |
| 279 | 3300014969 | Ga0157376_10124200 | Ga0157376_101242002 | 343 |
| 280 | 3300025904 | Ga0207647_10062089 | Ga0207647_100620892 | 343 |
| 281 | 3300025909 | Ga0207705_10005367 | Ga0207705_100053679 | 343 |
| 282 | 3300025909 | Ga0207705_10050433 | Ga0207705_100504332 | 343 |
| 283 | 3300025912 | Ga0207707_10001224 | Ga0207707_1000122411 | 343 |
| 284 | 3300025913 | Ga0207695_10006566 | Ga0207695_100065661 | 343 |
| 285 | 3300025919 | Ga0207657_10006538 | Ga0207657_100065384 | 343 |
| 286 | 3300025921 | Ga0207652_10071658 | Ga0207652_100716582 | 343 |
| 287 | 3300025924 | Ga0207694_10002817 | Ga0207694_100028177 | 343 |
| 288 | 3300025939 | Ga0207665_10183236 | Ga0207665_101832361 | 343 |
| 289 | 3300025941 | Ga0207711_10000014 | Ga0207711_10000014113 | 343 |
| 290 | 3300025944 | Ga0207661_10022517 | Ga0207661_100225174 | 343 |
| 291 | 3300025944 | Ga0207661_10148653 | Ga0207661_101486532 | 343 |
| 292 | 3300025949 | Ga0207667_10000390 | Ga0207667_1000039033 | 343 |
| 293 | 3300025949 | Ga0207667_10016742 | Ga0207667_100167425 | 343 |
| 294 | 3300025981 | Ga0207640_10068954 | Ga0207640_100689542 | 343 |
| 295 | 3300026078 | Ga0207702_10012160 | Ga0207702_100121606 | 343 |
| 296 | 3300026088 | Ga0207641_10072485 | Ga0207641_100724853 | 343 |
| 297 | 3300026116 | Ga0207674_10010381 | Ga0207674_100103815 | 343 |
| 298 | 3300026142 | Ga0207698_10005494 | Ga0207698_100054945 | 343 |
| 299 | 3300028379 | Ga0268266_10359699 | Ga0268266_103596991 | 343 |
| 300 | 3300028573 | Ga0265334_10043857 | Ga0265334_100438572 | 343 |
| 301 | 3300028666 | Ga0265336_10014015 | Ga0265336_100140152 | 343 |
| 302 | 3300028800 | Ga0265338_10002352 | Ga0265338_100023523 | 343 |
| 303 | 3300028800 | Ga0265338_10002845 | Ga0265338_1000284520 | 343 |
| 304 | 3300028800 | Ga0265338_10032103 | Ga0265338_100321034 | 343 |
| 305 | 3300028800 | Ga0265338_10061447 | Ga0265338_100614472 | 343 |
| 306 | 3300031235 | Ga0265330_10000252 | Ga0265330_1000025228 | 343 |
| 307 | 3300031235 | Ga0265330_10000498 | Ga0265330_1000049810 | 343 |
| 308 | 3300031238 | Ga0265332_10002353 | Ga0265332_100023533 | 343 |
| 309 | 3300031238 | Ga0265332_10063477 | Ga0265332_100634771 | 343 |
| 310 | 3300031239 | Ga0265328_10002804 | Ga0265328_100028044 | 343 |
| 311 | 3300031239 | Ga0265328_10002920 | Ga0265328_100029206 | 343 |
| 312 | 3300031240 | Ga0265320_10049291 | Ga0265320_100492912 | 343 |
| 313 | 3300031241 | Ga0265325_10000356 | Ga0265325_1000035613 | 343 |
| 314 | 3300031241 | Ga0265325_10002088 | Ga0265325_100020884 | 343 |
| 315 | 3300031241 | Ga0265325_10083445 | Ga0265325_100834452 | 343 |
| 316 | 3300031247 | Ga0265340_10002404 | Ga0265340_100024048 | 343 |
| 317 | 3300031249 | Ga0265339_10000100 | Ga0265339_1000010049 | 343 |
| 318 | 3300031249 | Ga0265339_10000235 | Ga0265339_1000023518 | 343 |
| 319 | 3300031249 | Ga0265339_10000447 | Ga0265339_1000044712 | 343 |
| 320 | 3300031249 | Ga0265339_10009080 | Ga0265339_100090802 | 343 |
| 321 | 3300031249 | Ga0265339_10032988 | Ga0265339_100329882 | 343 |
| 322 | 3300031344 | Ga0265316_10000483 | Ga0265316_1000048319 | 343 |
| 323 | 3300031344 | Ga0265316_10002001 | Ga0265316_1000200114 | 343 |
| 324 | 3300031344 | Ga0265316_10062503 | Ga0265316_100625031 | 343 |
| 325 | 3300031595 | Ga0265313_10001676 | Ga0265313_1000167612 | 343 |
| 326 | 3300031595 | Ga0265313_10002317 | Ga0265313_1000231710 | 343 |
| 327 | 3300031711 | Ga0265314_10000195 | Ga0265314_1000019545 | 343 |
| 328 | 3300031711 | Ga0265314_10002098 | Ga0265314_1000209818 | 343 |
| 329 | 3300031712 | Ga0265342_10000469 | Ga0265342_1000046921 | 343 |
| 330 | 3300031712 | Ga0265342_10001091 | Ga0265342_100010915 | 343 |
| 331 | 3300031712 | Ga0265342_10015378 | Ga0265342_100153782 | 343 |
| 332 | 3300031712 | Ga0265342_10149621 | Ga0265342_101496211 | 343 |
| 333 | 3300037853 | Ga0436364_1519815 | Ga0436364_1519815_569_1606 | 343 |
| 334 | 3300039437 | Ga0436365_1592832 | Ga0436365_1592832_2088_3119 | 343 |
| 335 | 3300046543 | Ga0495645_0218783 | Ga0495645_0218783_61_1092 | 343 |
| 336 | 3300048907 | Ga0496104_0074492 | Ga0496104_0074492_508_1542 | 343 |
| 337 | 3300048908 | Ga0496105_0092520 | Ga0496105_0092520_1024_2061 | 343 |
| 338 | 3300048929 | Ga0496126_0000018 | Ga0496126_0000018_335651_336682 | 343 |
| 339 | 3300049586 | Ga0501070_0250046 | Ga0501070_0250046_222_1253 | 343 |
| 340 | 3300049822 | Ga0501035_0091412 | Ga0501035_0091412_839_1870 | 343 |
| 341 | 3300049823 | Ga0501044_0002558 | Ga0501044_0002558_11493_12524 | 343 |
| 342 | 3300053111 | Ga0500572_051091 | Ga0500572_051091_131_1174 | 343 |
| 343 | 3300060353 | Ga0501082_0261094 | Ga0501082_0261094_447_1478 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3erp-assembly1.cif.gz_B-5 | structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium | 0.9837 | 3 | 326 |
| 4ast-assembly1.cif.gz_G | the apo structure of a bacterial aldo-keto reductase akr14a1 | 0.9801 | 3 | 326 |
| 4ast-assembly1.cif.gz_F | the apo structure of a bacterial aldo-keto reductase akr14a1 | 0.9798 | 3 | 326 |
| 4ast-assembly1.cif.gz_H | the apo structure of a bacterial aldo-keto reductase akr14a1 | 0.9775 | 3 | 327 |
| 3erp-assembly1.cif.gz_A | structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium | 0.9773 | 3 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n6qB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9651 | 16 | 332 | 3.20.20.100 |
| 3n6qB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9557 | 16 | 332 | 3.20.20.100 |
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.937 | 14 | 327 | 3.20.20.100 |
| af_O59826_13_339_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9334 | 14 | 327 | 3.20.20.100 |
| af_E9QGU5_66_406_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9275 | 13 | 327 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530ZNY9-F1-model_v4 | L-glyceraldehyde 3-phosphate reductase | 0.996 | 121 | 204 |
GO:0016491
GO:0051596 |
| AF-A0A529KXV0-F1-model_v4 | L-glyceraldehyde 3-phosphate reductase | 0.9875 | 77 | 192 |
GO:0016491
GO:0051596 |
| AF-A0A7W1R132-F1-model_v4 | Aldo/keto reductase | 0.9868 | 14 | 202 |
GO:0016491
GO:0051596 |
| AF-A0A3D6CKH0-F1-model_v4 | L-glyceraldehyde 3-phosphate reductase | 0.984 | 38 | 233 |
GO:0016491
GO:0051596 |
| AF-A0A2P7QKJ4-F1-model_v4 | Aldo/keto reductase | 0.9833 | 1 | 340 |
GO:0016491
GO:0051596 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar