F414122

General Info

Members Datasets Scaffolds Average Seq Length
339 217 678 178

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501025501|2501072049
Length 183
Sequence TPEQFAANQKAGLEALFGLTSKAFEGAIKLAELNIETARSAFAEGQEQAHRVLSAKDPQGFFAVQAGFAQPAAEKALAYGRSVYGIVSATQAEFATAAQSQYETQQRALESFVDNAAKNAPAGSEAAVAAIKSALNTASNAYASVNKAAKQAVEFAESNFDAAGKAATKAVAQASARAAKQAA

Samples

Sample ID Description Type Environment
1 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
81 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
82 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
83 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
90 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
180 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
181 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
182 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
183 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
184 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
185 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
186 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
187 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
188 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
189 2519103095 Burkholderia sp. KJ006 Isolate Nodule
190 2547132374 Acidovorax radicis N35 Isolate Unclassified
191 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
192 2643221570 Acidovorax sp. Root568 Isolate Unclassified
193 2643221596 Acidovorax sp. Root70 Isolate Unclassified
194 2643221609 Acidovorax sp. Root217 Isolate Unclassified
195 2643221611 Acidovorax sp. Root219 Isolate Unclassified
196 2643221652 Acidovorax sp. Root402 Isolate Unclassified
197 2643221717 Acidovorax sp. Root267 Isolate Unclassified
198 2721755523 Delftia sp. HK171 Isolate Unclassified
199 2738543012 Acidovorax sp. CF301 Isolate Unclassified
200 2816332133 Acidovorax radicis 2721A Isolate Unclassified
201 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
202 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
203 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
204 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
205 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
206 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
207 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
208 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
209 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
210 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
211 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
212 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
213 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
214 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
215 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
216 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
217 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 39.53
Metatranscriptomes 48.67
Isolates 11.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 1.18
Rhizoplane 2.06
Rhizosphere 83.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1013328 3300003162 Bacteria 742
2 Ga0006759J45824_1011169 3300003163 Bacteria 637
3 Ga0006758J48902_1011304 3300003300 Bacteria 728
4 Ga0006770J48903_1018277 3300003305 Bacteria 713
5 Ga0006777J48905_1010632 3300003308 Bacteria 715
6 Ga0006777J48905_1018001 3300003308 Bacteria 600
7 Ga0006777J48905_1026279 3300003308 Bacteria 730
8 Ga0006777J48905_1028902 3300003308 Bacteria 671
9 Ga0006777J48905_1036184 3300003308 Bacteria 713
10 Ga0006777J48905_1072723 3300003308 Bacteria 608
11 Ga0007417J51691_1010537 3300003544 Bacteria 657
12 Ga0007417J51691_1019894 3300003544 Bacteria 699
13 Ga0007417J51691_1023289 3300003544 Bacteria 747
14 Ga0007417J51691_1023312 3300003544 Bacteria 639
15 Ga0007417J51691_1025532 3300003544 Bacteria 672
16 Ga0007417J51691_1039797 3300003544 Bacteria 700
17 Ga0007417J51691_1045870 3300003544 Bacteria 729
18 Ga0007427J51700_110639 3300003559 Bacteria 725
19 Ga0006781J51513_1006164 3300003568 Bacteria 693
20 Ga0006781J51513_1012196 3300003568 Bacteria 678
21 Ga0007410J51695_1023410 3300003574 Bacteria 715
22 Ga0007410J51695_1061286 3300003574 Bacteria 693
23 Ga0007409J51694_1014002 3300003575 Bacteria 719
24 Ga0007409J51694_1021568 3300003575 Bacteria 645
25 Ga0007409J51694_1034612 3300003575 Bacteria 659
26 Ga0007411J51799_111002 3300003611 Bacteria 680
27 Ga0007411J51799_112755 3300003611 Bacteria 720
28 Ga0032354_1000981 3300003693 Bacteria 704
29 Ga0032354_1013412 3300003693 Bacteria 710
30 Ga0032354_1016205 3300003693 Bacteria 675
31 Ga0006780_1007873 3300003735 Bacteria 674
32 Ga0006780_1015581 3300003735 Bacteria 690
33 Ga0055540_1022956 3300003792 Bacteria 1582
34 Ga0055531_10000254 3300003794 Bacteria 57349
35 Ga0058859_10078480 3300004798 Bacteria 631
36 Ga0058863_10034640 3300004799 Bacteria 779
37 Ga0058863_11903558 3300004799 Bacteria 661
38 Ga0058861_11986126 3300004800 Bacteria 692
39 Ga0058861_12003363 3300004800 Bacteria 734
40 Ga0058860_10018089 3300004801 Bacteria 721
41 Ga0058862_12860858 3300004803 Bacteria 778
42 Ga0068869_100127785 3300005334 Bacteria 1951
43 Ga0068868_100063586 3300005338 Bacteria 2927
44 Ga0070714_100467984 3300005435 Bacteria 1199
45 Ga0068867_100728101 3300005459 Bacteria 878
46 Ga0070679_100016044 3300005530 Bacteria 7215
47 Ga0070679_100134886 3300005530 Bacteria 2450
48 Ga0070672_100597664 3300005543 Bacteria 961
49 Ga0068855_100274058 3300005563 Bacteria 1875
50 Ga0068856_100500034 3300005614 Bacteria 1237
51 Ga0068864_100069090 3300005618 Bacteria 3071
52 Ga0068863_100670691 3300005841 Bacteria 1029
53 Ga0075365_10564906 3300006038 Bacteria 805
54 Ga0075363_100058221 3300006048 Bacteria 2075
55 Ga0075363_100141993 3300006048 Bacteria 1352
56 Ga0075370_10322155 3300006353 Bacteria 921
57 Ga0075370_10506485 3300006353 Bacteria 729
58 Ga0105240_10008954 3300009093 Bacteria 14231
59 Ga0105240_10398550 3300009093 Bacteria 1550
60 Ga0105242_10161310 3300009176 Bacteria 1963
61 Ga0105248_10982563 3300009177 Bacteria 954
62 Ga0105248_12143852 3300009177 Bacteria 636
63 Ga0105237_10092899 3300009545 Bacteria 3007
64 Ga0105238_10161529 3300009551 Bacteria 2216
65 Ga0105239_10288838 3300010375 Bacteria 1847
66 Ga0105246_10739587 3300011119 Bacteria 866
67 Ga0157370_10297117 3300013104 Bacteria 1491
68 Ga0157369_11265354 3300013105 Bacteria 752
69 Ga0157375_11686623 3300013308 Bacteria 750
70 Ga0157376_11422488 3300014969 Bacteria 725
71 Ga0182006_1070360 3300015261 Bacteria 1299
72 Ga0182007_10089161 3300015262 Bacteria 1015
73 Ga0182005_1025390 3300015265 Bacteria 1617
74 Ga0197907_10830821 3300020069 Bacteria 645
75 Ga0209758_1061515 3300025297 Bacteria 1236
76 Ga0209051_1000055 3300025303 Bacteria 277194
77 Ga0209257_1000101 3300025304 Bacteria 251553
78 Ga0207647_10049083 3300025904 Bacteria 2619
79 Ga0207705_10044382 3300025909 Bacteria 3195
80 Ga0207705_10272066 3300025909 Bacteria 1295
81 Ga0207705_10284527 3300025909 Bacteria 1266
82 Ga0207654_10097362 3300025911 Bacteria 1806
83 Ga0207695_10044866 3300025913 Bacteria 4698
84 Ga0207695_10856556 3300025913 Bacteria 789
85 Ga0207660_10078838 3300025917 Bacteria 2415
86 Ga0207657_10064527 3300025919 Bacteria 3125
87 Ga0207652_10020271 3300025921 Bacteria 5474
88 Ga0207694_10082806 3300025924 Bacteria 2522
89 Ga0207689_10111443 3300025942 Bacteria 2249
90 Ga0207667_10106776 3300025949 Bacteria 2888
91 Ga0207667_10747936 3300025949 Bacteria 977
92 Ga0207677_10044779 3300026023 Bacteria 2950
93 Ga0207702_11261935 3300026078 Bacteria 733
94 Ga0207641_10480993 3300026088 Bacteria 1203
95 Ga0207641_11208138 3300026088 Bacteria 756
96 Ga0207648_10889199 3300026089 Bacteria 832
97 Ga0207676_10041519 3300026095 Bacteria 3532
98 Ga0207698_10535799 3300026142 Bacteria 1145
99 Ga0209974_10069095 3300027876 Bacteria 1203
100 Ga0268266_11592613 3300028379 Bacteria 629
101 Ga0307408_100234472 3300031548 Bacteria 1505
102 Ga0307408_100603901 3300031548 Bacteria 975
103 Ga0307405_10596105 3300031731 Bacteria 901
104 Ga0307406_10747098 3300031901 Bacteria 821
105 Ga0307412_10479056 3300031911 Bacteria 1032
106 Ga0307416_101286161 3300032002 Bacteria 837
107 Ga0395900_0004479 3300037418 Bacteria 14790
108 Ga0395900_0845653 3300037418 Bacteria 841
109 Ga0395900_1527609 3300037418 Bacteria 579
110 Ga0395898_0004394 3300037466 Bacteria 15422
111 Ga0395905_0091655 3300037471 Bacteria 2849
112 Ga0395905_0110324 3300037471 Bacteria 2583
113 Ga0395905_0155421 3300037471 Bacteria 2151
114 Ga0395905_0332313 3300037471 Bacteria 1410
115 Ga0395901_0091640 3300038443 Bacteria 3181
116 Ga0395901_0145817 3300038443 Bacteria 2488
117 Ga0395901_0291914 3300038443 Bacteria 1692
118 Ga0395901_0299547 3300038443 Bacteria 1667
119 Ga0395901_0519278 3300038443 Bacteria 1210
120 Ga0436365_0594657 3300039437 Bacteria 2505
121 Ga0439439_0025177 3300041406 Bacteria 1497
122 Ga0451787_195086 3300041441 Bacteria 1587
123 Ga0451791_1635742 3300041451 Bacteria 672
124 Ga0451805_084058 3300041461 Bacteria 708
125 Ga0451807_0183323 3300041486 Bacteria 837
126 Ga0439437_009500 3300042000 Bacteria 1101
127 Ga0439449_0077007 3300042007 Bacteria 1230
128 Ga0439449_0098089 3300042007 Bacteria 1082
129 Ga0439454_026822 3300042011 Bacteria 883
130 Ga0439446_0046009 3300042156 Bacteria 1295
131 Ga0439434_0013907 3300042435 Bacteria 2392
132 Ga0439434_0046754 3300042435 Bacteria 1336
133 Ga0439464_0035556 3300042439 Bacteria 1407
134 Ga0453683_0002817 3300044673 Bacteria 13218
135 Ga0466965_0034792 3300044683 Bacteria 2466
136 Ga0466968_0017310 3300044735 Bacteria 2879
137 Ga0466957_0077557 3300044842 Bacteria 2065
138 Ga0466957_0263863 3300044842 Bacteria 1148
139 Ga0466960_0063878 3300044901 Bacteria 1813
140 Ga0466959_0467731 3300045049 Bacteria 854
141 Ga0451576_0018179 3300045051 Bacteria 7711
142 Ga0451576_0156678 3300045051 Bacteria 2376
143 Ga0451576_0465687 3300045051 Bacteria 1327
144 Ga0466958_0381251 3300045836 Bacteria 909
145 Ga0495663_0077471 3300046525 Bacteria 1066
146 Ga0495656_0030664 3300046615 Bacteria 2175
147 Ga0496101_0223412 3300048904 Bacteria 1462
148 Ga0496111_0933572 3300048914 Bacteria 624
149 Ga0496112_0094584 3300048915 Bacteria 2959
150 Ga0496116_0151305 3300048919 Bacteria 1288
151 Ga0496118_0038929 3300048921 Bacteria 3802
152 Ga0496121_0016616 3300048924 Bacteria 7584
153 Ga0496122_0156533 3300048925 Bacteria 1397
154 Ga0501306_038043 3300049127 Bacteria 738
155 Ga0501306_039441 3300049127 Bacteria 728
156 Ga0501306_039769 3300049127 Bacteria 726
157 Ga0501306_040238 3300049127 Bacteria 723
158 Ga0501306_040556 3300049127 Bacteria 721
159 Ga0501306_040720 3300049127 Bacteria 720
160 Ga0501306_046474 3300049127 Bacteria 686
161 Ga0501306_051771 3300049127 Bacteria 660
162 Ga0501308_024444 3300049128 Bacteria 777
163 Ga0501308_027605 3300049128 Bacteria 746
164 Ga0501308_036552 3300049128 Bacteria 678
165 Ga0501309_034114 3300049129 Bacteria 760
166 Ga0501309_034838 3300049129 Bacteria 754
167 Ga0501309_038929 3300049129 Bacteria 722
168 Ga0501310_027518 3300049130 Bacteria 741
169 Ga0501310_051610 3300049130 Bacteria 596
170 Ga0501310_052429 3300049130 Bacteria 593
171 Ga0501304_023099 3300049160 Bacteria 627
172 Ga0501305_038251 3300049161 Bacteria 773
173 Ga0501305_041489 3300049161 Bacteria 750
174 Ga0501305_047612 3300049161 Bacteria 713
175 Ga0501305_059531 3300049161 Bacteria 655
176 Ga0501307_026523 3300049162 Bacteria 783
177 Ga0501307_032359 3300049162 Bacteria 731
178 Ga0501307_033068 3300049162 Bacteria 725
179 Ga0501307_037811 3300049162 Bacteria 692
180 Ga0501307_043892 3300049162 Bacteria 656
181 Ga0501307_047796 3300049162 Bacteria 637
182 Ga0501311_035452 3300049527 Bacteria 738
183 Ga0501311_036588 3300049527 Bacteria 730
184 Ga0501311_036632 3300049527 Bacteria 730
185 Ga0501311_056534 3300049527 Bacteria 625
186 Ga0501312_029839 3300049528 Bacteria 851
187 Ga0501312_034292 3300049528 Bacteria 808
188 Ga0501312_040706 3300049528 Bacteria 759
189 Ga0501312_042330 3300049528 Bacteria 747
190 Ga0501312_051252 3300049528 Bacteria 697
191 Ga0501312_055907 3300049528 Bacteria 675
192 Ga0501312_068882 3300049528 Bacteria 624
193 Ga0501313_026840 3300049529 Bacteria 734
194 Ga0501313_029422 3300049529 Bacteria 707
195 Ga0501313_030072 3300049529 Bacteria 701
196 Ga0501313_030466 3300049529 Bacteria 698
197 Ga0501313_033252 3300049529 Bacteria 674
198 Ga0501313_040644 3300049529 Bacteria 624
199 Ga0501314_020617 3300049530 Bacteria 683
200 Ga0501314_020989 3300049530 Bacteria 679
201 Ga0501315_022388 3300049531 Bacteria 861
202 Ga0501315_034856 3300049531 Bacteria 740
203 Ga0501315_036596 3300049531 Bacteria 728
204 Ga0501315_044860 3300049531 Bacteria 679
205 Ga0501315_045961 3300049531 Bacteria 674
206 Ga0501315_067193 3300049531 Bacteria 589
207 Ga0501316_031265 3300049532 Bacteria 713
208 Ga0501317_042001 3300049533 Bacteria 701
209 Ga0501317_057249 3300049533 Bacteria 633
210 Ga0501318_034436 3300049534 Bacteria 702
211 Ga0501319_010748 3300049535 Bacteria 731
212 Ga0501320_022476 3300049536 Bacteria 740
213 Ga0501320_025950 3300049536 Bacteria 705
214 Ga0501320_028277 3300049536 Bacteria 686
215 Ga0501321_035640 3300049537 Bacteria 682
216 Ga0501321_044972 3300049537 Bacteria 631
217 Ga0501321_048454 3300049537 Bacteria 616
218 Ga0501322_010505 3300049538 Bacteria 714
219 Ga0501322_013286 3300049538 Bacteria 662
220 Ga0501323_035156 3300049539 Bacteria 717
221 Ga0501323_037717 3300049539 Bacteria 699
222 Ga0501323_040435 3300049539 Bacteria 682
223 Ga0501323_044554 3300049539 Bacteria 659
224 Ga0501323_050663 3300049539 Bacteria 629
225 Ga0501324_020454 3300049540 Bacteria 674
226 Ga0501324_022025 3300049540 Bacteria 657
227 Ga0501331_06622 3300049547 Bacteria 678
228 Ga0501333_008951 3300049549 Bacteria 697
229 Ga0501335_011629 3300049551 Bacteria 862
230 Ga0501335_016965 3300049551 Bacteria 753
231 Ga0501336_014350 3300049552 Bacteria 670
232 Ga0501337_009615 3300049553 Bacteria 696
233 Ga0501337_010421 3300049553 Bacteria 678
234 Ga0501340_009321 3300049556 Bacteria 705
235 Ga0501036_0093986 3300049572 Bacteria 2534
236 Ga0501037_0640116 3300049573 Bacteria 711
237 Ga0501038_0055986 3300049574 Bacteria 3387
238 Ga0501039_0608482 3300049575 Bacteria 856
239 Ga0501043_0019422 3300049579 Bacteria 5334
240 Ga0501046_0015962 3300049580 Bacteria 6299
241 Ga0501047_0063728 3300049581 Bacteria 3555
242 Ga0501072_0290205 3300049588 Bacteria 1301
243 Ga0501073_0058651 3300049589 Bacteria 2690
244 Ga0501074_0277673 3300049590 Bacteria 1191
245 Ga0501217_086530 3300049661 Bacteria 875
246 Ga0501080_0018035 3300049742 Bacteria 6535
247 Ga0501268_010966 3300049765 Bacteria 1422
248 Ga0501035_0087041 3300049822 Bacteria 2753
249 Ga0501044_0034824 3300049823 Bacteria 5278
250 nmdc:mga03683_187649_c1 3300050489 Bacteria 945
251 nmdc:mga00v17_430457_c1 3300050491 Bacteria 857
252 nmdc:mga0yw44_314296_c1 3300050492 Bacteria 1051
253 nmdc:mga0yw44_578228_c1 3300050492 Bacteria 763
254 nmdc:mga0yw44_641521_c1 3300050492 Bacteria 722
255 nmdc:mga07m45_326456_c1 3300050496 Bacteria 892
256 Ga0587084_050017 3300059477 Bacteria 737
257 Ga0587084_053745 3300059477 Bacteria 720
258 Ga0587093_032752 3300059478 Bacteria 756
259 Ga0587093_035886 3300059478 Bacteria 733
260 Ga0587093_038567 3300059478 Bacteria 716
261 Ga0587070_051561 3300059491 Bacteria 823
262 Ga0587077_054157 3300059493 Bacteria 849
263 Ga0587077_088916 3300059493 Bacteria 723
264 Ga0587077_102404 3300059493 Bacteria 690
265 Ga0587082_035105 3300059504 Bacteria 893
266 Ga0587082_086869 3300059504 Bacteria 661
267 Ga0587083_0057051 3300059505 Bacteria 869
268 Ga0587083_0095022 3300059505 Bacteria 733
269 Ga0587085_058849 3300059506 Bacteria 721
270 Ga0587086_043778 3300059507 Bacteria 701
271 Ga0587090_015954 3300059510 Bacteria 1117
272 Ga0587090_054234 3300059510 Bacteria 743
273 Ga0587090_060586 3300059510 Bacteria 717
274 Ga0587090_062365 3300059510 Bacteria 710
275 Ga0587092_056085 3300059512 Bacteria 726
276 Ga0587095_015334 3300059514 Bacteria 693
277 Ga0587106_071636 3300059605 Bacteria 658
278 Ga0587101_048788 3300059623 Bacteria 723
279 Ga0587101_050598 3300059623 Bacteria 714
280 Ga0587101_052405 3300059623 Bacteria 707
281 Ga0587101_053717 3300059623 Bacteria 701
282 Ga0587115_036381 3300059626 Bacteria 752
283 Ga0587117_042430 3300059627 Bacteria 729
284 Ga0587117_059414 3300059627 Bacteria 654
285 Ga0587128_020162 3300059630 Bacteria 1016
286 Ga0587128_055273 3300059630 Bacteria 736
287 Ga0587128_057767 3300059630 Bacteria 725
288 Ga0587062_049949 3300059639 Bacteria 705
289 Ga0587068_062980 3300059641 Bacteria 717
290 Ga0587072_025564 3300059643 Bacteria 1074
291 Ga0587075_053323 3300059644 Bacteria 711
292 Ga0587076_076735 3300059645 Bacteria 705
293 Ga0587079_114685 3300059647 Bacteria 659
294 Ga0587071_115342 3300060344 Bacteria 636
295 Ga0587111_0105849 3300060346 Bacteria 707
296 Ga0587111_0115195 3300060346 Bacteria 686
297 Ga0587111_0119085 3300060346 Bacteria 678
298 Ga0587111_0129239 3300060346 Bacteria 659
299 Ga0466962_0074019 3300061719 Bacteria 1628
300 2501072049 2501025501 Bacteria 7768574
301 2501084378 2501025502 Bacteria 9641094
302 2501411856 2501025504 Bacteria 8008976
303 2511088542 2510917013 Bacteria 9951648
304 2511100859 2510917014 Bacteria 8296963
305 2511107382 2510917015 Bacteria 7950052
306 2511244806 2511231002 Bacteria 5042903
307 2513553332 2513237082 Bacteria 8640282
308 2513564224 2513237083 Bacteria 8410967
309 2516025114 2515154189 Bacteria 9629850
310 2519459186 2519103095 Bacteria 6629912
311 2548501099 2547132374 Bacteria 5530232
312 2585290234 2582581311 Bacteria 6763856
313 2643866800 2643221570 Bacteria 5103772
314 2643993522 2643221596 Bacteria 5006805
315 2644062635 2643221609 Bacteria 6756331
316 2644076351 2643221611 Bacteria 6820941
317 2644294659 2643221652 Bacteria 5140275
318 2644645807 2643221717 Bacteria 5676132
319 2722882783 2721755523 Bacteria 6430384
320 2739244681 2738543012 Bacteria 7115078
321 2816475116 2816332133 Bacteria 7249298
322 2817261475 2816332253 Bacteria 6764532
323 2817279161 2816332256 Bacteria 6891714
324 2817456239 2816332286 Bacteria 6853759
325 2839138518 2839138175 Bacteria 6549354
326 2856294430 2856287931 Bacteria 7223934
327 2857367805 2857357740 Bacteria 9937880
328 2881103936 2881101125 Bacteria 4590519
329 2883089564 2883087390 Bacteria 9532701
330 2904619872 2904615490 Bacteria 10047340
331 2919705285 2919704043 Bacteria 5560311
332 2929162424 2929160207 Bacteria 9075316
333 2939631529 2939631187 Bacteria 6118131
334 2939631544 2939631187 Bacteria 6118131
335 2990712758 2990710928 Bacteria 5002431
336 8003960705 8003955200 Bacteria 8601927
337 8020813599 8020807995 Bacteria 6801506
338 8040172823 8040167225 Bacteria 6542727
339 8040173706 8040173305 Bacteria 6827067
340 Ga0006778J45830_1013328
341 Ga0006759J45824_1011169
342 Ga0006758J48902_1011304
343 Ga0006770J48903_1018277
344 Ga0006777J48905_1010632
345 Ga0006777J48905_1018001
346 Ga0006777J48905_1026279
347 Ga0006777J48905_1028902
348 Ga0006777J48905_1036184
349 Ga0006777J48905_1072723
350 Ga0007417J51691_1010537
351 Ga0007417J51691_1019894
352 Ga0007417J51691_1023289
353 Ga0007417J51691_1023312
354 Ga0007417J51691_1025532
355 Ga0007417J51691_1039797
356 Ga0007417J51691_1045870
357 Ga0007427J51700_110639
358 Ga0006781J51513_1006164
359 Ga0006781J51513_1012196
360 Ga0007410J51695_1023410
361 Ga0007410J51695_1061286
362 Ga0007409J51694_1014002
363 Ga0007409J51694_1021568
364 Ga0007409J51694_1034612
365 Ga0007411J51799_111002
366 Ga0007411J51799_112755
367 Ga0032354_1000981
368 Ga0032354_1013412
369 Ga0032354_1016205
370 Ga0006780_1007873
371 Ga0006780_1015581
372 Ga0055540_1022956
373 Ga0055531_10000254
374 Ga0058859_10078480
375 Ga0058863_10034640
376 Ga0058863_11903558
377 Ga0058861_11986126
378 Ga0058861_12003363
379 Ga0058860_10018089
380 Ga0058862_12860858
381 Ga0068869_100127785
382 Ga0068868_100063586
383 Ga0070714_100467984
384 Ga0068867_100728101
385 Ga0070679_100016044
386 Ga0070679_100134886
387 Ga0070672_100597664
388 Ga0068855_100274058
389 Ga0068856_100500034
390 Ga0068864_100069090
391 Ga0068863_100670691
392 Ga0075365_10564906
393 Ga0075363_100058221
394 Ga0075363_100141993
395 Ga0075370_10322155
396 Ga0075370_10506485
397 Ga0105240_10008954
398 Ga0105240_10398550
399 Ga0105242_10161310
400 Ga0105248_10982563
401 Ga0105248_12143852
402 Ga0105237_10092899
403 Ga0105238_10161529
404 Ga0105239_10288838
405 Ga0105246_10739587
406 Ga0157370_10297117
407 Ga0157369_11265354
408 Ga0157375_11686623
409 Ga0157376_11422488
410 Ga0182006_1070360
411 Ga0182007_10089161
412 Ga0182005_1025390
413 Ga0197907_10830821
414 Ga0209758_1061515
415 Ga0209051_1000055
416 Ga0209257_1000101
417 Ga0207647_10049083
418 Ga0207705_10044382
419 Ga0207705_10272066
420 Ga0207705_10284527
421 Ga0207654_10097362
422 Ga0207695_10044866
423 Ga0207695_10856556
424 Ga0207660_10078838
425 Ga0207657_10064527
426 Ga0207652_10020271
427 Ga0207694_10082806
428 Ga0207689_10111443
429 Ga0207667_10106776
430 Ga0207667_10747936
431 Ga0207677_10044779
432 Ga0207702_11261935
433 Ga0207641_10480993
434 Ga0207641_11208138
435 Ga0207648_10889199
436 Ga0207676_10041519
437 Ga0207698_10535799
438 Ga0209974_10069095
439 Ga0268266_11592613
440 Ga0307408_100234472
441 Ga0307408_100603901
442 Ga0307405_10596105
443 Ga0307406_10747098
444 Ga0307412_10479056
445 Ga0307416_101286161
446 Ga0395900_0004479
447 Ga0395900_0845653
448 Ga0395900_1527609
449 Ga0395898_0004394
450 Ga0395905_0091655
451 Ga0395905_0110324
452 Ga0395905_0155421
453 Ga0395905_0332313
454 Ga0395901_0091640
455 Ga0395901_0145817
456 Ga0395901_0291914
457 Ga0395901_0299547
458 Ga0395901_0519278
459 Ga0436365_0594657
460 Ga0439439_0025177
461 Ga0451787_195086
462 Ga0451791_1635742
463 Ga0451805_084058
464 Ga0451807_0183323
465 Ga0439437_009500
466 Ga0439449_0077007
467 Ga0439449_0098089
468 Ga0439454_026822
469 Ga0439446_0046009
470 Ga0439434_0013907
471 Ga0439434_0046754
472 Ga0439464_0035556
473 Ga0453683_0002817
474 Ga0466965_0034792
475 Ga0466968_0017310
476 Ga0466957_0077557
477 Ga0466957_0263863
478 Ga0466960_0063878
479 Ga0466959_0467731
480 Ga0451576_0018179
481 Ga0451576_0156678
482 Ga0451576_0465687
483 Ga0466958_0381251
484 Ga0495663_0077471
485 Ga0495656_0030664
486 Ga0496101_0223412
487 Ga0496111_0933572
488 Ga0496112_0094584
489 Ga0496116_0151305
490 Ga0496118_0038929
491 Ga0496121_0016616
492 Ga0496122_0156533
493 Ga0501306_038043
494 Ga0501306_039441
495 Ga0501306_039769
496 Ga0501306_040238
497 Ga0501306_040556
498 Ga0501306_040720
499 Ga0501306_046474
500 Ga0501306_051771
501 Ga0501308_024444
502 Ga0501308_027605
503 Ga0501308_036552
504 Ga0501309_034114
505 Ga0501309_034838
506 Ga0501309_038929
507 Ga0501310_027518
508 Ga0501310_051610
509 Ga0501310_052429
510 Ga0501304_023099
511 Ga0501305_038251
512 Ga0501305_041489
513 Ga0501305_047612
514 Ga0501305_059531
515 Ga0501307_026523
516 Ga0501307_032359
517 Ga0501307_033068
518 Ga0501307_037811
519 Ga0501307_043892
520 Ga0501307_047796
521 Ga0501311_035452
522 Ga0501311_036588
523 Ga0501311_036632
524 Ga0501311_056534
525 Ga0501312_029839
526 Ga0501312_034292
527 Ga0501312_040706
528 Ga0501312_042330
529 Ga0501312_051252
530 Ga0501312_055907
531 Ga0501312_068882
532 Ga0501313_026840
533 Ga0501313_029422
534 Ga0501313_030072
535 Ga0501313_030466
536 Ga0501313_033252
537 Ga0501313_040644
538 Ga0501314_020617
539 Ga0501314_020989
540 Ga0501315_022388
541 Ga0501315_034856
542 Ga0501315_036596
543 Ga0501315_044860
544 Ga0501315_045961
545 Ga0501315_067193
546 Ga0501316_031265
547 Ga0501317_042001
548 Ga0501317_057249
549 Ga0501318_034436
550 Ga0501319_010748
551 Ga0501320_022476
552 Ga0501320_025950
553 Ga0501320_028277
554 Ga0501321_035640
555 Ga0501321_044972
556 Ga0501321_048454
557 Ga0501322_010505
558 Ga0501322_013286
559 Ga0501323_035156
560 Ga0501323_037717
561 Ga0501323_040435
562 Ga0501323_044554
563 Ga0501323_050663
564 Ga0501324_020454
565 Ga0501324_022025
566 Ga0501331_06622
567 Ga0501333_008951
568 Ga0501335_011629
569 Ga0501335_016965
570 Ga0501336_014350
571 Ga0501337_009615
572 Ga0501337_010421
573 Ga0501340_009321
574 Ga0501036_0093986
575 Ga0501037_0640116
576 Ga0501038_0055986
577 Ga0501039_0608482
578 Ga0501043_0019422
579 Ga0501046_0015962
580 Ga0501047_0063728
581 Ga0501072_0290205
582 Ga0501073_0058651
583 Ga0501074_0277673
584 Ga0501217_086530
585 Ga0501080_0018035
586 Ga0501268_010966
587 Ga0501035_0087041
588 Ga0501044_0034824
589 nmdc:mga03683_187649_c1
590 nmdc:mga00v17_430457_c1
591 nmdc:mga0yw44_314296_c1
592 nmdc:mga0yw44_578228_c1
593 nmdc:mga0yw44_641521_c1
594 nmdc:mga07m45_326456_c1
595 Ga0587084_050017
596 Ga0587084_053745
597 Ga0587093_032752
598 Ga0587093_035886
599 Ga0587093_038567
600 Ga0587070_051561
601 Ga0587077_054157
602 Ga0587077_088916
603 Ga0587077_102404
604 Ga0587082_035105
605 Ga0587082_086869
606 Ga0587083_0057051
607 Ga0587083_0095022
608 Ga0587085_058849
609 Ga0587086_043778
610 Ga0587090_015954
611 Ga0587090_054234
612 Ga0587090_060586
613 Ga0587090_062365
614 Ga0587092_056085
615 Ga0587095_015334
616 Ga0587106_071636
617 Ga0587101_048788
618 Ga0587101_050598
619 Ga0587101_052405
620 Ga0587101_053717
621 Ga0587115_036381
622 Ga0587117_042430
623 Ga0587117_059414
624 Ga0587128_020162
625 Ga0587128_055273
626 Ga0587128_057767
627 Ga0587062_049949
628 Ga0587068_062980
629 Ga0587072_025564
630 Ga0587075_053323
631 Ga0587076_076735
632 Ga0587079_114685
633 Ga0587071_115342
634 Ga0587111_0105849
635 Ga0587111_0115195
636 Ga0587111_0119085
637 Ga0587111_0129239
638 Ga0466962_0074019
639 2501072049
640 2501084378
641 2501411856
642 2511088542
643 2511100859
644 2511107382
645 2511244806
646 2513553332
647 2513564224
648 2516025114
649 2519459186
650 2548501099
651 2585290234
652 2643866800
653 2643993522
654 2644062635
655 2644076351
656 2644294659
657 2644645807
658 2722882783
659 2739244681
660 2816475116
661 2817261475
662 2817279161
663 2817456239
664 2839138518
665 2856294430
666 2857367805
667 2881103936
668 2883089564
669 2904619872
670 2919705285
671 2929162424
672 2939631529
673 2939631544
674 2990712758
675 8003960705
676 8020813599
677 8040172823
678 8040173706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09361

Phasin_2

Phasin protein

3

102

0.98

Map