F415429

General Info

Members Datasets Scaffolds Average Seq Length
343 222 312 344

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100168431|Ga0070683_1001684314
Length 352
Sequence MEKPYVPNPTRYDQANFRRCGRSGLVLPAITLGLWQNFGGADVFETGRAMIRRAFDRGVTHFDLANNYGPPYGSAEENFGLILRKDFGVTKRSSGLRNELLISTKAGWDMWPGPYGIGASRKYLLASLDDSLRRMGLDYVDIFYAHRPWANAPLEETMGALATAVHQGKALYVGISSYSPERTRQAAEILKSMGVPLLIHQPSYSMLNRWIEHGLLDTLAELGVGCIGFSPLAQGMLTTKYLNGVPTDSRAALGNSSLLKEFLTEKNIEQVRHLNQIAIRRGQSLPQMAIAWVLRDARVTSALIGARNIEQLDDSLDALNKLEFSPAELEEIDHHAKDVGIDLWRAARMNMV

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
3 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
4 2751185800 Brucella pituitosa AA2 Isolate Unclassified
5 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
6 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
7 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
8 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
9 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
10 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
11 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
12 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
13 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
16 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
17 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
18 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
19 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
20 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
21 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
27 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
28 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
31 2941471342 Luteibacter sp. 621 Isolate Unclassified
32 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.67
Metatranscriptomes 0.29
Isolates 9.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.5
Nodule 0.29
Rhizoplane 1.75
Rhizosphere 73.76
Stem 0
Stem Tuber 0
Unclassified 13.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002031 3300000546 Bacteria 2586
2 JGI25152J39213_1000240 3300002773 Bacteria 36681
3 JGI25150J39212_1000170 3300002774 Bacteria 36653
4 JGI25151J46595_10000109 3300003187 Bacteria 112044
5 JGI25153J46596_10000084 3300003215 Bacteria 112044
6 Ga0055538_1000024 3300003751 Bacteria 241526
7 Ga0055539_1000031 3300003752 Bacteria 241526
8 Ga0055533_1000041 3300003756 Bacteria 241526
9 Ga0055525_1000049 3300003759 Bacteria 241526
10 Ga0055541_1000022 3300003841 Bacteria 241526
11 Ga0070658_10000199 3300005327 Bacteria 52822
12 Ga0070658_10031456 3300005327 Bacteria 4261
13 Ga0070658_10119267 3300005327 Bacteria 2191
14 Ga0070683_100044840 3300005329 Bacteria 4079
15 Ga0070683_100168431 3300005329 Bacteria 2079
16 Ga0070680_100033451 3300005336 Bacteria 4145
17 Ga0068868_100149132 3300005338 Bacteria 1925
18 Ga0070660_100288882 3300005339 Bacteria 1343
19 Ga0070691_10149534 3300005341 Bacteria 1196
20 Ga0070661_100000006 3300005344 Bacteria 216544
21 Ga0070668_100012366 3300005347 Bacteria 6356
22 Ga0070659_100036033 3300005366 Bacteria 3855
23 Ga0070659_100201627 3300005366 Bacteria 1638
24 Ga0070713_100160570 3300005436 Bacteria 2006
25 Ga0070713_100257202 3300005436 Bacteria 1595
26 Ga0070700_100020375 3300005441 Bacteria 3841
27 Ga0070663_100058919 3300005455 Bacteria 2759
28 Ga0070662_100117925 3300005457 Bacteria 2031
29 Ga0070681_10012753 3300005458 Bacteria 8340
30 Ga0070681_10039368 3300005458 Bacteria 4739
31 Ga0070679_100000281 3300005530 Bacteria 43079
32 Ga0070679_100140261 3300005530 Bacteria 2397
33 Ga0070684_100005710 3300005535 Bacteria 9558
34 Ga0070684_100066582 3300005535 Bacteria 3162
35 Ga0068855_100003216 3300005563 Bacteria 19987
36 Ga0068855_100004458 3300005563 Bacteria 17112
37 Ga0068855_100005621 3300005563 Bacteria 15293
38 Ga0068855_100015967 3300005563 Bacteria 9031
39 Ga0068855_100033215 3300005563 Bacteria 6160
40 Ga0068855_100409738 3300005563 Bacteria 1484
41 Ga0070664_100015767 3300005564 Bacteria 6185
42 Ga0070664_100056065 3300005564 Bacteria 3348
43 Ga0068857_100030614 3300005577 Bacteria 4753
44 Ga0068854_100017634 3300005578 Bacteria 4780
45 Ga0068854_100052253 3300005578 Bacteria 2930
46 Ga0068854_100261863 3300005578 Bacteria 1385
47 Ga0068856_100033278 3300005614 Bacteria 5046
48 Ga0068852_100001995 3300005616 Bacteria 13909
49 Ga0068866_10024620 3300005718 Bacteria 2819
50 Ga0068861_100124354 3300005719 Bacteria 2085
51 Ga0068851_10100141 3300005834 Bacteria 1537
52 Ga0068851_10124297 3300005834 Bacteria 1390
53 Ga0081540_1075525 3300005983 Bacteria 1540
54 Ga0075365_10035810 3300006038 Bacteria 3213
55 Ga0075365_10067873 3300006038 Bacteria 2395
56 Ga0075366_10051672 3300006195 Bacteria 2442
57 Ga0075370_10221356 3300006353 Bacteria 1119
58 Ga0068871_100295223 3300006358 Bacteria 1421
59 Ga0075434_100046865 3300006871 Bacteria 4289
60 Ga0105244_10033895 3300009036 Bacteria 2690
61 Ga0105240_10001240 3300009093 Bacteria 44296
62 Ga0105240_10035479 3300009093 Bacteria 6426
63 Ga0105240_10139807 3300009093 Bacteria 2896
64 Ga0105240_10239393 3300009093 Bacteria 2105
65 Ga0114129_10176761 3300009147 Bacteria 2908
66 Ga0105243_10067369 3300009148 Bacteria 2882
67 Ga0105242_10113588 3300009176 Bacteria 2313
68 Ga0105237_10016078 3300009545 Bacteria 7782
69 Ga0105237_10023373 3300009545 Bacteria 6334
70 Ga0105237_10026893 3300009545 Bacteria 5879
71 Ga0105238_10000355 3300009551 Bacteria 49268
72 Ga0105238_10000624 3300009551 Bacteria 37245
73 Ga0105238_10044116 3300009551 Bacteria 4510
74 Ga0105238_10363640 3300009551 Bacteria 1436
75 Ga0105239_10013108 3300010375 Bacteria 9213
76 Ga0105239_10114431 3300010375 Bacteria 2992
77 Ga0157371_10236242 3300013102 Bacteria 1314
78 Ga0157370_10001834 3300013104 Bacteria 26190
79 Ga0157370_10142932 3300013104 Bacteria 2229
80 Ga0157369_10001712 3300013105 Bacteria 26704
81 Ga0157369_10014477 3300013105 Bacteria 8902
82 Ga0157369_10052790 3300013105 Bacteria 4396
83 Ga0157369_10318418 3300013105 Bacteria 1617
84 Ga0157374_10002741 3300013296 Bacteria 14798
85 Ga0163162_10000443 3300013306 Bacteria 38255
86 Ga0163162_10181881 3300013306 Bacteria 2228
87 Ga0157372_10000134 3300013307 Bacteria 81431
88 Ga0157372_10054919 3300013307 Bacteria 4446
89 Ga0163163_10208125 3300014325 Bacteria 2005
90 Ga0157380_10043879 3300014326 Bacteria 3502
91 Ga0157379_10248528 3300014968 Bacteria 1614
92 Ga0157376_10023921 3300014969 Bacteria 4790
93 Ga0157376_10124200 3300014969 Bacteria 2292
94 Ga0182006_1012269 3300015261 Bacteria 3748
95 Ga0206349_1264054 3300020075 Bacteria 1162
96 Ga0213872_10000181 3300021361 Bacteria 56542
97 Ga0213872_10043198 3300021361 Bacteria 2054
98 Ga0213876_10001649 3300021384 Bacteria 13615
99 Ga0213875_10024051 3300021388 Bacteria 2906
100 Ga0209784_100018 3300025224 Bacteria 456816
101 Ga0209566_100016 3300025225 Bacteria 456824
102 Ga0209674_100030 3300025226 Bacteria 456824
103 Ga0209563_100034 3300025230 Bacteria 456824
104 Ga0207425_1000290 3300025245 Bacteria 36693
105 Ga0209677_100019 3300025253 Bacteria 456824
106 Ga0209129_1000202 3300025258 Bacteria 72795
107 Ga0209565_1003537 3300025263 Bacteria 5009
108 Ga0209025_1000013 3300025294 Bacteria 871757
109 Ga0209025_1000416 3300025294 Bacteria 85510
110 Ga0209758_1000014 3300025297 Bacteria 871757
111 Ga0209051_1006470 3300025303 Bacteria 6598
112 Ga0207656_10021178 3300025321 Bacteria 2594
113 Ga0207656_10086520 3300025321 Bacteria 1417
114 Ga0207647_10000056 3300025904 Bacteria 86476
115 Ga0207647_10062089 3300025904 Bacteria 2277
116 Ga0207705_10000002 3300025909 Bacteria 2046852
117 Ga0207705_10005367 3300025909 Bacteria 9583
118 Ga0207705_10038006 3300025909 Bacteria 3445
119 Ga0207705_10050433 3300025909 Bacteria 2996
120 Ga0207705_10074813 3300025909 Bacteria 2459
121 Ga0207705_10104647 3300025909 Bacteria 2085
122 Ga0207705_10200748 3300025909 Bacteria 1511
123 Ga0207707_10001224 3300025912 Bacteria 24099
124 Ga0207695_10003906 3300025913 Bacteria 20624
125 Ga0207695_10006566 3300025913 Bacteria 15055
126 Ga0207695_10030343 3300025913 Bacteria 5953
127 Ga0207695_10260361 3300025913 Bacteria 1632
128 Ga0207671_10002093 3300025914 Bacteria 21844
129 Ga0207671_10022412 3300025914 Bacteria 4776
130 Ga0207657_10006538 3300025919 Bacteria 12072
131 Ga0207657_10219672 3300025919 Bacteria 1523
132 Ga0207649_10000058 3300025920 Bacteria 100911
133 Ga0207649_10129671 3300025920 Bacteria 1711
134 Ga0207652_10071658 3300025921 Bacteria 3011
135 Ga0207681_10306074 3300025923 Bacteria 1259
136 Ga0207694_10000236 3300025924 Bacteria 52960
137 Ga0207694_10002817 3300025924 Bacteria 14029
138 Ga0207706_10039254 3300025933 Bacteria 4197
139 Ga0207665_10183236 3300025939 Bacteria 1517
140 Ga0207711_10000014 3300025941 Bacteria 506753
141 Ga0207661_10022517 3300025944 Bacteria 4748
142 Ga0207661_10148653 3300025944 Bacteria 2023
143 Ga0207667_10000044 3300025949 Bacteria 248251
144 Ga0207667_10000390 3300025949 Bacteria 59216
145 Ga0207667_10016742 3300025949 Bacteria 8271
146 Ga0207667_10029725 3300025949 Bacteria 5920
147 Ga0207667_10039384 3300025949 Bacteria 5037
148 Ga0207668_10090605 3300025972 Bacteria 2245
149 Ga0207640_10012327 3300025981 Bacteria 4865
150 Ga0207640_10068954 3300025981 Bacteria 2372
151 Ga0207639_10102736 3300026041 Bacteria 2314
152 Ga0207678_10055037 3300026067 Bacteria 3427
153 Ga0207702_10012160 3300026078 Bacteria 7162
154 Ga0207702_10275233 3300026078 Bacteria 1589
155 Ga0207641_10072485 3300026088 Bacteria 2966
156 Ga0207674_10010381 3300026116 Bacteria 10554
157 Ga0207675_100014410 3300026118 Bacteria 7370
158 Ga0207698_10005494 3300026142 Bacteria 7842
159 Ga0209371_1000513 3300027312 Bacteria 36998
160 Ga0265356_1005464 3300028017 Bacteria 1515
161 Ga0268266_10093672 3300028379 Bacteria 2636
162 Ga0268266_10359699 3300028379 Bacteria 1369
163 Ga0265334_10043857 3300028573 Bacteria 1739
164 Ga0265336_10014015 3300028666 Bacteria 2663
165 Ga0265338_10002352 3300028800 Bacteria 28548
166 Ga0265338_10002845 3300028800 Bacteria 25287
167 Ga0265338_10032103 3300028800 Bacteria 5132
168 Ga0265338_10061447 3300028800 Bacteria 3293
169 Ga0268256_1000441 3300030500 Bacteria 36967
170 Ga0265330_10000252 3300031235 Bacteria 40011
171 Ga0265330_10000498 3300031235 Bacteria 26268
172 Ga0265332_10002353 3300031238 Bacteria 9645
173 Ga0265332_10063477 3300031238 Bacteria 1578
174 Ga0265328_10002804 3300031239 Bacteria 7801
175 Ga0265328_10002920 3300031239 Bacteria 7628
176 Ga0265320_10049291 3300031240 Bacteria 2051
177 Ga0265325_10000356 3300031241 Bacteria 32238
178 Ga0265325_10002088 3300031241 Bacteria 13652
179 Ga0265325_10048286 3300031241 Bacteria 2200
180 Ga0265325_10083445 3300031241 Bacteria 1585
181 Ga0265340_10002404 3300031247 Bacteria 10648
182 Ga0265339_10000100 3300031249 Bacteria 72186
183 Ga0265339_10000235 3300031249 Bacteria 44859
184 Ga0265339_10000447 3300031249 Bacteria 32333
185 Ga0265339_10009080 3300031249 Bacteria 6281
186 Ga0265339_10032988 3300031249 Bacteria 2919
187 Ga0265316_10000483 3300031344 Bacteria 45211
188 Ga0265316_10002001 3300031344 Bacteria 21464
189 Ga0265316_10062503 3300031344 Bacteria 2889
190 Ga0265316_10070495 3300031344 Bacteria 2696
191 Ga0265313_10001676 3300031595 Bacteria 20495
192 Ga0265313_10002317 3300031595 Bacteria 16687
193 Ga0265313_10030254 3300031595 Bacteria 2790
194 Ga0265314_10000195 3300031711 Bacteria 90391
195 Ga0265314_10002098 3300031711 Bacteria 20978
196 Ga0265314_10073980 3300031711 Bacteria 2270
197 Ga0265342_10000469 3300031712 Bacteria 43738
198 Ga0265342_10001091 3300031712 Bacteria 26110
199 Ga0265342_10015378 3300031712 Bacteria 5035
200 Ga0265342_10068220 3300031712 Bacteria 2079
201 Ga0265342_10108199 3300031712 Bacteria 1576
202 Ga0265342_10149621 3300031712 Bacteria 1297
203 Ga0395899_0204578 3300037312 Bacteria 1374
204 Ga0395900_0035364 3300037418 Bacteria 5144
205 Ga0395900_0098645 3300037418 Bacteria 3002
206 Ga0395900_0325672 3300037418 Bacteria 1516
207 Ga0395898_0356147 3300037466 Bacteria 1395
208 Ga0395905_0000690 3300037471 Bacteria 44713
209 Ga0395905_0117059 3300037471 Bacteria 2504
210 Ga0395905_0118093 3300037471 Bacteria 2493
211 Ga0395905_0211907 3300037471 Bacteria 1815
212 Ga0395905_0226666 3300037471 Bacteria 1748
213 Ga0395905_0258972 3300037471 Bacteria 1624
214 Ga0436364_0764407 3300037853 Bacteria 11998
215 Ga0436364_1519815 3300037853 Bacteria 1749
216 Ga0395901_0029295 3300038443 Bacteria 5666
217 Ga0395901_0032436 3300038443 Bacteria 5389
218 Ga0395901_0367065 3300038443 Bacteria 1483
219 Ga0237819_00250 3300038705 Bacteria 19601
220 Ga0436365_0794411 3300039437 Bacteria 78184
221 Ga0436365_1592832 3300039437 Bacteria 3187
222 Ga0436361_0284344 3300039447 Bacteria 76533
223 Ga0436363_1126952 3300039450 Bacteria 1834
224 Ga0439462_0058069 3300042015 Bacteria 1045
225 Ga0466968_0000819 3300044735 Bacteria 10822
226 Ga0495643_0157587 3300046522 Bacteria 1119
227 Ga0495645_0218783 3300046543 Bacteria 1282
228 Ga0495645_0253694 3300046543 Bacteria 1168
229 Ga0495636_0022446 3300047318 Bacteria 2551
230 Ga0495672_0040014 3300047320 Bacteria 2846
231 Ga0495686_0000026 3300047472 Bacteria 383637
232 Ga0495686_0043061 3300047472 Bacteria 2865
233 Ga0496102_0199068 3300048905 Bacteria 1888
234 Ga0496104_0074492 3300048907 Bacteria 3232
235 Ga0496105_0092520 3300048908 Bacteria 2497
236 Ga0496106_0384177 3300048909 Bacteria 1128
237 Ga0496111_0196438 3300048914 Bacteria 1500
238 Ga0496115_0107365 3300048918 Bacteria 2292
239 Ga0496117_0001262 3300048920 Bacteria 37592
240 Ga0496117_0066387 3300048920 Bacteria 2448
241 Ga0496118_0000228 3300048921 Bacteria 98198
242 Ga0496118_0008099 3300048921 Bacteria 10954
243 Ga0496118_0043706 3300048921 Bacteria 3518
244 Ga0496119_0000091 3300048922 Bacteria 133090
245 Ga0496120_0005081 3300048923 Bacteria 10647
246 Ga0496121_0000044 3300048924 Bacteria 337672
247 Ga0496122_0000770 3300048925 Bacteria 61729
248 Ga0496122_0038415 3300048925 Bacteria 3837
249 Ga0496122_0064712 3300048925 Bacteria 2658
250 Ga0496122_0071923 3300048925 Bacteria 2462
251 Ga0496123_0000018 3300048926 Bacteria 404553
252 Ga0496123_0042610 3300048926 Bacteria 3130
253 Ga0496123_0052593 3300048926 Bacteria 2701
254 Ga0496124_0003217 3300048927 Bacteria 20178
255 Ga0496125_0000145 3300048928 Bacteria 156267
256 Ga0496125_0000575 3300048928 Bacteria 62850
257 Ga0496125_0001173 3300048928 Bacteria 39668
258 Ga0496125_0003607 3300048928 Bacteria 18580
259 Ga0496125_0080859 3300048928 Bacteria 2485
260 Ga0496126_0000018 3300048929 Bacteria 581170
261 Ga0496126_0001062 3300048929 Bacteria 46308
262 Ga0496126_0138324 3300048929 Bacteria 2098
263 Ga0496126_0172562 3300048929 Bacteria 1841
264 Ga0501031_0026807 3300049568 Bacteria 3756
265 Ga0501032_0034759 3300049569 Bacteria 3448
266 Ga0501032_0043696 3300049569 Bacteria 3033
267 Ga0501033_0002968 3300049570 Bacteria 14169
268 Ga0501033_0050306 3300049570 Bacteria 3092
269 Ga0501034_0093510 3300049571 Bacteria 3003
270 Ga0501034_0144013 3300049571 Bacteria 2361
271 Ga0501036_0139056 3300049572 Bacteria 2049
272 Ga0501036_0141144 3300049572 Bacteria 2033
273 Ga0501037_0008956 3300049573 Bacteria 7333
274 Ga0501038_0007372 3300049574 Bacteria 10146
275 Ga0501040_0080040 3300049576 Bacteria 2262
276 Ga0501042_0090064 3300049578 Bacteria 2201
277 Ga0501043_0005468 3300049579 Bacteria 10270
278 Ga0501046_0085081 3300049580 Bacteria 2438
279 Ga0501048_0053861 3300049582 Bacteria 2858
280 Ga0501068_0012223 3300049584 Bacteria 4856
281 Ga0501070_0250046 3300049586 Bacteria 1450
282 Ga0501071_0094555 3300049587 Bacteria 2198
283 Ga0501073_0000087 3300049589 Bacteria 58557
284 Ga0501073_0064394 3300049589 Bacteria 2556
285 Ga0501074_0014520 3300049590 Bacteria 5730
286 Ga0501075_0101722 3300049591 Bacteria 2182
287 Ga0501077_0015186 3300049593 Bacteria 4843
288 Ga0501079_0065520 3300049741 Bacteria 2802
289 Ga0501080_0044152 3300049742 Bacteria 4149
290 Ga0501081_0243175 3300049743 Bacteria 1312
291 Ga0501083_0009631 3300049744 Bacteria 6825
292 Ga0501035_0006965 3300049822 Bacteria 10558
293 Ga0501035_0091412 3300049822 Bacteria 2679
294 Ga0501044_0002558 3300049823 Bacteria 20715
295 Ga0501045_0083057 3300049824 Bacteria 2362
296 nmdc:mga03683_53129_c1 3300050489 Bacteria 1695
297 nmdc:mga0yw44_11478_c1 3300050492 Bacteria 4576
298 nmdc:mga0k408_41045_c1 3300050493 Bacteria 2663
299 nmdc:mga05p37_98139_c1 3300050507 Bacteria 3608
300 nmdc:mga0n895_289246_c1 3300050512 Bacteria 1661
301 nmdc:mga0n895_49801_c1 3300050512 Bacteria 4106
302 nmdc:mga0a205_274345_c1 3300050515 Bacteria 1563
303 nmdc:mga0sz30_15592_c1 3300050516 Bacteria 3005
304 nmdc:mga0sz30_91425_c1 3300050516 Bacteria 1324
305 Ga0500562_002952 3300053108 Bacteria 4243
306 Ga0500572_051091 3300053111 Bacteria 1232
307 Ga0500568_0000156 3300053139 Bacteria 59014
308 Ga0500568_0012335 3300053139 Bacteria 3935
309 Ga0500577_0021639 3300053142 Bacteria 2122
310 Ga0500616_0000245 3300053153 Bacteria 84999
311 Ga0501082_0261094 3300060353 Bacteria 1507
312 Ga0530510_0209706 3300061734 Bacteria 1447

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2852618963 2852619120 276
2 3300048909 Ga0496106_0384177 Ga0496106_0384177_10_984 320
3 3300038705 Ga0237819_00250 Ga0237819_00250_1191_2243 323
4 3300005344 Ga0070661_100000006 Ga0070661_10000000661 324
5 3300025920 Ga0207649_10000058 Ga0207649_1000005864 324
6 3300048922 Ga0496119_0000091 Ga0496119_0000091_99781_100773 328
7 3300048923 Ga0496120_0005081 Ga0496120_0005081_781_1773 328
8 3300042015 Ga0439462_0058069 Ga0439462_0058069_10_1011 330
9 3300006038 Ga0075365_10035810 Ga0075365_100358102 332
10 3300006038 Ga0075365_10067873 Ga0075365_100678732 332
11 3300048929 Ga0496126_0172562 Ga0496126_0172562_359_1375 332
12 3300050492 nmdc:mga0yw44_11478_c1 nmdc:mga0yw44_11478_c1_2707_3723 332
13 3300053108 Ga0500562_002952 Ga0500562_002952_2586_3602 332
14 3300049569 Ga0501032_0034759 Ga0501032_0034759_393_1397 333
15 3300049570 Ga0501033_0050306 Ga0501033_0050306_1009_2013 333
16 3300049571 Ga0501034_0144013 Ga0501034_0144013_208_1212 333
17 3300049572 Ga0501036_0141144 Ga0501036_0141144_382_1386 333
18 3300049574 Ga0501038_0007372 Ga0501038_0007372_359_1363 333
19 3300049589 Ga0501073_0000087 Ga0501073_0000087_48823_49842 333
20 3300050516 nmdc:mga0sz30_15592_c1 nmdc:mga0sz30_15592_c1_1150_2169 333
21 3300053139 Ga0500568_0012335 Ga0500568_0012335_1978_2994 333
22 3300005338 Ga0068868_100149132 Ga0068868_1001491322 334
23 3300005563 Ga0068855_100005621 Ga0068855_10000562116 334
24 3300005563 Ga0068855_100015967 Ga0068855_1000159679 334
25 3300009545 Ga0105237_10023373 Ga0105237_100233734 334
26 3300025914 Ga0207671_10022412 Ga0207671_100224124 334
27 3300025949 Ga0207667_10039384 Ga0207667_100393845 334
28 3300048921 Ga0496118_0043706 Ga0496118_0043706_1841_2878 334
29 iso_pu_bacteria 2909399089 2909400564 334
30 iso_pu_bacteria 2751185800 2753360973 336
31 iso_pu_bacteria 2758568016 2758637807 336
32 iso_pu_bacteria 2891373044 2891376838 336
33 iso_pu_bacteria 2898795034 2898797914 336
34 3300037418 Ga0395900_0325672 Ga0395900_0325672_430_1476 337
35 3300037471 Ga0395905_0118093 Ga0395905_0118093_197_1243 337
36 3300050512 nmdc:mga0n895_49801_c1 nmdc:mga0n895_49801_c1_2673_3689 337
37 iso_pu_bacteria 2521172590 2521560470 337
38 iso_pu_bacteria 2551306416 2553005590 337
39 iso_pu_bacteria 2765235838 2765571705 337
40 iso_pu_bacteria 2808606386 2808982237 337
41 iso_pu_bacteria 2808606415 2809129963 337
42 iso_pu_bacteria 2808606419 2809148982 337
43 iso_pu_bacteria 2818991449 2819617138 337
44 iso_pu_bacteria 2839094727 2839098570 337
45 iso_pu_bacteria 2904439833 2904442768 337
46 iso_pu_bacteria 2904530477 2904535019 337
47 iso_pu_bacteria 2904584206 2904588643 337
48 iso_pu_bacteria 2904589729 2904594283 337
49 iso_pu_bacteria 2904601388 2904604875 337
50 iso_pu_bacteria 2919046199 2919048708 337
51 iso_pu_bacteria 2919079590 2919083113 337
52 iso_pu_bacteria 2923510766 2923514259 337
53 iso_pu_bacteria 2928130867 2928132970 337
54 iso_pu_bacteria 2728369276 2729909348 338
55 iso_pu_bacteria 2818991440 2819562858 338
56 iso_pu_bacteria 2884338543 2884340629 338
57 iso_pu_bacteria 2904463128 2904463469 338
58 iso_pu_bacteria 2941471342 2941475895 338
59 3300039450 Ga0436363_1126952 Ga0436363_1126952_84_1112 339
60 iso_pu_bacteria 2808606384 2808973570 339
61 iso_pu_bacteria 2808606390 2809008419 339
62 iso_pu_bacteria 2808606391 2809015243 339
63 3300006195 Ga0075366_10051672 Ga0075366_100516722 340
64 3300006353 Ga0075370_10221356 Ga0075370_102213561 340
65 3300006871 Ga0075434_100046865 Ga0075434_1000468651 340
66 3300009147 Ga0114129_10176761 Ga0114129_101767613 340
67 3300021361 Ga0213872_10043198 Ga0213872_100431982 340
68 3300025294 Ga0209025_1000416 Ga0209025_100041644 340
69 3300028379 Ga0268266_10093672 Ga0268266_100936721 340
70 3300031344 Ga0265316_10070495 Ga0265316_100704953 340
71 3300031711 Ga0265314_10073980 Ga0265314_100739801 340
72 3300031712 Ga0265342_10108199 Ga0265342_101081991 340
73 3300046522 Ga0495643_0157587 Ga0495643_0157587_48_1073 340
74 3300047318 Ga0495636_0022446 Ga0495636_0022446_865_1890 340
75 3300047320 Ga0495672_0040014 Ga0495672_0040014_280_1305 340
76 3300048914 Ga0496111_0196438 Ga0496111_0196438_194_1222 340
77 3300048918 Ga0496115_0107365 Ga0496115_0107365_657_1682 340
78 3300048920 Ga0496117_0001262 Ga0496117_0001262_23230_24255 340
79 3300048925 Ga0496122_0000770 Ga0496122_0000770_38507_39532 340
80 3300048925 Ga0496122_0038415 Ga0496122_0038415_67_1092 340
81 3300048925 Ga0496122_0064712 Ga0496122_0064712_377_1402 340
82 3300048926 Ga0496123_0000018 Ga0496123_0000018_154950_155975 340
83 3300048927 Ga0496124_0003217 Ga0496124_0003217_18654_19679 340
84 3300048928 Ga0496125_0000145 Ga0496125_0000145_102685_103710 340
85 3300048928 Ga0496125_0000575 Ga0496125_0000575_40557_41582 340
86 3300048928 Ga0496125_0001173 Ga0496125_0001173_16375_17400 340
87 3300048928 Ga0496125_0003607 Ga0496125_0003607_10391_11416 340
88 3300048929 Ga0496126_0001062 Ga0496126_0001062_2685_3710 340
89 3300049568 Ga0501031_0026807 Ga0501031_0026807_759_1784 340
90 3300049569 Ga0501032_0043696 Ga0501032_0043696_1178_2203 340
91 3300049570 Ga0501033_0002968 Ga0501033_0002968_6463_7488 340
92 3300049572 Ga0501036_0139056 Ga0501036_0139056_795_1820 340
93 3300049573 Ga0501037_0008956 Ga0501037_0008956_298_1323 340
94 3300049576 Ga0501040_0080040 Ga0501040_0080040_254_1279 340
95 3300049578 Ga0501042_0090064 Ga0501042_0090064_759_1784 340
96 3300049579 Ga0501043_0005468 Ga0501043_0005468_7142_8167 340
97 3300049580 Ga0501046_0085081 Ga0501046_0085081_631_1656 340
98 3300049582 Ga0501048_0053861 Ga0501048_0053861_1051_2076 340
99 3300049584 Ga0501068_0012223 Ga0501068_0012223_1639_2664 340
100 3300049587 Ga0501071_0094555 Ga0501071_0094555_391_1416 340
101 3300049589 Ga0501073_0064394 Ga0501073_0064394_927_1952 340
102 3300049590 Ga0501074_0014520 Ga0501074_0014520_3821_4846 340
103 3300049591 Ga0501075_0101722 Ga0501075_0101722_236_1261 340
104 3300049593 Ga0501077_0015186 Ga0501077_0015186_126_1151 340
105 3300049741 Ga0501079_0065520 Ga0501079_0065520_794_1819 340
106 3300049742 Ga0501080_0044152 Ga0501080_0044152_1334_2359 340
107 3300049743 Ga0501081_0243175 Ga0501081_0243175_11_1036 340
108 3300049744 Ga0501083_0009631 Ga0501083_0009631_602_1627 340
109 3300049822 Ga0501035_0006965 Ga0501035_0006965_2321_3346 340
110 3300049824 Ga0501045_0083057 Ga0501045_0083057_1069_2094 340
111 3300050489 nmdc:mga03683_53129_c1 nmdc:mga03683_53129_c1_265_1290 340
112 3300050493 nmdc:mga0k408_41045_c1 nmdc:mga0k408_41045_c1_1308_2333 340
113 3300050507 nmdc:mga05p37_98139_c1 nmdc:mga05p37_98139_c1_770_1798 340
114 3300050512 nmdc:mga0n895_289246_c1 nmdc:mga0n895_289246_c1_163_1197 340
115 3300050515 nmdc:mga0a205_274345_c1 nmdc:mga0a205_274345_c1_368_1396 340
116 3300050516 nmdc:mga0sz30_91425_c1 nmdc:mga0sz30_91425_c1_125_1150 340
117 3300053139 Ga0500568_0000156 Ga0500568_0000156_28923_29948 340
118 3300053142 Ga0500577_0021639 Ga0500577_0021639_298_1323 340
119 3300053153 Ga0500616_0000245 Ga0500616_0000245_40035_41060 340
120 3300061734 Ga0530510_0209706 Ga0530510_0209706_269_1294 340
121 3300003751 Ga0055538_1000024 Ga0055538_1000024225 341
122 3300003752 Ga0055539_1000031 Ga0055539_1000031225 341
123 3300003756 Ga0055533_1000041 Ga0055533_1000041225 341
124 3300003759 Ga0055525_1000049 Ga0055525_1000049225 341
125 3300003841 Ga0055541_1000022 Ga0055541_1000022225 341
126 3300005563 Ga0068855_100004458 Ga0068855_1000044582 341
127 3300005578 Ga0068854_100052253 Ga0068854_1000522532 341
128 3300005834 Ga0068851_10100141 Ga0068851_101001412 341
129 3300005834 Ga0068851_10124297 Ga0068851_101242972 341
130 3300009036 Ga0105244_10033895 Ga0105244_100338951 341
131 3300009093 Ga0105240_10139807 Ga0105240_101398072 341
132 3300009093 Ga0105240_10239393 Ga0105240_102393932 341
133 3300009545 Ga0105237_10016078 Ga0105237_100160786 341
134 3300009551 Ga0105238_10000355 Ga0105238_1000035547 341
135 3300009551 Ga0105238_10363640 Ga0105238_103636402 341
136 3300010375 Ga0105239_10013108 Ga0105239_100131088 341
137 3300010375 Ga0105239_10114431 Ga0105239_101144313 341
138 3300015261 Ga0182006_1012269 Ga0182006_10122694 341
139 3300021388 Ga0213875_10024051 Ga0213875_100240512 341
140 3300025224 Ga0209784_100018 Ga0209784_100018224 341
141 3300025225 Ga0209566_100016 Ga0209566_100016224 341
142 3300025226 Ga0209674_100030 Ga0209674_100030224 341
143 3300025230 Ga0209563_100034 Ga0209563_100034224 341
144 3300025253 Ga0209677_100019 Ga0209677_100019224 341
145 3300025321 Ga0207656_10021178 Ga0207656_100211782 341
146 3300025321 Ga0207656_10086520 Ga0207656_100865201 341
147 3300025913 Ga0207695_10003906 Ga0207695_1000390615 341
148 3300025913 Ga0207695_10030343 Ga0207695_100303432 341
149 3300025913 Ga0207695_10260361 Ga0207695_102603612 341
150 3300025914 Ga0207671_10002093 Ga0207671_100020936 341
151 3300025924 Ga0207694_10000236 Ga0207694_100002367 341
152 3300025949 Ga0207667_10000044 Ga0207667_10000044212 341
153 3300025949 Ga0207667_10029725 Ga0207667_100297255 341
154 3300025981 Ga0207640_10012327 Ga0207640_100123274 341
155 3300037853 Ga0436364_0764407 Ga0436364_0764407_4998_6026 341
156 3300048926 Ga0496123_0052593 Ga0496123_0052593_187_1263 341
157 3300002773 JGI25152J39213_1000240 JGI25152J39213_100024034 342
158 3300002774 JGI25150J39212_1000170 JGI25150J39212_100017034 342
159 3300003187 JGI25151J46595_10000109 JGI25151J46595_100001092 342
160 3300003215 JGI25153J46596_10000084 JGI25153J46596_100000842 342
161 3300005327 Ga0070658_10000199 Ga0070658_1000019920 342
162 3300005327 Ga0070658_10119267 Ga0070658_101192672 342
163 3300005347 Ga0070668_100012366 Ga0070668_1000123665 342
164 3300005366 Ga0070659_100201627 Ga0070659_1002016271 342
165 3300005441 Ga0070700_100020375 Ga0070700_1000203753 342
166 3300005457 Ga0070662_100117925 Ga0070662_1001179251 342
167 3300005563 Ga0068855_100033215 Ga0068855_1000332154 342
168 3300005564 Ga0070664_100056065 Ga0070664_1000560653 342
169 3300005578 Ga0068854_100261863 Ga0068854_1002618632 342
170 3300005614 Ga0068856_100033278 Ga0068856_1000332785 342
171 3300005718 Ga0068866_10024620 Ga0068866_100246203 342
172 3300005719 Ga0068861_100124354 Ga0068861_1001243542 342
173 3300005983 Ga0081540_1075525 Ga0081540_10755251 342
174 3300006358 Ga0068871_100295223 Ga0068871_1002952231 342
175 3300009148 Ga0105243_10067369 Ga0105243_100673692 342
176 3300009176 Ga0105242_10113588 Ga0105242_101135882 342
177 3300013102 Ga0157371_10236242 Ga0157371_102362422 342
178 3300013104 Ga0157370_10142932 Ga0157370_101429321 342
179 3300013105 Ga0157369_10001712 Ga0157369_1000171226 342
180 3300013105 Ga0157369_10014477 Ga0157369_1001447710 342
181 3300013306 Ga0163162_10181881 Ga0163162_101818812 342
182 3300013307 Ga0157372_10054919 Ga0157372_100549193 342
183 3300014326 Ga0157380_10043879 Ga0157380_100438793 342
184 3300020075 Ga0206349_1264054 Ga0206349_12640541 342
185 3300021361 Ga0213872_10000181 Ga0213872_100001814 342
186 3300021384 Ga0213876_10001649 Ga0213876_100016496 342
187 3300025245 Ga0207425_1000290 Ga0207425_10002902 342
188 3300025258 Ga0209129_1000202 Ga0209129_10002022 342
189 3300025263 Ga0209565_1003537 Ga0209565_10035374 342
190 3300025294 Ga0209025_1000013 Ga0209025_10000132 342
191 3300025297 Ga0209758_1000014 Ga0209758_10000142 342
192 3300025303 Ga0209051_1006470 Ga0209051_10064709 342
193 3300025904 Ga0207647_10000056 Ga0207647_1000005672 342
194 3300025909 Ga0207705_10000002 Ga0207705_10000002715 342
195 3300025909 Ga0207705_10038006 Ga0207705_100380064 342
196 3300025909 Ga0207705_10074813 Ga0207705_100748132 342
197 3300025909 Ga0207705_10104647 Ga0207705_101046472 342
198 3300025909 Ga0207705_10200748 Ga0207705_102007482 342
199 3300025919 Ga0207657_10219672 Ga0207657_102196722 342
200 3300025920 Ga0207649_10129671 Ga0207649_101296711 342
201 3300025923 Ga0207681_10306074 Ga0207681_103060741 342
202 3300025933 Ga0207706_10039254 Ga0207706_100392543 342
203 3300025972 Ga0207668_10090605 Ga0207668_100906052 342
204 3300026041 Ga0207639_10102736 Ga0207639_101027362 342
205 3300026067 Ga0207678_10055037 Ga0207678_100550373 342
206 3300026078 Ga0207702_10275233 Ga0207702_102752331 342
207 3300026118 Ga0207675_100014410 Ga0207675_1000144107 342
208 3300027312 Ga0209371_1000513 Ga0209371_100051320 342
209 3300028017 Ga0265356_1005464 Ga0265356_10054641 342
210 3300030500 Ga0268256_1000441 Ga0268256_100044120 342
211 3300031241 Ga0265325_10048286 Ga0265325_100482863 342
212 3300031595 Ga0265313_10030254 Ga0265313_100302544 342
213 3300031712 Ga0265342_10068220 Ga0265342_100682202 342
214 3300037312 Ga0395899_0204578 Ga0395899_0204578_121_1170 342
215 3300037418 Ga0395900_0035364 Ga0395900_0035364_1716_2765 342
216 3300037418 Ga0395900_0098645 Ga0395900_0098645_1536_2585 342
217 3300037466 Ga0395898_0356147 Ga0395898_0356147_216_1265 342
218 3300037471 Ga0395905_0000690 Ga0395905_0000690_3626_4672 342
219 3300037471 Ga0395905_0117059 Ga0395905_0117059_909_1955 342
220 3300037471 Ga0395905_0211907 Ga0395905_0211907_362_1411 342
221 3300037471 Ga0395905_0226666 Ga0395905_0226666_311_1357 342
222 3300037471 Ga0395905_0258972 Ga0395905_0258972_310_1377 342
223 3300038443 Ga0395901_0029295 Ga0395901_0029295_1159_2208 342
224 3300038443 Ga0395901_0032436 Ga0395901_0032436_4162_5211 342
225 3300038443 Ga0395901_0367065 Ga0395901_0367065_101_1147 342
226 3300039437 Ga0436365_0794411 Ga0436365_0794411_44111_45157 342
227 3300039447 Ga0436361_0284344 Ga0436361_0284344_30498_31544 342
228 3300044735 Ga0466968_0000819 Ga0466968_0000819_3970_5037 342
229 3300046543 Ga0495645_0253694 Ga0495645_0253694_98_1129 342
230 3300047472 Ga0495686_0000026 Ga0495686_0000026_57790_58830 342
231 3300047472 Ga0495686_0043061 Ga0495686_0043061_267_1319 342
232 3300048905 Ga0496102_0199068 Ga0496102_0199068_725_1765 342
233 3300048920 Ga0496117_0066387 Ga0496117_0066387_42_1082 342
234 3300048921 Ga0496118_0000228 Ga0496118_0000228_89079_90119 342
235 3300048921 Ga0496118_0008099 Ga0496118_0008099_1401_2441 342
236 3300048924 Ga0496121_0000044 Ga0496121_0000044_315603_316646 342
237 3300048925 Ga0496122_0071923 Ga0496122_0071923_41_1081 342
238 3300048926 Ga0496123_0042610 Ga0496123_0042610_2017_3057 342
239 3300048928 Ga0496125_0080859 Ga0496125_0080859_1389_2429 342
240 3300048929 Ga0496126_0138324 Ga0496126_0138324_32_1072 342
241 3300049571 Ga0501034_0093510 Ga0501034_0093510_1043_2089 342
242 3300000546 LJNas_1002031 LJNas_10020311 343
243 3300005327 Ga0070658_10031456 Ga0070658_100314562 343
244 3300005329 Ga0070683_100044840 Ga0070683_1000448402 343
245 3300005329 Ga0070683_100168431 Ga0070683_1001684314 343
246 3300005336 Ga0070680_100033451 Ga0070680_1000334514 343
247 3300005339 Ga0070660_100288882 Ga0070660_1002888821 343
248 3300005341 Ga0070691_10149534 Ga0070691_101495341 343
249 3300005366 Ga0070659_100036033 Ga0070659_1000360331 343
250 3300005436 Ga0070713_100160570 Ga0070713_1001605703 343
251 3300005436 Ga0070713_100257202 Ga0070713_1002572022 343
252 3300005455 Ga0070663_100058919 Ga0070663_1000589192 343
253 3300005458 Ga0070681_10012753 Ga0070681_100127532 343
254 3300005458 Ga0070681_10039368 Ga0070681_100393682 343
255 3300005530 Ga0070679_100000281 Ga0070679_10000028125 343
256 3300005530 Ga0070679_100140261 Ga0070679_1001402612 343
257 3300005535 Ga0070684_100005710 Ga0070684_1000057106 343
258 3300005535 Ga0070684_100066582 Ga0070684_1000665821 343
259 3300005563 Ga0068855_100003216 Ga0068855_10000321613 343
260 3300005563 Ga0068855_100409738 Ga0068855_1004097381 343
261 3300005564 Ga0070664_100015767 Ga0070664_1000157675 343
262 3300005577 Ga0068857_100030614 Ga0068857_1000306141 343
263 3300005578 Ga0068854_100017634 Ga0068854_1000176342 343
264 3300005616 Ga0068852_100001995 Ga0068852_1000019955 343
265 3300009093 Ga0105240_10001240 Ga0105240_1000124018 343
266 3300009093 Ga0105240_10035479 Ga0105240_100354793 343
267 3300009545 Ga0105237_10026893 Ga0105237_100268934 343
268 3300009551 Ga0105238_10000624 Ga0105238_1000062420 343
269 3300009551 Ga0105238_10044116 Ga0105238_100441164 343
270 3300013104 Ga0157370_10001834 Ga0157370_1000183412 343
271 3300013105 Ga0157369_10052790 Ga0157369_100527901 343
272 3300013105 Ga0157369_10318418 Ga0157369_103184181 343
273 3300013296 Ga0157374_10002741 Ga0157374_1000274113 343
274 3300013306 Ga0163162_10000443 Ga0163162_100004436 343
275 3300013307 Ga0157372_10000134 Ga0157372_1000013437 343
276 3300014325 Ga0163163_10208125 Ga0163163_102081252 343
277 3300014968 Ga0157379_10248528 Ga0157379_102485281 343
278 3300014969 Ga0157376_10023921 Ga0157376_100239213 343
279 3300014969 Ga0157376_10124200 Ga0157376_101242002 343
280 3300025904 Ga0207647_10062089 Ga0207647_100620892 343
281 3300025909 Ga0207705_10005367 Ga0207705_100053679 343
282 3300025909 Ga0207705_10050433 Ga0207705_100504332 343
283 3300025912 Ga0207707_10001224 Ga0207707_1000122411 343
284 3300025913 Ga0207695_10006566 Ga0207695_100065661 343
285 3300025919 Ga0207657_10006538 Ga0207657_100065384 343
286 3300025921 Ga0207652_10071658 Ga0207652_100716582 343
287 3300025924 Ga0207694_10002817 Ga0207694_100028177 343
288 3300025939 Ga0207665_10183236 Ga0207665_101832361 343
289 3300025941 Ga0207711_10000014 Ga0207711_10000014113 343
290 3300025944 Ga0207661_10022517 Ga0207661_100225174 343
291 3300025944 Ga0207661_10148653 Ga0207661_101486532 343
292 3300025949 Ga0207667_10000390 Ga0207667_1000039033 343
293 3300025949 Ga0207667_10016742 Ga0207667_100167425 343
294 3300025981 Ga0207640_10068954 Ga0207640_100689542 343
295 3300026078 Ga0207702_10012160 Ga0207702_100121606 343
296 3300026088 Ga0207641_10072485 Ga0207641_100724853 343
297 3300026116 Ga0207674_10010381 Ga0207674_100103815 343
298 3300026142 Ga0207698_10005494 Ga0207698_100054945 343
299 3300028379 Ga0268266_10359699 Ga0268266_103596991 343
300 3300028573 Ga0265334_10043857 Ga0265334_100438572 343
301 3300028666 Ga0265336_10014015 Ga0265336_100140152 343
302 3300028800 Ga0265338_10002352 Ga0265338_100023523 343
303 3300028800 Ga0265338_10002845 Ga0265338_1000284520 343
304 3300028800 Ga0265338_10032103 Ga0265338_100321034 343
305 3300028800 Ga0265338_10061447 Ga0265338_100614472 343
306 3300031235 Ga0265330_10000252 Ga0265330_1000025228 343
307 3300031235 Ga0265330_10000498 Ga0265330_1000049810 343
308 3300031238 Ga0265332_10002353 Ga0265332_100023533 343
309 3300031238 Ga0265332_10063477 Ga0265332_100634771 343
310 3300031239 Ga0265328_10002804 Ga0265328_100028044 343
311 3300031239 Ga0265328_10002920 Ga0265328_100029206 343
312 3300031240 Ga0265320_10049291 Ga0265320_100492912 343
313 3300031241 Ga0265325_10000356 Ga0265325_1000035613 343
314 3300031241 Ga0265325_10002088 Ga0265325_100020884 343
315 3300031241 Ga0265325_10083445 Ga0265325_100834452 343
316 3300031247 Ga0265340_10002404 Ga0265340_100024048 343
317 3300031249 Ga0265339_10000100 Ga0265339_1000010049 343
318 3300031249 Ga0265339_10000235 Ga0265339_1000023518 343
319 3300031249 Ga0265339_10000447 Ga0265339_1000044712 343
320 3300031249 Ga0265339_10009080 Ga0265339_100090802 343
321 3300031249 Ga0265339_10032988 Ga0265339_100329882 343
322 3300031344 Ga0265316_10000483 Ga0265316_1000048319 343
323 3300031344 Ga0265316_10002001 Ga0265316_1000200114 343
324 3300031344 Ga0265316_10062503 Ga0265316_100625031 343
325 3300031595 Ga0265313_10001676 Ga0265313_1000167612 343
326 3300031595 Ga0265313_10002317 Ga0265313_1000231710 343
327 3300031711 Ga0265314_10000195 Ga0265314_1000019545 343
328 3300031711 Ga0265314_10002098 Ga0265314_1000209818 343
329 3300031712 Ga0265342_10000469 Ga0265342_1000046921 343
330 3300031712 Ga0265342_10001091 Ga0265342_100010915 343
331 3300031712 Ga0265342_10015378 Ga0265342_100153782 343
332 3300031712 Ga0265342_10149621 Ga0265342_101496211 343
333 3300037853 Ga0436364_1519815 Ga0436364_1519815_569_1606 343
334 3300039437 Ga0436365_1592832 Ga0436365_1592832_2088_3119 343
335 3300046543 Ga0495645_0218783 Ga0495645_0218783_61_1092 343
336 3300048907 Ga0496104_0074492 Ga0496104_0074492_508_1542 343
337 3300048908 Ga0496105_0092520 Ga0496105_0092520_1024_2061 343
338 3300048929 Ga0496126_0000018 Ga0496126_0000018_335651_336682 343
339 3300049586 Ga0501070_0250046 Ga0501070_0250046_222_1253 343
340 3300049822 Ga0501035_0091412 Ga0501035_0091412_839_1870 343
341 3300049823 Ga0501044_0002558 Ga0501044_0002558_11493_12524 343
342 3300053111 Ga0500572_051091 Ga0500572_051091_131_1174 343
343 3300060353 Ga0501082_0261094 Ga0501082_0261094_447_1478 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

29

337

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9837 3 326
4ast-assembly1.cif.gz_G the apo structure of a bacterial aldo-keto reductase akr14a1 0.9801 3 326
4ast-assembly1.cif.gz_F the apo structure of a bacterial aldo-keto reductase akr14a1 0.9798 3 326
4ast-assembly1.cif.gz_H the apo structure of a bacterial aldo-keto reductase akr14a1 0.9775 3 327
3erp-assembly1.cif.gz_A structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9773 3 326
ID Description Score Start End Superfamily
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9651 16 332 3.20.20.100
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9557 16 332 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.937 14 327 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9334 14 327 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9275 13 327 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A530ZNY9-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.996 121 204 GO:0016491
GO:0051596
AF-A0A529KXV0-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9875 77 192 GO:0016491
GO:0051596
AF-A0A7W1R132-F1-model_v4 Aldo/keto reductase 0.9868 14 202 GO:0016491
GO:0051596
AF-A0A3D6CKH0-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.984 38 233 GO:0016491
GO:0051596
AF-A0A2P7QKJ4-F1-model_v4 Aldo/keto reductase 0.9833 1 340 GO:0016491
GO:0051596

Feature Viewer

pLDDT pTM Quality
88.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map