F415113

General Info

Members Datasets Scaffolds Average Seq Length
342 232 338 264

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100051144|Ga0075430_1000511444
Length 301
Sequence LGRGATGYGRNERQSEVNVADHPYKSPSVRPRPAARGPKPAPIISIRGVVNRFGTQLVHDGVDLDVYPGEVLGIVGGSGSGKSVLLRTMLGLNKPAAGQVVIEGKDITQAPEDELLAVKQRYGVTFQQGALFSSLTVADNIELPIREYFRVSKEALAQLSELRLRMVGLSVDAGAKLPSQLSGGMIKRAALARALALDPSLLFLDEPTAGLDPISAAAFDELVLYLQRGLKLTVVMITHDLDTLVTTCDRVAVLVDRKIVVDTLDGIMKNPHPWIQEYFHGPRARAVQTPGDQGDEPGPRN

Samples

Sample ID Description Type Environment
1 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
4 2884411467 Dyella sp. AD56 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 1.17
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0
Rhizoplane 3.51
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 7.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003233 3300001979 Bacteria 7189
2 JGI24740J21852_10010008 3300001979 Bacteria 3675
3 JGI24740J21852_10024292 3300001979 Bacteria 2058
4 JGI24739J22299_10004668 3300001989 Bacteria 5236
5 JGI24737J22298_10000559 3300001990 Bacteria 13038
6 JGI24735J21928_10001809 3300002067 Bacteria 7509
7 JGI25162J39368_1000072 3300002737 Bacteria 122550
8 JGI25157J39369_1000143 3300002741 Bacteria 60517
9 JGI25163J39215_1001127 3300002771 Bacteria 5360
10 JGI25164J39214_1000115 3300002772 Bacteria 77050
11 JGI25165J46597_1000063 3300003214 Bacteria 205051
12 JGI25153J46596_10008070 3300003215 Bacteria 5079
13 Ga0006562J51391_1001749 3300003578 Bacteria 7922
14 Ga0006562J51391_1001750 3300003578 Bacteria 18300
15 Ga0055538_1002088 3300003751 Bacteria 3191
16 Ga0055533_1002156 3300003756 Bacteria 4698
17 Ga0055535_1000068 3300003761 Bacteria 115329
18 Ga0055542_1000090 3300003762 Bacteria 122550
19 Ga0055529_1000084 3300003763 Bacteria 143720
20 Ga0065165_1001063 3300005262 Bacteria 32832
21 Ga0065704_10079766 3300005289 Bacteria 4086
22 Ga0065707_10095927 3300005295 Bacteria 3322
23 Ga0070658_10004051 3300005327 Bacteria 12010
24 Ga0070676_10038418 3300005328 Bacteria 2765
25 Ga0070676_10061904 3300005328 Bacteria 2225
26 Ga0070676_10450485 3300005328 Bacteria 905
27 Ga0070690_100231721 3300005330 Bacteria 1299
28 Ga0070670_100441284 3300005331 Bacteria 1153
29 Ga0070677_10124138 3300005333 Bacteria 1170
30 Ga0068869_100106789 3300005334 Bacteria 2125
31 Ga0070666_10000010 3300005335 Bacteria 264789
32 Ga0070689_100027312 3300005340 Bacteria 4303
33 Ga0070691_10156839 3300005341 Bacteria 1171
34 Ga0070661_100005371 3300005344 Bacteria 8832
35 Ga0070661_100021626 3300005344 Bacteria 4597
36 Ga0070668_100001998 3300005347 Bacteria 14909
37 Ga0070668_100016378 3300005347 Bacteria 5543
38 Ga0070668_100016553 3300005347 Bacteria 5512
39 Ga0070668_100201217 3300005347 Bacteria 1635
40 Ga0070669_100013073 3300005353 Bacteria 5896
41 Ga0070669_100158090 3300005353 Bacteria 1759
42 Ga0070669_100219436 3300005353 Bacteria 1503
43 Ga0070671_100201049 3300005355 Bacteria 1689
44 Ga0070673_100197112 3300005364 Bacteria 1733
45 Ga0070688_100021073 3300005365 Bacteria 3802
46 Ga0070688_100078168 3300005365 Bacteria 2134
47 Ga0070667_100000070 3300005367 Bacteria 126321
48 Ga0070711_100074721 3300005439 Bacteria 2398
49 Ga0070663_100044488 3300005455 Bacteria 3131
50 Ga0070663_100287794 3300005455 Bacteria 1311
51 Ga0070662_100042506 3300005457 Bacteria 3246
52 Ga0070662_100105248 3300005457 Bacteria 2142
53 Ga0070662_100329421 3300005457 Bacteria 1247
54 Ga0070681_10242753 3300005458 Bacteria 1715
55 Ga0068867_100460376 3300005459 Bacteria 1086
56 Ga0070685_10065106 3300005466 Bacteria 2145
57 Ga0070706_100168101 3300005467 Bacteria 2048
58 Ga0070696_100000267 3300005546 Bacteria 31493
59 Ga0070696_100007203 3300005546 Bacteria 7429
60 Ga0070665_100000339 3300005548 Bacteria 71205
61 Ga0070665_100016966 3300005548 Bacteria 7300
62 Ga0068855_100000696 3300005563 Bacteria 41094
63 Ga0068855_100177002 3300005563 Bacteria 2413
64 Ga0068857_100008376 3300005577 Bacteria 8936
65 Ga0068857_100031079 3300005577 Bacteria 4719
66 Ga0068854_100007700 3300005578 Bacteria 6887
67 Ga0068854_100009207 3300005578 Bacteria 6372
68 Ga0068854_100037537 3300005578 Bacteria 3402
69 Ga0068859_100010234 3300005617 Bacteria 9439
70 Ga0068859_101035461 3300005617 Bacteria 902
71 Ga0068864_100001967 3300005618 Bacteria 16895
72 Ga0068866_10060474 3300005718 Bacteria 1964
73 Ga0068861_100002407 3300005719 Bacteria 12184
74 Ga0068851_10003620 3300005834 Bacteria 6892
75 Ga0068863_100058014 3300005841 Bacteria 3664
76 Ga0068863_100131255 3300005841 Bacteria 2392
77 Ga0068863_100209479 3300005841 Bacteria 1877
78 Ga0068858_100034229 3300005842 Bacteria 4712
79 Ga0068860_100000517 3300005843 Bacteria 47364
80 Ga0068860_100001527 3300005843 Bacteria 24942
81 Ga0068860_100020901 3300005843 Bacteria 6342
82 Ga0068860_100192017 3300005843 Bacteria 1976
83 Ga0068862_100000717 3300005844 Bacteria 33735
84 Ga0068862_100058914 3300005844 Bacteria 3296
85 Ga0068862_100109548 3300005844 Bacteria 2423
86 Ga0068862_100155780 3300005844 Bacteria 2036
87 Ga0070712_100122452 3300006175 Bacteria 1959
88 Ga0075428_100004151 3300006844 Bacteria 15943
89 Ga0075428_100096852 3300006844 Bacteria 3216
90 Ga0075428_100242835 3300006844 Bacteria 1943
91 Ga0075430_100051144 3300006846 Bacteria 3483
92 Ga0075433_10002157 3300006852 Bacteria 14904
93 Ga0075433_10391977 3300006852 Bacteria 1226
94 Ga0075434_100007796 3300006871 Bacteria 9916
95 Ga0075429_100059229 3300006880 Bacteria 3335
96 Ga0068865_100025141 3300006881 Bacteria 3914
97 Ga0068865_100050396 3300006881 Bacteria 2876
98 Ga0097620_100010235 3300006931 Bacteria 9439
99 Ga0097620_101035250 3300006931 Bacteria 902
100 Ga0099794_10017114 3300007265 Bacteria 3226
101 Ga0099794_10069042 3300007265 Bacteria 1729
102 Ga0099795_10000289 3300007788 Bacteria 8995
103 Ga0105250_10021170 3300009092 Bacteria 2625
104 Ga0105240_10000633 3300009093 Bacteria 64950
105 Ga0105240_10003017 3300009093 Bacteria 26477
106 Ga0105240_10017993 3300009093 Bacteria 9505
107 Ga0105240_10022080 3300009093 Bacteria 8447
108 Ga0105240_10101277 3300009093 Bacteria 3504
109 Ga0105240_10674715 3300009093 Bacteria 1131
110 Ga0111539_10000362 3300009094 Bacteria 55860
111 Ga0111539_10045704 3300009094 Bacteria 5241
112 Ga0111539_10050610 3300009094 Bacteria 4949
113 Ga0111539_10174885 3300009094 Bacteria 2508
114 Ga0111539_10270348 3300009094 Bacteria 1978
115 Ga0105247_10002758 3300009101 Bacteria 11759
116 Ga0114129_10055597 3300009147 Bacteria 5546
117 Ga0114129_10414586 3300009147 Bacteria 1773
118 Ga0105241_10458702 3300009174 Bacteria 1129
119 Ga0105248_10108514 3300009177 Bacteria 3130
120 Ga0105248_10108875 3300009177 Bacteria 3124
121 Ga0105248_10119702 3300009177 Bacteria 2970
122 Ga0105237_10000148 3300009545 Bacteria 98986
123 Ga0105238_10000044 3300009551 Bacteria 151485
124 Ga0105238_10099909 3300009551 Bacteria 2884
125 Ga0105249_10045696 3300009553 Bacteria 3983
126 Ga0105249_10448669 3300009553 Bacteria 1328
127 Ga0105249_10552264 3300009553 Bacteria 1202
128 Ga0105030_100317 3300009987 Bacteria 4231
129 Ga0099796_10002865 3300010159 Bacteria 3886
130 Ga0105239_10069898 3300010375 Bacteria 3856
131 Ga0157314_1000057 3300012500 Bacteria 11802
132 Ga0157373_10043822 3300013100 Bacteria 3195
133 Ga0157369_10072053 3300013105 Bacteria 3708
134 Ga0157369_10361983 3300013105 Bacteria 1506
135 Ga0157374_10214492 3300013296 Bacteria 1888
136 Ga0157378_10374881 3300013297 Bacteria 1396
137 Ga0163162_10000193 3300013306 Bacteria 56063
138 Ga0157514_120288 3300013874 Bacteria 1810
139 Ga0163163_10193138 3300014325 Bacteria 2084
140 Ga0157380_10000385 3300014326 Bacteria 26615
141 Ga0157380_10007459 3300014326 Bacteria 7767
142 Ga0157380_10543923 3300014326 Bacteria 1138
143 Ga0157376_10019218 3300014969 Bacteria 5260
144 Ga0183368_1002 3300015687 Bacteria 1865598
145 Ga0163161_10102461 3300017792 Bacteria 2132
146 Ga0209760_100542 3300025207 Bacteria 7118
147 Ga0209784_100042 3300025224 Bacteria 218070
148 Ga0209674_100033 3300025226 Bacteria 423450
149 Ga0209674_103136 3300025226 Bacteria 3147
150 Ga0207427_100096 3300025231 Bacteria 123398
151 Ga0207427_106390 3300025231 Bacteria 1498
152 Ga0209437_100074 3300025233 Bacteria 300858
153 Ga0209437_101781 3300025233 Bacteria 4653
154 Ga0209258_100136 3300025242 Bacteria 169078
155 Ga0209646_1002309 3300025246 Bacteria 4334
156 Ga0209646_1006125 3300025246 Bacteria 2038
157 Ga0209026_1000072 3300025250 Bacteria 205447
158 Ga0209148_1000036 3300025254 Bacteria 530505
159 Ga0209148_1001842 3300025254 Bacteria 8891
160 Ga0209759_1000490 3300025256 Bacteria 43624
161 Ga0209233_1000040 3300025261 Bacteria 530395
162 Ga0209455_1000071 3300025272 Bacteria 300858
163 Ga0209758_1000481 3300025297 Bacteria 65650
164 Ga0209758_1017224 3300025297 Bacteria 3613
165 Ga0207656_10013657 3300025321 Bacteria 3110
166 Ga0207680_10000002 3300025903 Bacteria 1018646
167 Ga0207680_10034900 3300025903 Bacteria 2882
168 Ga0207647_10002363 3300025904 Bacteria 14333
169 Ga0207647_10004228 3300025904 Bacteria 10644
170 Ga0207645_10007898 3300025907 Bacteria 7480
171 Ga0207645_10046879 3300025907 Bacteria 2760
172 Ga0207705_10013630 3300025909 Bacteria 5865
173 Ga0207707_10063448 3300025912 Bacteria 3216
174 Ga0207695_10001588 3300025913 Bacteria 36909
175 Ga0207695_10033104 3300025913 Bacteria 5645
176 Ga0207695_10073877 3300025913 Bacteria 3473
177 Ga0207695_10135641 3300025913 Bacteria 2414
178 Ga0207671_10000028 3300025914 Bacteria 263092
179 Ga0207649_10018790 3300025920 Bacteria 3940
180 Ga0207681_10013671 3300025923 Bacteria 5025
181 Ga0207694_10000517 3300025924 Bacteria 34931
182 Ga0207694_10081152 3300025924 Bacteria 2547
183 Ga0207650_10090000 3300025925 Bacteria 2343
184 Ga0207706_10041826 3300025933 Bacteria 4062
185 Ga0207706_10535342 3300025933 Bacteria 1009
186 Ga0207704_10016564 3300025938 Bacteria 3790
187 Ga0207704_10149128 3300025938 Bacteria 1648
188 Ga0207711_10257446 3300025941 Bacteria 1603
189 Ga0207711_10675679 3300025941 Bacteria 963
190 Ga0207667_10000080 3300025949 Bacteria 163287
191 Ga0207667_10000344 3300025949 Bacteria 63681
192 Ga0207651_10245482 3300025960 Bacteria 1462
193 Ga0207712_10306523 3300025961 Bacteria 1305
194 Ga0207668_10000912 3300025972 Bacteria 17798
195 Ga0207668_10001104 3300025972 Bacteria 16060
196 Ga0207668_10026609 3300025972 Bacteria 3757
197 Ga0207668_10071407 3300025972 Bacteria 2480
198 Ga0207668_10187019 3300025972 Bacteria 1638
199 Ga0207640_10000190 3300025981 Bacteria 43737
200 Ga0207640_10005347 3300025981 Bacteria 7000
201 Ga0207640_10103811 3300025981 Bacteria 1999
202 Ga0207658_10000035 3300025986 Bacteria 154818
203 Ga0207658_10135652 3300025986 Bacteria 1984
204 Ga0207658_10284356 3300025986 Bacteria 1419
205 Ga0207677_10059921 3300026023 Bacteria 2628
206 Ga0207678_10050935 3300026067 Bacteria 3576
207 Ga0207678_10060846 3300026067 Bacteria 3248
208 Ga0207641_10064462 3300026088 Bacteria 3132
209 Ga0207641_10186143 3300026088 Bacteria 1905
210 Ga0207641_10331043 3300026088 Bacteria 1447
211 Ga0207648_10175082 3300026089 Bacteria 1897
212 Ga0207674_10000090 3300026116 Bacteria 99821
213 Ga0207675_100001556 3300026118 Bacteria 22976
214 Ga0209179_1003938 3300027512 Bacteria 2196
215 Ga0209588_1052722 3300027671 Bacteria 1316
216 Ga0207428_10001201 3300027907 Bacteria 27753
217 Ga0207428_10121331 3300027907 Bacteria 2004
218 Ga0207428_10121855 3300027907 Bacteria 1999
219 Ga0265356_1000425 3300028017 Bacteria 7661
220 Ga0268266_10000004 3300028379 Bacteria 1495817
221 Ga0268265_10004078 3300028380 Bacteria 10263
222 Ga0268265_10020628 3300028380 Bacteria 4602
223 Ga0268265_10041795 3300028380 Bacteria 3396
224 Ga0268265_10310590 3300028380 Bacteria 1423
225 Ga0268264_10000416 3300028381 Bacteria 60203
226 Ga0268264_10021783 3300028381 Bacteria 5231
227 Ga0265326_10008324 3300028558 Bacteria 3131
228 Ga0265319_1006158 3300028563 Bacteria 5602
229 Ga0265334_10010841 3300028573 Bacteria 3848
230 Ga0265318_10001075 3300028577 Bacteria 17150
231 Ga0307517_10201161 3300028786 Bacteria 1245
232 Ga0265338_10014561 3300028800 Bacteria 8737
233 Ga0265338_10025830 3300028800 Bacteria 5944
234 Ga0265770_1000126 3300030878 Bacteria 9239
235 Ga0265760_10000920 3300031090 Bacteria 8488
236 Ga0265330_10009231 3300031235 Bacteria 4695
237 Ga0265330_10061438 3300031235 Bacteria 1635
238 Ga0265332_10003731 3300031238 Bacteria 7291
239 Ga0265328_10000718 3300031239 Bacteria 15354
240 Ga0265328_10015185 3300031239 Bacteria 3022
241 Ga0265320_10062302 3300031240 Bacteria 1776
242 Ga0265325_10045666 3300031241 Bacteria 2275
243 Ga0265329_10005847 3300031242 Bacteria 4935
244 Ga0265331_10002872 3300031250 Bacteria 11391
245 Ga0265316_10110812 3300031344 Bacteria 2078
246 Ga0307408_100146765 3300031548 Bacteria 1858
247 Ga0265313_10012381 3300031595 Bacteria 5212
248 Ga0265313_10040434 3300031595 Bacteria 2305
249 Ga0265342_10014434 3300031712 Bacteria 5243
250 Ga0307516_10000013 3300031730 Bacteria 217896
251 Ga0307416_100064846 3300032002 Bacteria 2999
252 Ga0307414_10027719 3300032004 Bacteria 3665
253 Ga0307415_100047256 3300032126 Bacteria 2897
254 Ga0307415_100303385 3300032126 Bacteria 1324
255 Ga0307510_10000059 3300033180 Bacteria 84839
256 Ga0373923_0035723 3300035111 Bacteria 2025
257 Ga0373956_0048647 3300035119 Bacteria 1900
258 Ga0373937_0431223 3300036401 Bacteria 1251
259 Ga0395899_0195383 3300037312 Bacteria 1414
260 Ga0395905_0079366 3300037471 Bacteria 3076
261 Ga0436360_0141899 3300039438 Bacteria 3321
262 Ga0451577_0418582 3300042876 Bacteria 1216
263 Ga0466969_0066383 3300044656 Bacteria 1742
264 Ga0466982_0000007 3300044672 Bacteria 250854
265 Ga0466966_0019462 3300044684 Bacteria 4466
266 Ga0466961_0334290 3300044693 Bacteria 923
267 Ga0466964_0000672 3300044706 Bacteria 10967
268 Ga0453684_0020520 3300044712 Bacteria 9957
269 Ga0466971_0006693 3300044719 Bacteria 5015
270 Ga0466968_0018035 3300044735 Bacteria 2828
271 Ga0466970_0081861 3300044765 Bacteria 1745
272 Ga0466960_0021295 3300044901 Bacteria 2884
273 Ga0451576_0070812 3300045051 Bacteria 3629
274 Ga0466958_0033140 3300045836 Bacteria 3077
275 Ga0466967_0009916 3300045976 Bacteria 7108
276 Ga0466967_0464772 3300045976 Bacteria 1238
277 Ga0495627_000209 3300046453 Bacteria 63424
278 Ga0495629_0462092 3300046459 Bacteria 859
279 Ga0495638_0000357 3300046460 Bacteria 56906
280 Ga0495638_0000907 3300046460 Bacteria 30264
281 Ga0495650_0000074 3300046471 Bacteria 251346
282 Ga0495650_0000134 3300046471 Bacteria 173331
283 Ga0495580_0220131 3300046472 Bacteria 1305
284 Ga0495662_0108482 3300046476 Bacteria 1360
285 Ga0495625_0020790 3300046660 Bacteria 5060
286 Ga0495599_0204397 3300046678 Bacteria 1213
287 Ga0495658_0029949 3300046683 Bacteria 2951
288 Ga0495669_0000001 3300046684 Bacteria 291866
289 Ga0495669_0000172 3300046684 Bacteria 40888
290 Ga0495677_0064490 3300047445 Bacteria 1361
291 Ga0496102_0754407 3300048905 Bacteria 896
292 Ga0496104_0000936 3300048907 Bacteria 25051
293 Ga0496104_0219583 3300048907 Bacteria 1813
294 Ga0496105_0001552 3300048908 Bacteria 16255
295 Ga0496106_0348758 3300048909 Bacteria 1189
296 Ga0496112_0416131 3300048915 Bacteria 1283
297 Ga0496113_0003067 3300048916 Bacteria 9912
298 Ga0496114_0006022 3300048917 Bacteria 9542
299 Ga0496114_0100908 3300048917 Bacteria 2463
300 Ga0496115_0002040 3300048918 Bacteria 14453
301 Ga0496115_0020146 3300048918 Bacteria 5141
302 Ga0496117_0013525 3300048920 Bacteria 7113
303 Ga0496118_0000434 3300048921 Bacteria 69469
304 Ga0496119_0001389 3300048922 Bacteria 29376
305 Ga0496120_0001232 3300048923 Bacteria 32376
306 Ga0496121_0000282 3300048924 Bacteria 105900
307 Ga0496121_0101792 3300048924 Bacteria 2214
308 Ga0496121_0260525 3300048924 Bacteria 1197
309 Ga0496124_0079263 3300048927 Bacteria 2705
310 Ga0496125_0000291 3300048928 Bacteria 98752
311 Ga0496125_0053640 3300048928 Bacteria 3303
312 Ga0496126_0129435 3300048929 Bacteria 2182
313 Ga0496126_0130799 3300048929 Bacteria 2169
314 Ga0501038_0000011 3300049574 Bacteria 181217
315 Ga0501067_0016436 3300049583 Bacteria 4088
316 Ga0501073_0007079 3300049589 Bacteria 8356
317 Ga0501074_0262581 3300049590 Bacteria 1227
318 Ga0501077_0013571 3300049593 Bacteria 5108
319 Ga0501257_001923 3300049686 Bacteria 4325
320 Ga0501080_0007371 3300049742 Bacteria 9928
321 Ga0501045_0008507 3300049824 Bacteria 7153
322 nmdc:mga09592_69232_c1 3300050508 Bacteria 2993
323 nmdc:mga0qj67_43011_c1 3300050509 Bacteria 3557
324 nmdc:mga06r32_593951_c1 3300050510 Bacteria 1078
325 nmdc:mga08y16_162688_c1 3300050511 Bacteria 2319
326 nmdc:mga08y16_6375_c1 3300050511 Bacteria 12372
327 nmdc:mga08y16_64041_c1 3300050511 Bacteria 3840
328 nmdc:mga08y16_84971_c1 3300050511 Bacteria 3298
329 nmdc:mga0n895_1635_c1 3300050512 Bacteria 16940
330 nmdc:mga0rr50_15525_c1 3300050513 Bacteria 5029
331 nmdc:mga0a205_133343_c1 3300050515 Bacteria 2384
332 nmdc:mga0a205_1685_c1 3300050515 Bacteria 19075
333 nmdc:mga0a205_384121_c1 3300050515 Bacteria 1269
334 Ga0501084_0219168 3300054114 Bacteria 1605
335 Ga0590075_014607 3300059424 Bacteria 1921
336 Ga0501082_0005967 3300060353 Bacteria 10564
337 Ga0501082_0044386 3300060353 Bacteria 3834
338 Ga0466962_0006046 3300061719 Bacteria 5823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100020901 Ga0068860_1000209015 240
2 3300028381 Ga0268264_10021783 Ga0268264_100217833 240
3 3300005841 Ga0068863_100209479 Ga0068863_1002094792 245
4 3300009987 Ga0105030_100317 Ga0105030_1003172 245
5 3300013874 Ga0157514_120288 Ga0157514_1202882 245
6 3300025941 Ga0207711_10675679 Ga0207711_106756791 245
7 3300035111 Ga0373923_0035723 Ga0373923_0035723_130_879 245
8 3300035119 Ga0373956_0048647 Ga0373956_0048647_256_1005 245
9 3300046459 Ga0495629_0462092 Ga0495629_0462092_46_795 245
10 3300046472 Ga0495580_0220131 Ga0495580_0220131_546_1295 245
11 3300048905 Ga0496102_0754407 Ga0496102_0754407_13_762 245
12 3300048907 Ga0496104_0000936 Ga0496104_0000936_23577_24326 245
13 3300048908 Ga0496105_0001552 Ga0496105_0001552_14556_15305 245
14 3300048917 Ga0496114_0006022 Ga0496114_0006022_568_1317 245
15 3300048918 Ga0496115_0020146 Ga0496115_0020146_726_1475 245
16 3300049583 Ga0501067_0016436 Ga0501067_0016436_2815_3567 245
17 3300049589 Ga0501073_0007079 Ga0501073_0007079_1008_1760 245
18 3300049590 Ga0501074_0262581 Ga0501074_0262581_387_1139 245
19 3300049593 Ga0501077_0013571 Ga0501077_0013571_699_1451 245
20 3300049742 Ga0501080_0007371 Ga0501080_0007371_2368_3120 245
21 3300054114 Ga0501084_0219168 Ga0501084_0219168_505_1257 245
22 3300060353 Ga0501082_0005967 Ga0501082_0005967_3258_4010 245
23 3300046476 Ga0495662_0108482 Ga0495662_0108482_425_1177 246
24 3300046683 Ga0495658_0029949 Ga0495658_0029949_36_788 246
25 3300049574 Ga0501038_0000011 Ga0501038_0000011_149569_150333 247
26 3300048917 Ga0496114_0100908 Ga0496114_0100908_1608_2372 249
27 3300028558 Ga0265326_10008324 Ga0265326_100083242 250
28 3300028563 Ga0265319_1006158 Ga0265319_10061584 250
29 3300028573 Ga0265334_10010841 Ga0265334_100108414 250
30 3300028577 Ga0265318_10001075 Ga0265318_100010757 250
31 3300028800 Ga0265338_10025830 Ga0265338_100258304 250
32 3300031235 Ga0265330_10009231 Ga0265330_100092315 250
33 3300031238 Ga0265332_10003731 Ga0265332_100037314 250
34 3300031239 Ga0265328_10000718 Ga0265328_1000071810 250
35 3300031240 Ga0265320_10062302 Ga0265320_100623022 250
36 3300031241 Ga0265325_10045666 Ga0265325_100456663 250
37 3300031242 Ga0265329_10005847 Ga0265329_100058474 250
38 3300031250 Ga0265331_10002872 Ga0265331_1000287211 250
39 3300031344 Ga0265316_10110812 Ga0265316_101108123 250
40 3300031595 Ga0265313_10012381 Ga0265313_100123814 250
41 3300031712 Ga0265342_10014434 Ga0265342_100144345 250
42 3300005353 Ga0070669_100158090 Ga0070669_1001580902 251
43 3300005457 Ga0070662_100329421 Ga0070662_1003294211 251
44 3300006844 Ga0075428_100004151 Ga0075428_1000041515 251
45 3300006844 Ga0075428_100242835 Ga0075428_1002428352 251
46 3300006852 Ga0075433_10002157 Ga0075433_1000215714 251
47 3300006871 Ga0075434_100007796 Ga0075434_1000077965 251
48 3300009094 Ga0111539_10000362 Ga0111539_100003625 251
49 3300009094 Ga0111539_10270348 Ga0111539_102703482 251
50 3300009147 Ga0114129_10055597 Ga0114129_100555973 251
51 3300009147 Ga0114129_10414586 Ga0114129_104145862 251
52 3300014326 Ga0157380_10007459 Ga0157380_100074594 251
53 3300027907 Ga0207428_10001201 Ga0207428_1000120124 251
54 3300027907 Ga0207428_10121331 Ga0207428_101213312 251
55 3300031235 Ga0265330_10061438 Ga0265330_100614382 251
56 3300036401 Ga0373937_0431223 Ga0373937_0431223_255_1025 251
57 3300046678 Ga0495599_0204397 Ga0495599_0204397_112_882 251
58 3300048924 Ga0496121_0000282 Ga0496121_0000282_100561_101358 251
59 3300049824 Ga0501045_0008507 Ga0501045_0008507_2941_3711 251
60 3300050510 nmdc:mga06r32_593951_c1 nmdc:mga06r32_593951_c1_83_853 251
61 3300050511 nmdc:mga08y16_6375_c1 nmdc:mga08y16_6375_c1_4564_5334 251
62 3300050511 nmdc:mga08y16_84971_c1 nmdc:mga08y16_84971_c1_1698_2468 251
63 3300050512 nmdc:mga0n895_1635_c1 nmdc:mga0n895_1635_c1_645_1415 251
64 3300050513 nmdc:mga0rr50_15525_c1 nmdc:mga0rr50_15525_c1_4005_4775 251
65 3300050515 nmdc:mga0a205_1685_c1 nmdc:mga0a205_1685_c1_11860_12630 251
66 3300050515 nmdc:mga0a205_384121_c1 nmdc:mga0a205_384121_c1_476_1246 251
67 3300059424 Ga0590075_014607 Ga0590075_014607_577_1350 251
68 3300060353 Ga0501082_0044386 Ga0501082_0044386_576_1346 251
69 3300005327 Ga0070658_10004051 Ga0070658_1000405111 252
70 3300005335 Ga0070666_10000010 Ga0070666_10000010114 252
71 3300005344 Ga0070661_100021626 Ga0070661_1000216262 252
72 3300005548 Ga0070665_100000339 Ga0070665_10000033939 252
73 3300009551 Ga0105238_10000044 Ga0105238_1000004442 252
74 3300013306 Ga0163162_10000193 Ga0163162_1000019341 252
75 3300025903 Ga0207680_10000002 Ga0207680_10000002277 252
76 3300025909 Ga0207705_10013630 Ga0207705_100136304 252
77 3300025920 Ga0207649_10018790 Ga0207649_100187902 252
78 3300025924 Ga0207694_10000517 Ga0207694_100005177 252
79 3300028379 Ga0268266_10000004 Ga0268266_10000004275 252
80 3300028786 Ga0307517_10201161 Ga0307517_102011612 252
81 3300031239 Ga0265328_10015185 Ga0265328_100151851 252
82 3300033180 Ga0307510_10000059 Ga0307510_1000005958 252
83 3300046471 Ga0495650_0000074 Ga0495650_0000074_29716_30492 252
84 3300046660 Ga0495625_0020790 Ga0495625_0020790_3783_4559 252
85 3300046684 Ga0495669_0000001 Ga0495669_0000001_46432_47247 252
86 3300048924 Ga0496121_0101792 Ga0496121_0101792_876_1652 252
87 3300048928 Ga0496125_0053640 Ga0496125_0053640_2045_2821 252
88 3300005439 Ga0070711_100074721 Ga0070711_1000747212 253
89 3300005618 Ga0068864_100001967 Ga0068864_10000196710 253
90 3300006175 Ga0070712_100122452 Ga0070712_1001224522 253
91 3300039438 Ga0436360_0141899 Ga0436360_0141899_1958_2731 253
92 3300047445 Ga0495677_0064490 Ga0495677_0064490_73_897 253
93 3300005328 Ga0070676_10038418 Ga0070676_100384183 254
94 3300005328 Ga0070676_10450485 Ga0070676_104504851 254
95 3300005331 Ga0070670_100441284 Ga0070670_1004412841 254
96 3300005334 Ga0068869_100106789 Ga0068869_1001067892 254
97 3300005347 Ga0070668_100201217 Ga0070668_1002012172 254
98 3300005353 Ga0070669_100013073 Ga0070669_1000130732 254
99 3300005365 Ga0070688_100021073 Ga0070688_1000210733 254
100 3300005458 Ga0070681_10242753 Ga0070681_102427532 254
101 3300005548 Ga0070665_100016966 Ga0070665_1000169662 254
102 3300005719 Ga0068861_100002407 Ga0068861_1000024072 254
103 3300005844 Ga0068862_100000717 Ga0068862_10000071732 254
104 3300006844 Ga0075428_100096852 Ga0075428_1000968522 254
105 3300006852 Ga0075433_10391977 Ga0075433_103919772 254
106 3300006880 Ga0075429_100059229 Ga0075429_1000592292 254
107 3300006881 Ga0068865_100050396 Ga0068865_1000503962 254
108 3300009094 Ga0111539_10050610 Ga0111539_100506103 254
109 3300009094 Ga0111539_10174885 Ga0111539_101748852 254
110 3300009553 Ga0105249_10045696 Ga0105249_100456962 254
111 3300025907 Ga0207645_10046879 Ga0207645_100468793 254
112 3300025912 Ga0207707_10063448 Ga0207707_100634482 254
113 3300025923 Ga0207681_10013671 Ga0207681_100136714 254
114 3300025938 Ga0207704_10149128 Ga0207704_101491282 254
115 3300025972 Ga0207668_10187019 Ga0207668_101870192 254
116 3300026023 Ga0207677_10059921 Ga0207677_100599213 254
117 3300026118 Ga0207675_100001556 Ga0207675_1000015563 254
118 3300027907 Ga0207428_10121855 Ga0207428_101218551 254
119 3300028380 Ga0268265_10310590 Ga0268265_103105902 254
120 3300028800 Ga0265338_10014561 Ga0265338_100145617 254
121 3300031548 Ga0307408_100146765 Ga0307408_1001467652 254
122 3300032002 Ga0307416_100064846 Ga0307416_1000648461 254
123 3300046453 Ga0495627_000209 Ga0495627_000209_40121_40969 254
124 3300050508 nmdc:mga09592_69232_c1 nmdc:mga09592_69232_c1_1604_2389 254
125 3300050511 nmdc:mga08y16_162688_c1 nmdc:mga08y16_162688_c1_1459_2244 254
126 3300050511 nmdc:mga08y16_64041_c1 nmdc:mga08y16_64041_c1_2672_3457 254
127 3300050515 nmdc:mga0a205_133343_c1 nmdc:mga0a205_133343_c1_615_1400 254
128 3300005546 Ga0070696_100000267 Ga0070696_10000026722 255
129 3300007265 Ga0099794_10017114 Ga0099794_100171144 255
130 3300007265 Ga0099794_10069042 Ga0099794_100690422 255
131 3300007788 Ga0099795_10000289 Ga0099795_100002894 255
132 3300009093 Ga0105240_10101277 Ga0105240_101012773 255
133 3300009553 Ga0105249_10552264 Ga0105249_105522642 255
134 3300010159 Ga0099796_10002865 Ga0099796_100028653 255
135 3300025913 Ga0207695_10073877 Ga0207695_100738773 255
136 3300026088 Ga0207641_10064462 Ga0207641_100644622 255
137 3300027512 Ga0209179_1003938 Ga0209179_10039382 255
138 3300027671 Ga0209588_1052722 Ga0209588_10527222 255
139 3300031595 Ga0265313_10040434 Ga0265313_100404343 255
140 3300032004 Ga0307414_10027719 Ga0307414_100277192 255
141 3300032126 Ga0307415_100047256 Ga0307415_1000472563 255
142 3300046684 Ga0495669_0000172 Ga0495669_0000172_8614_9438 255
143 iso_pu_bacteria 2554235132 2554814125 255
144 iso_pu_bacteria 2593339238 2595447261 255
145 iso_pu_bacteria 2606217733 2608384589 255
146 3300028017 Ga0265356_1000425 Ga0265356_10004254 256
147 3300032126 Ga0307415_100303385 Ga0307415_1003033852 256
148 3300005367 Ga0070667_100000070 Ga0070667_10000007054 257
149 3300005617 Ga0068859_101035461 Ga0068859_1010354612 257
150 3300005841 Ga0068863_100131255 Ga0068863_1001312553 257
151 3300006931 Ga0097620_101035250 Ga0097620_1010352501 257
152 3300009092 Ga0105250_10021170 Ga0105250_100211702 257
153 3300009101 Ga0105247_10002758 Ga0105247_1000275810 257
154 3300009177 Ga0105248_10108514 Ga0105248_101085143 257
155 3300014325 Ga0163163_10193138 Ga0163163_101931382 257
156 3300025903 Ga0207680_10034900 Ga0207680_100349003 257
157 3300025941 Ga0207711_10257446 Ga0207711_102574462 257
158 3300025986 Ga0207658_10000035 Ga0207658_1000003557 257
159 3300026088 Ga0207641_10331043 Ga0207641_103310432 257
160 3300013297 Ga0157378_10374881 Ga0157378_103748812 258
161 3300030878 Ga0265770_1000126 Ga0265770_10001265 258
162 3300031090 Ga0265760_10000920 Ga0265760_100009204 258
163 3300042876 Ga0451577_0418582 Ga0451577_0418582_352_1149 258
164 3300044712 Ga0453684_0020520 Ga0453684_0020520_47_844 258
165 3300045051 Ga0451576_0070812 Ga0451576_0070812_728_1525 258
166 3300005289 Ga0065704_10079766 Ga0065704_100797662 259
167 3300005328 Ga0070676_10061904 Ga0070676_100619042 259
168 3300005330 Ga0070690_100231721 Ga0070690_1002317212 259
169 3300005333 Ga0070677_10124138 Ga0070677_101241382 259
170 3300005347 Ga0070668_100016553 Ga0070668_1000165534 259
171 3300005353 Ga0070669_100219436 Ga0070669_1002194361 259
172 3300005364 Ga0070673_100197112 Ga0070673_1001971122 259
173 3300005457 Ga0070662_100042506 Ga0070662_1000425062 259
174 3300005457 Ga0070662_100105248 Ga0070662_1001052482 259
175 3300005459 Ga0068867_100460376 Ga0068867_1004603762 259
176 3300005546 Ga0070696_100007203 Ga0070696_1000072033 259
177 3300005577 Ga0068857_100031079 Ga0068857_1000310794 259
178 3300005578 Ga0068854_100037537 Ga0068854_1000375373 259
179 3300005718 Ga0068866_10060474 Ga0068866_100604742 259
180 3300005844 Ga0068862_100058914 Ga0068862_1000589143 259
181 3300006881 Ga0068865_100025141 Ga0068865_1000251413 259
182 3300009093 Ga0105240_10000633 Ga0105240_100006337 259
183 3300009093 Ga0105240_10003017 Ga0105240_1000301717 259
184 3300009177 Ga0105248_10108875 Ga0105248_101088753 259
185 3300013100 Ga0157373_10043822 Ga0157373_100438223 259
186 3300013296 Ga0157374_10214492 Ga0157374_102144922 259
187 3300017792 Ga0163161_10102461 Ga0163161_101024613 259
188 3300025226 Ga0209674_103136 Ga0209674_1031362 259
189 3300025231 Ga0207427_106390 Ga0207427_1063902 259
190 3300025233 Ga0209437_101781 Ga0209437_1017815 259
191 3300025254 Ga0209148_1001842 Ga0209148_10018428 259
192 3300025907 Ga0207645_10007898 Ga0207645_100078984 259
193 3300025933 Ga0207706_10041826 Ga0207706_100418262 259
194 3300025938 Ga0207704_10016564 Ga0207704_100165643 259
195 3300025960 Ga0207651_10245482 Ga0207651_102454822 259
196 3300025972 Ga0207668_10000912 Ga0207668_100009127 259
197 3300025972 Ga0207668_10071407 Ga0207668_100714072 259
198 3300025981 Ga0207640_10103811 Ga0207640_101038112 259
199 3300025986 Ga0207658_10135652 Ga0207658_101356522 259
200 3300026089 Ga0207648_10175082 Ga0207648_101750822 259
201 3300028380 Ga0268265_10041795 Ga0268265_100417952 259
202 3300031730 Ga0307516_10000013 Ga0307516_10000013186 259
203 3300048920 Ga0496117_0013525 Ga0496117_0013525_3982_4785 259
204 3300048921 Ga0496118_0000434 Ga0496118_0000434_36393_37196 259
205 3300048922 Ga0496119_0001389 Ga0496119_0001389_25729_26547 259
206 3300048923 Ga0496120_0001232 Ga0496120_0001232_5054_5872 259
207 3300048924 Ga0496121_0260525 Ga0496121_0260525_133_951 259
208 3300048927 Ga0496124_0079263 Ga0496124_0079263_1680_2483 259
209 3300048929 Ga0496126_0130799 Ga0496126_0130799_1095_1913 259
210 3300005347 Ga0070668_100016378 Ga0070668_1000163784 260
211 3300005355 Ga0070671_100201049 Ga0070671_1002010492 260
212 3300005563 Ga0068855_100000696 Ga0068855_10000069632 260
213 3300005578 Ga0068854_100007700 Ga0068854_1000077007 260
214 3300005617 Ga0068859_100010234 Ga0068859_1000102345 260
215 3300005841 Ga0068863_100058014 Ga0068863_1000580142 260
216 3300005843 Ga0068860_100001527 Ga0068860_10000152721 260
217 3300005844 Ga0068862_100155780 Ga0068862_1001557802 260
218 3300006931 Ga0097620_100010235 Ga0097620_1000102355 260
219 3300009093 Ga0105240_10017993 Ga0105240_100179936 260
220 3300009093 Ga0105240_10674715 Ga0105240_106747152 260
221 3300009553 Ga0105249_10448669 Ga0105249_104486691 260
222 3300014326 Ga0157380_10543923 Ga0157380_105439232 260
223 3300025297 Ga0209758_1017224 Ga0209758_10172245 260
224 3300025913 Ga0207695_10033104 Ga0207695_100331042 260
225 3300025913 Ga0207695_10135641 Ga0207695_101356412 260
226 3300025925 Ga0207650_10090000 Ga0207650_100900001 260
227 3300025949 Ga0207667_10000344 Ga0207667_100003444 260
228 3300025961 Ga0207712_10306523 Ga0207712_103065232 260
229 3300025972 Ga0207668_10026609 Ga0207668_100266094 260
230 3300025981 Ga0207640_10000190 Ga0207640_100001904 260
231 3300026088 Ga0207641_10186143 Ga0207641_101861432 260
232 3300028380 Ga0268265_10004078 Ga0268265_100040783 260
233 3300049686 Ga0501257_001923 Ga0501257_001923_2422_3246 260
234 iso_pu_bacteria 2884411467 2884416080 260
235 3300005340 Ga0070689_100027312 Ga0070689_1000273122 261
236 3300005344 Ga0070661_100005371 Ga0070661_1000053716 261
237 3300005347 Ga0070668_100001998 Ga0070668_1000019983 261
238 3300005843 Ga0068860_100000517 Ga0068860_10000051742 261
239 3300005843 Ga0068860_100192017 Ga0068860_1001920172 261
240 3300005844 Ga0068862_100109548 Ga0068862_1001095482 261
241 3300009177 Ga0105248_10119702 Ga0105248_101197023 261
242 3300009551 Ga0105238_10099909 Ga0105238_100999092 261
243 3300013105 Ga0157369_10361983 Ga0157369_103619832 261
244 3300025924 Ga0207694_10081152 Ga0207694_100811522 261
245 3300025972 Ga0207668_10001104 Ga0207668_1000110410 261
246 3300025986 Ga0207658_10284356 Ga0207658_102843562 261
247 3300026067 Ga0207678_10050935 Ga0207678_100509352 261
248 3300028380 Ga0268265_10020628 Ga0268265_100206286 261
249 3300028381 Ga0268264_10000416 Ga0268264_1000041628 261
250 3300044656 Ga0466969_0066383 Ga0466969_0066383_64_864 261
251 3300044672 Ga0466982_0000007 Ga0466982_0000007_178580_179380 261
252 3300044684 Ga0466966_0019462 Ga0466966_0019462_1439_2239 261
253 3300044693 Ga0466961_0334290 Ga0466961_0334290_101_901 261
254 3300044706 Ga0466964_0000672 Ga0466964_0000672_9626_10426 261
255 3300044719 Ga0466971_0006693 Ga0466971_0006693_1558_2358 261
256 3300044735 Ga0466968_0018035 Ga0466968_0018035_973_1773 261
257 3300044765 Ga0466970_0081861 Ga0466970_0081861_914_1714 261
258 3300044901 Ga0466960_0021295 Ga0466960_0021295_1353_2153 261
259 3300045836 Ga0466958_0033140 Ga0466958_0033140_183_983 261
260 3300046460 Ga0495638_0000357 Ga0495638_0000357_55998_56822 261
261 3300048909 Ga0496106_0348758 Ga0496106_0348758_70_894 261
262 3300048929 Ga0496126_0129435 Ga0496126_0129435_293_1117 261
263 3300061719 Ga0466962_0006046 Ga0466962_0006046_2964_3764 261
264 3300005467 Ga0070706_100168101 Ga0070706_1001681012 262
265 3300025246 Ga0209646_1006125 Ga0209646_10061253 262
266 3300001979 JGI24740J21852_10010008 JGI24740J21852_100100085 263
267 3300001979 JGI24740J21852_10024292 JGI24740J21852_100242922 263
268 3300005341 Ga0070691_10156839 Ga0070691_101568392 263
269 3300005455 Ga0070663_100287794 Ga0070663_1002877942 263
270 3300002067 JGI24735J21928_10001809 JGI24735J21928_100018096 264
271 3300003756 Ga0055533_1002156 Ga0055533_10021565 264
272 3300005365 Ga0070688_100078168 Ga0070688_1000781681 264
273 3300005466 Ga0070685_10065106 Ga0070685_100651062 264
274 3300014969 Ga0157376_10019218 Ga0157376_100192186 264
275 3300015687 Ga0183368_1002 Ga0183368_1002819 264
276 3300025226 Ga0209674_100033 Ga0209674_100033304 264
277 3300025904 Ga0207647_10004228 Ga0207647_100042285 264
278 3300037312 Ga0395899_0195383 Ga0395899_0195383_321_1160 264
279 3300037471 Ga0395905_0079366 Ga0395905_0079366_1699_2538 264
280 3300045976 Ga0466967_0009916 Ga0466967_0009916_4749_5588 264
281 3300045976 Ga0466967_0464772 Ga0466967_0464772_307_1122 264
282 3300046471 Ga0495650_0000134 Ga0495650_0000134_122161_122976 264
283 3300048907 Ga0496104_0219583 Ga0496104_0219583_603_1418 264
284 3300048915 Ga0496112_0416131 Ga0496112_0416131_48_863 264
285 3300048916 Ga0496113_0003067 Ga0496113_0003067_3669_4484 264
286 3300048918 Ga0496115_0002040 Ga0496115_0002040_9373_10188 264
287 3300001979 JGI24740J21852_10003233 JGI24740J21852_100032335 265
288 3300001989 JGI24739J22299_10004668 JGI24739J22299_100046684 265
289 3300001990 JGI24737J22298_10000559 JGI24737J22298_100005599 265
290 3300002737 JGI25162J39368_1000072 JGI25162J39368_100007257 265
291 3300002741 JGI25157J39369_1000143 JGI25157J39369_100014332 265
292 3300002771 JGI25163J39215_1001127 JGI25163J39215_10011272 265
293 3300002772 JGI25164J39214_1000115 JGI25164J39214_100011548 265
294 3300003214 JGI25165J46597_1000063 JGI25165J46597_1000063136 265
295 3300003215 JGI25153J46596_10008070 JGI25153J46596_100080703 265
296 3300003578 Ga0006562J51391_1001749 Ga0006562J51391_10017491 265
297 3300003578 Ga0006562J51391_1001750 Ga0006562J51391_10017506 265
298 3300003751 Ga0055538_1002088 Ga0055538_10020883 265
299 3300003761 Ga0055535_1000068 Ga0055535_100006857 265
300 3300003762 Ga0055542_1000090 Ga0055542_100009057 265
301 3300003763 Ga0055529_1000084 Ga0055529_100008457 265
302 3300005262 Ga0065165_1001063 Ga0065165_100106321 265
303 3300005295 Ga0065707_10095927 Ga0065707_100959272 265
304 3300005455 Ga0070663_100044488 Ga0070663_1000444883 265
305 3300005563 Ga0068855_100177002 Ga0068855_1001770023 265
306 3300005577 Ga0068857_100008376 Ga0068857_1000083763 265
307 3300005578 Ga0068854_100009207 Ga0068854_1000092074 265
308 3300005834 Ga0068851_10003620 Ga0068851_100036203 265
309 3300005842 Ga0068858_100034229 Ga0068858_1000342293 265
310 3300006846 Ga0075430_100051144 Ga0075430_1000511444 265
311 3300009093 Ga0105240_10022080 Ga0105240_100220803 265
312 3300009094 Ga0111539_10045704 Ga0111539_100457042 265
313 3300009174 Ga0105241_10458702 Ga0105241_104587021 265
314 3300009545 Ga0105237_10000148 Ga0105237_1000014849 265
315 3300010375 Ga0105239_10069898 Ga0105239_100698983 265
316 3300012500 Ga0157314_1000057 Ga0157314_10000574 265
317 3300013105 Ga0157369_10072053 Ga0157369_100720533 265
318 3300014326 Ga0157380_10000385 Ga0157380_1000038520 265
319 3300025207 Ga0209760_100542 Ga0209760_1005424 265
320 3300025224 Ga0209784_100042 Ga0209784_100042139 265
321 3300025231 Ga0207427_100096 Ga0207427_10009656 265
322 3300025233 Ga0209437_100074 Ga0209437_100074212 265
323 3300025242 Ga0209258_100136 Ga0209258_10013650 265
324 3300025246 Ga0209646_1002309 Ga0209646_10023093 265
325 3300025250 Ga0209026_1000072 Ga0209026_100007256 265
326 3300025254 Ga0209148_1000036 Ga0209148_1000036213 265
327 3300025256 Ga0209759_1000490 Ga0209759_100049023 265
328 3300025261 Ga0209233_1000040 Ga0209233_1000040211 265
329 3300025272 Ga0209455_1000071 Ga0209455_1000071212 265
330 3300025297 Ga0209758_1000481 Ga0209758_100048132 265
331 3300025321 Ga0207656_10013657 Ga0207656_100136573 265
332 3300025904 Ga0207647_10002363 Ga0207647_100023633 265
333 3300025913 Ga0207695_10001588 Ga0207695_100015887 265
334 3300025914 Ga0207671_10000028 Ga0207671_1000002836 265
335 3300025933 Ga0207706_10535342 Ga0207706_105353422 265
336 3300025949 Ga0207667_10000080 Ga0207667_1000008036 265
337 3300025981 Ga0207640_10005347 Ga0207640_100053473 265
338 3300026067 Ga0207678_10060846 Ga0207678_100608463 265
339 3300026116 Ga0207674_10000090 Ga0207674_1000009049 265
340 3300046460 Ga0495638_0000907 Ga0495638_0000907_11040_11882 265
341 3300048928 Ga0496125_0000291 Ga0496125_0000291_35987_36799 265
342 3300050509 nmdc:mga0qj67_43011_c1 nmdc:mga0qj67_43011_c1_2115_2966 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9462 12 232
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9441 15 230
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9422 12 245
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.942 12 245
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.936 12 232
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9459 13 230 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9439 12 249 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9418 11 233 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 12 231 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9396 12 232 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A377GL99-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein HI_1087 0.9669 12 247 GO:0005524
GO:0016887
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9664 11 255 GO:0005524
GO:0016887
AF-A0A383F2Y9-F1-model_v4 ABC transporter domain-containing protein 0.958 29 230 GO:0005524
GO:0016887
AF-A0A2N3PRL6-F1-model_v4 Polyamine ABC transporter ATP-binding protein 0.9557 9 247 GO:0005524
GO:0016887
AF-A0A529HGG3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9545 87 231 GO:0005524
GO:0006865
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.83 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map