F413534

General Info

Members Datasets Scaffolds Average Seq Length
338 220 676 226

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10071515|Ga0207645_100715153
Length 247
Sequence MSINSESGFSLTPGSCKFPPMPYLFPPTVPAVAVKGRPDQFPVHRIYCVGRNYAAHAREMGANPDREPPFFFAKPADAIVPGNSRIPYPSRTNNFHHEIELVVAIGKGGRDIAAAQALDHVYGYAVGNDLTRRDLQSDAKDNGRPWDTSKGFDRSAAISAITPAAQSGHLRSGRIWLKVNGQMRQQADLSELIWSVPEIIAELSTFFELQPGDLIYTGTPAGVGALKKGDRIEGGIDGLDELVTTIE

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
74 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
75 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
148 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
151 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 2516143018 Ensifer sp. BR816 Isolate Nodule
208 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
209 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
210 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
211 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
212 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
213 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
214 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
215 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
216 2818991435 Caulobacter henricii 536 Isolate Unclassified
217 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
218 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
219 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
220 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.88
Nodule 2.07
Rhizoplane 0.3
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10071515 3300025907 Bacteria 2220
2 JGI25153J46596_10060839 3300003215 Bacteria 1026
3 rootL2_10124961 3300003322 Bacteria 2071
4 Ga0055531_10001568 3300003794 Bacteria 16729
5 Ga0065715_10091653 3300005293 Bacteria 5643
6 Ga0065707_10082536 3300005295 Bacteria 14023
7 Ga0070676_10037692 3300005328 Bacteria 2789
8 Ga0070683_100047308 3300005329 Bacteria 3974
9 Ga0070683_100173955 3300005329 Bacteria 2044
10 Ga0070680_100007579 3300005336 Bacteria 8278
11 Ga0070680_100137596 3300005336 Bacteria 2047
12 Ga0070680_100158422 3300005336 Bacteria 1902
13 Ga0070680_100304684 3300005336 Bacteria 1351
14 Ga0068868_100330329 3300005338 Bacteria 1301
15 Ga0070689_100000337 3300005340 Bacteria 27384
16 Ga0070691_10081383 3300005341 Bacteria 1586
17 Ga0070687_100142183 3300005343 Bacteria 1399
18 Ga0070661_100344945 3300005344 Bacteria 1167
19 Ga0070692_10440226 3300005345 Bacteria 832
20 Ga0070668_100014072 3300005347 Bacteria 5980
21 Ga0070675_100000590 3300005354 Bacteria 24895
22 Ga0070671_100069354 3300005355 Bacteria 2941
23 Ga0070671_100122363 3300005355 Bacteria 2190
24 Ga0070673_100001770 3300005364 Bacteria 12869
25 Ga0070667_100124945 3300005367 Bacteria 2241
26 Ga0070714_100672106 3300005435 Bacteria 998
27 Ga0070713_100023397 3300005436 Bacteria 4795
28 Ga0070710_10218232 3300005437 Unclassified 1212
29 Ga0070678_100007824 3300005456 Bacteria 6359
30 Ga0070662_100040088 3300005457 Bacteria 3333
31 Ga0070681_10004268 3300005458 Bacteria 13561
32 Ga0070681_10015628 3300005458 Bacteria 7558
33 Ga0070681_10076627 3300005458 Bacteria 3302
34 Ga0070681_10129126 3300005458 Bacteria 2460
35 Ga0070681_10817987 3300005458 Bacteria 849
36 Ga0070679_100091518 3300005530 Bacteria 3030
37 Ga0070679_100107578 3300005530 Bacteria 2774
38 Ga0070679_100157568 3300005530 Bacteria 2245
39 Ga0070679_100606692 3300005530 Bacteria 1038
40 Ga0070684_100002059 3300005535 Bacteria 14811
41 Ga0068853_100200289 3300005539 Bacteria 1817
42 Ga0070672_100740829 3300005543 Bacteria 862
43 Ga0070686_100001568 3300005544 Bacteria 12849
44 Ga0070695_100457447 3300005545 Bacteria 979
45 Ga0070693_100073065 3300005547 Bacteria 2025
46 Ga0070665_100052310 3300005548 Bacteria 4097
47 Ga0070665_100065203 3300005548 Bacteria 3654
48 Ga0070665_100097900 3300005548 Bacteria 2938
49 Ga0070665_100502195 3300005548 Bacteria 1224
50 Ga0068855_100063359 3300005563 Bacteria 4314
51 Ga0068855_100084349 3300005563 Bacteria 3679
52 Ga0070664_100000397 3300005564 Bacteria 32538
53 Ga0068857_100261041 3300005577 Bacteria 1590
54 Ga0068856_100090481 3300005614 Bacteria 3044
55 Ga0068864_100015053 3300005618 Bacteria 6429
56 Ga0068861_100026172 3300005719 Bacteria 4240
57 Ga0068861_100047378 3300005719 Bacteria 3244
58 Ga0068863_100000998 3300005841 Bacteria 28350
59 Ga0068858_100064013 3300005842 Bacteria 3403
60 Ga0068862_100000542 3300005844 Bacteria 39532
61 Ga0068862_100009222 3300005844 Bacteria 8173
62 Ga0068862_100024026 3300005844 Bacteria 5110
63 Ga0070715_10112720 3300006163 Bacteria 1285
64 Ga0097621_100017737 3300006237 Bacteria 5415
65 Ga0097621_100088484 3300006237 Bacteria 2588
66 Ga0068871_100003074 3300006358 Bacteria 11450
67 Ga0068871_100075530 3300006358 Bacteria 2782
68 Ga0068871_100519806 3300006358 Unclassified 1075
69 Ga0068871_100630207 3300006358 Bacteria 977
70 Ga0075428_100000382 3300006844 Bacteria 43854
71 Ga0075428_100049076 3300006844 Bacteria 4631
72 Ga0075430_100009993 3300006846 Bacteria 8029
73 Ga0075430_100122094 3300006846 Bacteria 2172
74 Ga0075430_100174917 3300006846 Bacteria 1786
75 Ga0075430_100387313 3300006846 Bacteria 1154
76 Ga0075431_100003681 3300006847 Bacteria 14887
77 Ga0075431_100021732 3300006847 Bacteria 6561
78 Ga0075431_100121800 3300006847 Bacteria 2691
79 Ga0075431_100124465 3300006847 Bacteria 2660
80 Ga0075431_100796404 3300006847 Bacteria 918
81 Ga0075433_10503433 3300006852 Bacteria 1066
82 Ga0075429_100022392 3300006880 Bacteria 5480
83 Ga0075429_100042050 3300006880 Bacteria 3978
84 Ga0075429_100056860 3300006880 Bacteria 3405
85 Ga0068865_100132496 3300006881 Bacteria 1869
86 Ga0105240_10002586 3300009093 Bacteria 28982
87 Ga0105240_10004000 3300009093 Bacteria 22715
88 Ga0105240_10010103 3300009093 Bacteria 13283
89 Ga0105240_10090087 3300009093 Bacteria 3750
90 Ga0105240_10116714 3300009093 Bacteria 3219
91 Ga0105240_10123176 3300009093 Bacteria 3120
92 Ga0105240_10471242 3300009093 Bacteria 1401
93 Ga0105240_10940480 3300009093 Bacteria 928
94 Ga0111539_10025636 3300009094 Bacteria 7226
95 Ga0111539_10065170 3300009094 Bacteria 4306
96 Ga0111539_10183979 3300009094 Bacteria 2440
97 Ga0111539_10469760 3300009094 Bacteria 1465
98 Ga0114129_10004988 3300009147 Bacteria 18707
99 Ga0114129_10012199 3300009147 Bacteria 12228
100 Ga0105241_10054021 3300009174 Bacteria 3074
101 Ga0105242_10192672 3300009176 Bacteria 1806
102 Ga0105242_10590111 3300009176 Bacteria 1071
103 Ga0105242_10674156 3300009176 Unclassified 1008
104 Ga0105248_10009514 3300009177 Bacteria 10697
105 Ga0105248_10820062 3300009177 Bacteria 1050
106 Ga0105237_10031435 3300009545 Bacteria 5383
107 Ga0105237_10082802 3300009545 Bacteria 3200
108 Ga0105237_10124643 3300009545 Bacteria 2571
109 Ga0105237_10136468 3300009545 Bacteria 2447
110 Ga0105237_10150348 3300009545 Bacteria 2325
111 Ga0105237_10356822 3300009545 Bacteria 1466
112 Ga0105237_11031031 3300009545 Bacteria 829
113 Ga0105238_10015890 3300009551 Bacteria 7616
114 Ga0105238_10028634 3300009551 Bacteria 5674
115 Ga0105238_10077324 3300009551 Bacteria 3319
116 Ga0105238_10158440 3300009551 Bacteria 2239
117 Ga0105249_10026539 3300009553 Bacteria 5221
118 Ga0105249_10059563 3300009553 Bacteria 3502
119 Ga0105239_10137204 3300010375 Bacteria 2723
120 Ga0105239_10226431 3300010375 Bacteria 2098
121 Ga0105239_10342896 3300010375 Bacteria 1686
122 Ga0157370_10003442 3300013104 Bacteria 18575
123 Ga0157369_10129256 3300013105 Bacteria 2677
124 Ga0157369_10145323 3300013105 Bacteria 2508
125 Ga0157369_10689229 3300013105 Bacteria 1052
126 Ga0157374_10500058 3300013296 Bacteria 1220
127 Ga0157374_10694188 3300013296 Bacteria 1031
128 Ga0157378_10032348 3300013297 Bacteria 4622
129 Ga0163162_10001032 3300013306 Bacteria 25916
130 Ga0157372_10165909 3300013307 Bacteria 2554
131 Ga0157375_10004700 3300013308 Bacteria 11887
132 Ga0157380_10184575 3300014326 Bacteria 1836
133 Ga0157379_10053034 3300014968 Bacteria 3623
134 Ga0157376_10000657 3300014969 Bacteria 22340
135 Ga0157376_10375878 3300014969 Bacteria 1367
136 Ga0214544_1001682 3300021320 Bacteria 46508
137 Ga0214542_1001614 3300021321 Bacteria 46380
138 Ga0214543_1001395 3300021327 Bacteria 46435
139 Ga0213876_10000081 3300021384 Bacteria 108997
140 Ga0209676_1000783 3300025292 Bacteria 42336
141 Ga0209050_1009321 3300025298 Bacteria 5043
142 Ga0209257_1000554 3300025304 Bacteria 64085
143 Ga0207680_10049960 3300025903 Unclassified 2493
144 Ga0207643_10013118 3300025908 Bacteria 4483
145 Ga0207654_10138878 3300025911 Bacteria 1547
146 Ga0207707_10001408 3300025912 Bacteria 22278
147 Ga0207707_10066998 3300025912 Bacteria 3127
148 Ga0207707_10341115 3300025912 Bacteria 1292
149 Ga0207695_10002566 3300025913 Bacteria 26692
150 Ga0207695_10019794 3300025913 Bacteria 7736
151 Ga0207695_10023779 3300025913 Bacteria 6915
152 Ga0207695_10096823 3300025913 Bacteria 2952
153 Ga0207695_10132872 3300025913 Bacteria 2445
154 Ga0207695_10307315 3300025913 Bacteria 1476
155 Ga0207671_10010039 3300025914 Bacteria 7850
156 Ga0207671_10108160 3300025914 Bacteria 2113
157 Ga0207660_10030756 3300025917 Bacteria 3691
158 Ga0207660_10213674 3300025917 Bacteria 1511
159 Ga0207660_10480642 3300025917 Bacteria 1007
160 Ga0207657_10180765 3300025919 Bacteria 1705
161 Ga0207652_10003570 3300025921 Bacteria 12828
162 Ga0207652_10073598 3300025921 Bacteria 2973
163 Ga0207652_10115556 3300025921 Bacteria 2384
164 Ga0207652_10532949 3300025921 Bacteria 1056
165 Ga0207681_10005178 3300025923 Bacteria 8008
166 Ga0207694_10050948 3300025924 Bacteria 3208
167 Ga0207694_10349266 3300025924 Bacteria 1224
168 Ga0207694_10800998 3300025924 Bacteria 796
169 Ga0207694_10810219 3300025924 Bacteria 791
170 Ga0207700_10348195 3300025928 Bacteria 1289
171 Ga0207690_10290561 3300025932 Bacteria 1276
172 Ga0207706_10026066 3300025933 Bacteria 5234
173 Ga0207706_10207969 3300025933 Bacteria 1715
174 Ga0207686_10147572 3300025934 Bacteria 1633
175 Ga0207670_10014708 3300025936 Bacteria 4654
176 Ga0207691_10261937 3300025940 Bacteria 1490
177 Ga0207711_10516731 3300025941 Bacteria 1113
178 Ga0207689_10028901 3300025942 Bacteria 4635
179 Ga0207689_10423215 3300025942 Bacteria 1111
180 Ga0207661_10408917 3300025944 Bacteria 1231
181 Ga0207679_10002860 3300025945 Bacteria 10702
182 Ga0207667_10014734 3300025949 Bacteria 8898
183 Ga0207667_10048652 3300025949 Bacteria 4482
184 Ga0207712_10017676 3300025961 Bacteria 4635
185 Ga0207712_10172893 3300025961 Bacteria 1690
186 Ga0207668_10045520 3300025972 Bacteria 2993
187 Ga0207658_10651502 3300025986 Unclassified 949
188 Ga0207677_10423687 3300026023 Bacteria 1134
189 Ga0207639_10170112 3300026041 Bacteria 1844
190 Ga0207641_10004753 3300026088 Bacteria 11709
191 Ga0207648_10020973 3300026089 Bacteria 5882
192 Ga0207674_10046403 3300026116 Bacteria 4461
193 Ga0207674_10126498 3300026116 Bacteria 2521
194 Ga0207674_10170142 3300026116 Bacteria 2132
195 Ga0207675_100000884 3300026118 Bacteria 29908
196 Ga0207675_100008784 3300026118 Bacteria 9485
197 Ga0207683_10040002 3300026121 Bacteria 4090
198 Ga0207428_10066308 3300027907 Bacteria 2845
199 Ga0207428_10084432 3300027907 Bacteria 2475
200 Ga0207428_10094421 3300027907 Bacteria 2319
201 Ga0268266_10029345 3300028379 Bacteria 4676
202 Ga0268266_10092369 3300028379 Bacteria 2655
203 Ga0268266_10204453 3300028379 Bacteria 1808
204 Ga0268265_10012026 3300028380 Bacteria 5858
205 Ga0268265_10114527 3300028380 Bacteria 2208
206 Ga0268265_10295210 3300028380 Bacteria 1457
207 Ga0268264_10041996 3300028381 Bacteria 3784
208 Ga0265334_10012582 3300028573 Bacteria 3553
209 Ga0307515_10004149 3300028794 Bacteria 30164
210 Ga0265338_10575388 3300028800 Bacteria 786
211 Ga0265328_10123217 3300031239 Bacteria 968
212 Ga0265339_10029903 3300031249 Bacteria 3088
213 Ga0265331_10001557 3300031250 Bacteria 16815
214 Ga0307513_10429371 3300031456 Bacteria 1050
215 Ga0307509_10000062 3300031507 Bacteria 143809
216 Ga0307408_100019674 3300031548 Bacteria 4548
217 Ga0316575_10031330 3300031665 Bacteria 2081
218 Ga0265314_10122069 3300031711 Bacteria 1638
219 Ga0265314_10140295 3300031711 Bacteria 1495
220 Ga0265342_10038725 3300031712 Bacteria 2902
221 Ga0265342_10051444 3300031712 Bacteria 2458
222 Ga0316576_10002235 3300031727 Bacteria 10948
223 Ga0316576_10120615 3300031727 Bacteria 1968
224 Ga0316576_10123732 3300031727 Unclassified 1943
225 Ga0316578_10009149 3300031728 Bacteria 5083
226 Ga0316578_10108811 3300031728 Unclassified 1664
227 Ga0307406_10099164 3300031901 Bacteria 1980
228 Ga0307412_10093025 3300031911 Bacteria 2114
229 Ga0307416_100031560 3300032002 Bacteria 3990
230 Ga0307411_10254098 3300032005 Bacteria 1384
231 Ga0307415_100945604 3300032126 Bacteria 797
232 Ga0316580_10019211 3300032139 Bacteria 2103
233 Ga0316574_0004705 3300035398 Bacteria 7195
234 Ga0316574_0113356 3300035398 Bacteria 1738
235 Ga0316574_0186456 3300035398 Bacteria 1334
236 Ga0373937_0684323 3300036401 Bacteria 972
237 Ga0316584_0006332 3300036712 Bacteria 8017
238 Ga0373925_0179714 3300037068 Bacteria 1674
239 Ga0395900_0353259 3300037418 Bacteria 1443
240 Ga0395898_0031986 3300037466 Bacteria 5252
241 Ga0436364_1009037 3300037853 Bacteria 971
242 Ga0436365_1238940 3300039437 Bacteria 40642
243 Ga0436360_1022647 3300039438 Bacteria 2714
244 Ga0436361_0448400 3300039447 Bacteria 2346
245 Ga0436363_1631824 3300039450 Bacteria 882
246 Ga0451847_0495121 3300041503 Bacteria 1108
247 Ga0439437_003778 3300042000 Bacteria 1636
248 Ga0439435_0000652 3300042436 Bacteria 5720
249 Ga0439459_0003152 3300042438 Bacteria 2591
250 Ga0450916_004696 3300042530 Bacteria 1553
251 Ga0466969_0000965 3300044656 Bacteria 15505
252 Ga0453684_0000566 3300044712 Bacteria 138895
253 Ga0495627_000906 3300046453 Bacteria 20642
254 Ga0495638_0001344 3300046460 Bacteria 22555
255 Ga0495638_0019661 3300046460 Bacteria 4466
256 Ga0495650_0000262 3300046471 Bacteria 101769
257 Ga0495650_0030281 3300046471 Bacteria 2454
258 Ga0495605_0154726 3300046474 Bacteria 1021
259 Ga0495610_0000524 3300046512 Bacteria 38586
260 Ga0495632_0132668 3300046519 Bacteria 1158
261 Ga0495637_0004073 3300046520 Bacteria 7629
262 Ga0495648_0071427 3300046524 Bacteria 2012
263 Ga0495625_0001828 3300046660 Bacteria 24359
264 Ga0495625_0004648 3300046660 Bacteria 12893
265 Ga0495625_0016427 3300046660 Bacteria 5826
266 Ga0495671_0265065 3300046692 Bacteria 828
267 Ga0495672_0004566 3300047320 Bacteria 11257
268 Ga0495672_0043870 3300047320 Bacteria 2686
269 Ga0495683_0004303 3300047323 Bacteria 8115
270 Ga0495679_015528 3300047446 Bacteria 2781
271 Ga0495686_0011262 3300047472 Bacteria 6305
272 Ga0496102_0418161 3300048905 Bacteria 1259
273 Ga0496121_0016979 3300048924 Bacteria 7473
274 Ga0496124_0349125 3300048927 Bacteria 1047
275 Ga0496126_0451325 3300048929 Bacteria 1035
276 Ga0501033_0042613 3300049570 Bacteria 3384
277 Ga0501034_0468648 3300049571 Bacteria 1176
278 Ga0501068_0242709 3300049584 Bacteria 1147
279 Ga0501075_0011615 3300049591 Bacteria 6235
280 Ga0501238_000693 3300049671 Bacteria 3770
281 Ga0501083_0107445 3300049744 Bacteria 1836
282 Ga0501044_0197289 3300049823 Bacteria 1972
283 nmdc:mga05p37_190550_c1 3300050507 Bacteria 2490
284 nmdc:mga05p37_23852_c1 3300050507 Bacteria 7430
285 nmdc:mga09592_305269_c1 3300050508 Bacteria 1380
286 nmdc:mga09592_45601_c1 3300050508 Bacteria 3693
287 nmdc:mga0qj67_349417_c1 3300050509 Bacteria 1196
288 nmdc:mga0qj67_77114_c1 3300050509 Bacteria 2666
289 nmdc:mga0qj67_90899_c1 3300050509 Bacteria 2453
290 nmdc:mga06r32_167474_c1 3300050510 Bacteria 2180
291 nmdc:mga06r32_216585_c1 3300050510 Bacteria 1903
292 nmdc:mga06r32_5432_c1 3300050510 Bacteria 11470
293 nmdc:mga06r32_5497_c1 3300050510 Bacteria 11413
294 nmdc:mga08y16_226459_c1 3300050511 Bacteria 1935
295 nmdc:mga08y16_380728_c1 3300050511 Bacteria 1446
296 nmdc:mga08y16_53789_c1 3300050511 Bacteria 4208
297 nmdc:mga0a205_501068_c1 3300050515 Bacteria 1071
298 Ga0500583_0008612 3300053092 Bacteria 3673
299 Ga0500583_0155784 3300053092 Bacteria 1137
300 Ga0500651_0044166 3300053093 Bacteria 2807
301 Ga0500641_0100327 3300053096 Bacteria 1241
302 Ga0500554_003504 3300053102 Bacteria 3223
303 Ga0500556_0000300 3300053104 Bacteria 37857
304 Ga0500556_0039944 3300053104 Bacteria 1647
305 Ga0500562_001838 3300053108 Bacteria 5321
306 Ga0500572_057341 3300053111 Bacteria 1176
307 Ga0500595_105104 3300053119 Bacteria 806
308 Ga0500614_004563 3300053123 Bacteria 2919
309 Ga0500618_000205 3300053125 Bacteria 46863
310 Ga0500652_021292 3300053131 Bacteria 2441
311 Ga0500658_0000956 3300053134 Bacteria 11804
312 Ga0500559_0000277 3300053136 Bacteria 39724
313 Ga0500568_0055349 3300053139 Bacteria 1548
314 Ga0500588_0000800 3300053146 Bacteria 5430
315 Ga0500616_0109081 3300053153 Bacteria 1340
316 Ga0500622_0003862 3300053156 Bacteria 9731
317 Ga0500622_0006697 3300053156 Bacteria 6639
318 Ga0500622_0030146 3300053156 Bacteria 2849
319 Ga0500622_0033993 3300053156 Bacteria 2672
320 Ga0500637_0052576 3300053178 Bacteria 2324
321 Ga0500645_091953 3300053730 Bacteria 860
322 Ga0500609_027334 3300053731 Bacteria 782
323 Ga0501084_0012758 3300054114 Bacteria 6961
324 Ga0501082_0544993 3300060353 Bacteria 1014
325 2516209676 2516143018 Bacteria 6951533
326 2643748110 2643221545 Bacteria 5083237
327 2644506882 2643221691 Bacteria 5093099
328 2657681173 2657244999 Bacteria 5946535
329 2692315862 2690316117 Bacteria 6800650
330 2753461848 2751185821 Bacteria 6189929
331 2792620153 2791355091 Bacteria 6135441
332 2792639375 2791355094 Bacteria 7011481
333 2804752372 2802429268 Bacteria 6094027
334 2819540219 2818991435 Bacteria 5433759
335 2819649219 2818991454 Bacteria 5563326
336 2847419073 2847417321 Bacteria 6913799
337 2848994104 2848992105 Bacteria 6810864
338 2855876749 2855872281 Bacteria 6964271
339 Ga0207645_10071515
340 JGI25153J46596_10060839
341 rootL2_10124961
342 Ga0055531_10001568
343 Ga0065715_10091653
344 Ga0065707_10082536
345 Ga0070676_10037692
346 Ga0070683_100047308
347 Ga0070683_100173955
348 Ga0070680_100007579
349 Ga0070680_100137596
350 Ga0070680_100158422
351 Ga0070680_100304684
352 Ga0068868_100330329
353 Ga0070689_100000337
354 Ga0070691_10081383
355 Ga0070687_100142183
356 Ga0070661_100344945
357 Ga0070692_10440226
358 Ga0070668_100014072
359 Ga0070675_100000590
360 Ga0070671_100069354
361 Ga0070671_100122363
362 Ga0070673_100001770
363 Ga0070667_100124945
364 Ga0070714_100672106
365 Ga0070713_100023397
366 Ga0070710_10218232
367 Ga0070678_100007824
368 Ga0070662_100040088
369 Ga0070681_10004268
370 Ga0070681_10015628
371 Ga0070681_10076627
372 Ga0070681_10129126
373 Ga0070681_10817987
374 Ga0070679_100091518
375 Ga0070679_100107578
376 Ga0070679_100157568
377 Ga0070679_100606692
378 Ga0070684_100002059
379 Ga0068853_100200289
380 Ga0070672_100740829
381 Ga0070686_100001568
382 Ga0070695_100457447
383 Ga0070693_100073065
384 Ga0070665_100052310
385 Ga0070665_100065203
386 Ga0070665_100097900
387 Ga0070665_100502195
388 Ga0068855_100063359
389 Ga0068855_100084349
390 Ga0070664_100000397
391 Ga0068857_100261041
392 Ga0068856_100090481
393 Ga0068864_100015053
394 Ga0068861_100026172
395 Ga0068861_100047378
396 Ga0068863_100000998
397 Ga0068858_100064013
398 Ga0068862_100000542
399 Ga0068862_100009222
400 Ga0068862_100024026
401 Ga0070715_10112720
402 Ga0097621_100017737
403 Ga0097621_100088484
404 Ga0068871_100003074
405 Ga0068871_100075530
406 Ga0068871_100519806
407 Ga0068871_100630207
408 Ga0075428_100000382
409 Ga0075428_100049076
410 Ga0075430_100009993
411 Ga0075430_100122094
412 Ga0075430_100174917
413 Ga0075430_100387313
414 Ga0075431_100003681
415 Ga0075431_100021732
416 Ga0075431_100121800
417 Ga0075431_100124465
418 Ga0075431_100796404
419 Ga0075433_10503433
420 Ga0075429_100022392
421 Ga0075429_100042050
422 Ga0075429_100056860
423 Ga0068865_100132496
424 Ga0105240_10002586
425 Ga0105240_10004000
426 Ga0105240_10010103
427 Ga0105240_10090087
428 Ga0105240_10116714
429 Ga0105240_10123176
430 Ga0105240_10471242
431 Ga0105240_10940480
432 Ga0111539_10025636
433 Ga0111539_10065170
434 Ga0111539_10183979
435 Ga0111539_10469760
436 Ga0114129_10004988
437 Ga0114129_10012199
438 Ga0105241_10054021
439 Ga0105242_10192672
440 Ga0105242_10590111
441 Ga0105242_10674156
442 Ga0105248_10009514
443 Ga0105248_10820062
444 Ga0105237_10031435
445 Ga0105237_10082802
446 Ga0105237_10124643
447 Ga0105237_10136468
448 Ga0105237_10150348
449 Ga0105237_10356822
450 Ga0105237_11031031
451 Ga0105238_10015890
452 Ga0105238_10028634
453 Ga0105238_10077324
454 Ga0105238_10158440
455 Ga0105249_10026539
456 Ga0105249_10059563
457 Ga0105239_10137204
458 Ga0105239_10226431
459 Ga0105239_10342896
460 Ga0157370_10003442
461 Ga0157369_10129256
462 Ga0157369_10145323
463 Ga0157369_10689229
464 Ga0157374_10500058
465 Ga0157374_10694188
466 Ga0157378_10032348
467 Ga0163162_10001032
468 Ga0157372_10165909
469 Ga0157375_10004700
470 Ga0157380_10184575
471 Ga0157379_10053034
472 Ga0157376_10000657
473 Ga0157376_10375878
474 Ga0214544_1001682
475 Ga0214542_1001614
476 Ga0214543_1001395
477 Ga0213876_10000081
478 Ga0209676_1000783
479 Ga0209050_1009321
480 Ga0209257_1000554
481 Ga0207680_10049960
482 Ga0207643_10013118
483 Ga0207654_10138878
484 Ga0207707_10001408
485 Ga0207707_10066998
486 Ga0207707_10341115
487 Ga0207695_10002566
488 Ga0207695_10019794
489 Ga0207695_10023779
490 Ga0207695_10096823
491 Ga0207695_10132872
492 Ga0207695_10307315
493 Ga0207671_10010039
494 Ga0207671_10108160
495 Ga0207660_10030756
496 Ga0207660_10213674
497 Ga0207660_10480642
498 Ga0207657_10180765
499 Ga0207652_10003570
500 Ga0207652_10073598
501 Ga0207652_10115556
502 Ga0207652_10532949
503 Ga0207681_10005178
504 Ga0207694_10050948
505 Ga0207694_10349266
506 Ga0207694_10800998
507 Ga0207694_10810219
508 Ga0207700_10348195
509 Ga0207690_10290561
510 Ga0207706_10026066
511 Ga0207706_10207969
512 Ga0207686_10147572
513 Ga0207670_10014708
514 Ga0207691_10261937
515 Ga0207711_10516731
516 Ga0207689_10028901
517 Ga0207689_10423215
518 Ga0207661_10408917
519 Ga0207679_10002860
520 Ga0207667_10014734
521 Ga0207667_10048652
522 Ga0207712_10017676
523 Ga0207712_10172893
524 Ga0207668_10045520
525 Ga0207658_10651502
526 Ga0207677_10423687
527 Ga0207639_10170112
528 Ga0207641_10004753
529 Ga0207648_10020973
530 Ga0207674_10046403
531 Ga0207674_10126498
532 Ga0207674_10170142
533 Ga0207675_100000884
534 Ga0207675_100008784
535 Ga0207683_10040002
536 Ga0207428_10066308
537 Ga0207428_10084432
538 Ga0207428_10094421
539 Ga0268266_10029345
540 Ga0268266_10092369
541 Ga0268266_10204453
542 Ga0268265_10012026
543 Ga0268265_10114527
544 Ga0268265_10295210
545 Ga0268264_10041996
546 Ga0265334_10012582
547 Ga0307515_10004149
548 Ga0265338_10575388
549 Ga0265328_10123217
550 Ga0265339_10029903
551 Ga0265331_10001557
552 Ga0307513_10429371
553 Ga0307509_10000062
554 Ga0307408_100019674
555 Ga0316575_10031330
556 Ga0265314_10122069
557 Ga0265314_10140295
558 Ga0265342_10038725
559 Ga0265342_10051444
560 Ga0316576_10002235
561 Ga0316576_10120615
562 Ga0316576_10123732
563 Ga0316578_10009149
564 Ga0316578_10108811
565 Ga0307406_10099164
566 Ga0307412_10093025
567 Ga0307416_100031560
568 Ga0307411_10254098
569 Ga0307415_100945604
570 Ga0316580_10019211
571 Ga0316574_0004705
572 Ga0316574_0113356
573 Ga0316574_0186456
574 Ga0373937_0684323
575 Ga0316584_0006332
576 Ga0373925_0179714
577 Ga0395900_0353259
578 Ga0395898_0031986
579 Ga0436364_1009037
580 Ga0436365_1238940
581 Ga0436360_1022647
582 Ga0436361_0448400
583 Ga0436363_1631824
584 Ga0451847_0495121
585 Ga0439437_003778
586 Ga0439435_0000652
587 Ga0439459_0003152
588 Ga0450916_004696
589 Ga0466969_0000965
590 Ga0453684_0000566
591 Ga0495627_000906
592 Ga0495638_0001344
593 Ga0495638_0019661
594 Ga0495650_0000262
595 Ga0495650_0030281
596 Ga0495605_0154726
597 Ga0495610_0000524
598 Ga0495632_0132668
599 Ga0495637_0004073
600 Ga0495648_0071427
601 Ga0495625_0001828
602 Ga0495625_0004648
603 Ga0495625_0016427
604 Ga0495671_0265065
605 Ga0495672_0004566
606 Ga0495672_0043870
607 Ga0495683_0004303
608 Ga0495679_015528
609 Ga0495686_0011262
610 Ga0496102_0418161
611 Ga0496121_0016979
612 Ga0496124_0349125
613 Ga0496126_0451325
614 Ga0501033_0042613
615 Ga0501034_0468648
616 Ga0501068_0242709
617 Ga0501075_0011615
618 Ga0501238_000693
619 Ga0501083_0107445
620 Ga0501044_0197289
621 nmdc:mga05p37_190550_c1
622 nmdc:mga05p37_23852_c1
623 nmdc:mga09592_305269_c1
624 nmdc:mga09592_45601_c1
625 nmdc:mga0qj67_349417_c1
626 nmdc:mga0qj67_77114_c1
627 nmdc:mga0qj67_90899_c1
628 nmdc:mga06r32_167474_c1
629 nmdc:mga06r32_216585_c1
630 nmdc:mga06r32_5432_c1
631 nmdc:mga06r32_5497_c1
632 nmdc:mga08y16_226459_c1
633 nmdc:mga08y16_380728_c1
634 nmdc:mga08y16_53789_c1
635 nmdc:mga0a205_501068_c1
636 Ga0500583_0008612
637 Ga0500583_0155784
638 Ga0500651_0044166
639 Ga0500641_0100327
640 Ga0500554_003504
641 Ga0500556_0000300
642 Ga0500556_0039944
643 Ga0500562_001838
644 Ga0500572_057341
645 Ga0500595_105104
646 Ga0500614_004563
647 Ga0500618_000205
648 Ga0500652_021292
649 Ga0500658_0000956
650 Ga0500559_0000277
651 Ga0500568_0055349
652 Ga0500588_0000800
653 Ga0500616_0109081
654 Ga0500622_0003862
655 Ga0500622_0006697
656 Ga0500622_0030146
657 Ga0500622_0033993
658 Ga0500637_0052576
659 Ga0500645_091953
660 Ga0500609_027334
661 Ga0501084_0012758
662 Ga0501082_0544993
663 2516209676
664 2643748110
665 2644506882
666 2657681173
667 2692315862
668 2753461848
669 2792620153
670 2792639375
671 2804752372
672 2819540219
673 2819649219
674 2847419073
675 2848994104
676 2855876749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

45

247

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9587 1 224
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9559 2 224
6j5y-assembly1.cif.gz_A crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate 0.9392 3 225
1nr9-assembly2.cif.gz_C crystal structure of escherichia coli 1262 (apc5008), putative isomerase 0.9391 23 225
6foh-assembly1.cif.gz_A x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) at 1.56a resolution. 0.9363 25 224
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9559 2 224 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9361 25 224 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.935 2 224 3.90.850.10
af_Q4D6U8_2_270_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9286 1 225 3.90.850.10
af_Q4D6U8_2_270_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9246 1 225 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A1S2HSE9-F1-model_v4 deleted 0.9831 77 225
AF-A0A7V7X9R7-F1-model_v4 deleted 0.9823 75 225
AF-F8XN92-F1-model_v4 deleted 0.9779 71 225
AF-A0A435SEY7-F1-model_v4 deleted 0.9778 67 224
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9774 82 224 GO:0018773
GO:0046872

Map