F412863

General Info

Members Datasets Scaffolds Average Seq Length
336 247 312 195

Family's Representative Sequence

Representative Sequence 3300053123|Ga0500614_006403|Ga0500614_006403_75_644
Length 189
Sequence MSDEEDRPRASFTAFSQGTPADWDIIGAEFVRFAGGLPDRVLEHLMLLGQGHGGFPIDRLTHSLQTATMAHDDGRDEEYVVCALLHDIGDSLGTYNHPEVAAAILGPFVSDENRWMVEKHGIFQSHHMFQSVLDRDPRDALRSHRFYARAEDFSVRYDNRAFDPNRPNRPLAFFEPMVQRLFARPRRAG

Samples

Sample ID Description Type Environment
1 2511231017 Pseudomonas sp. GM55 Isolate Nodule
2 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
3 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
4 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
5 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
6 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
7 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
8 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
9 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
10 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
11 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
12 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
13 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
14 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
15 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
16 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
17 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
18 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
19 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
20 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
21 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
22 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
181 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0.6
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0.3
Rhizoplane 5.95
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000195 3300002774 Bacteria 33776
2 JGI25151J46595_10042355 3300003187 Bacteria 1641
3 JGI25153J46596_10000208 3300003215 Bacteria 53467
4 rootH2_10264734 3300003320 Bacteria 2740
5 Ga0055537_1006245 3300003773 Bacteria 3056
6 Ga0055536_1011468 3300003781 Bacteria 3395
7 Ga0055540_1001676 3300003792 Bacteria 12815
8 Ga0055531_10000001 3300003794 Bacteria 543586
9 Ga0055531_10000010 3300003794 Bacteria 206117
10 Ga0058859_10010417 3300004798 Bacteria 715
11 Ga0065704_10148096 3300005289 Bacteria 1453
12 Ga0070690_100008033 3300005330 Bacteria 6058
13 Ga0070670_100066352 3300005331 Bacteria 3096
14 Ga0070670_100122329 3300005331 Bacteria 2245
15 Ga0070677_10099475 3300005333 Bacteria 1280
16 Ga0070689_100119890 3300005340 Bacteria 2100
17 Ga0070668_100045700 3300005347 Bacteria 3360
18 Ga0070668_100278218 3300005347 Bacteria 1397
19 Ga0070669_100062201 3300005353 Bacteria 2744
20 Ga0070669_100331427 3300005353 Bacteria 1231
21 Ga0070671_100252826 3300005355 Bacteria 1497
22 Ga0070671_100352333 3300005355 Bacteria 1256
23 Ga0070671_100740259 3300005355 Bacteria 854
24 Ga0070674_100494991 3300005356 Bacteria 1017
25 Ga0070673_100096572 3300005364 Bacteria 2425
26 Ga0070688_100388202 3300005365 Bacteria 1031
27 Ga0070659_100123507 3300005366 Bacteria 2099
28 Ga0070667_100313202 3300005367 Bacteria 1415
29 Ga0070667_100622124 3300005367 Bacteria 996
30 Ga0070703_10068573 3300005406 Bacteria 1179
31 Ga0070705_100182399 3300005440 Bacteria 1423
32 Ga0070663_100719599 3300005455 Bacteria 850
33 Ga0070678_100570953 3300005456 Bacteria 1006
34 Ga0070662_100146080 3300005457 Bacteria 1837
35 Ga0070681_10913025 3300005458 Bacteria 797
36 Ga0068867_100069726 3300005459 Bacteria 2626
37 Ga0070698_100700483 3300005471 Bacteria 955
38 Ga0070699_100411286 3300005518 Bacteria 1224
39 Ga0070679_100773978 3300005530 Bacteria 903
40 Ga0068853_100031358 3300005539 Bacteria 4496
41 Ga0070672_100012287 3300005543 Bacteria 6004
42 Ga0070672_100053781 3300005543 Bacteria 3149
43 Ga0070695_100053747 3300005545 Bacteria 2591
44 Ga0070696_100075441 3300005546 Bacteria 2379
45 Ga0068855_100000772 3300005563 Bacteria 39468
46 Ga0068857_100136362 3300005577 Bacteria 2216
47 Ga0068856_100960638 3300005614 Bacteria 873
48 Ga0068852_101051602 3300005616 Bacteria 833
49 Ga0068859_100237582 3300005617 Bacteria 1911
50 Ga0068864_100507634 3300005618 Bacteria 1161
51 Ga0068861_100011778 3300005719 Bacteria 6085
52 Ga0068851_10116032 3300005834 Bacteria 1434
53 Ga0068863_100005774 3300005841 Bacteria 12134
54 Ga0068862_100048481 3300005844 Bacteria 3626
55 Ga0068862_100407600 3300005844 Bacteria 1273
56 Ga0070717_10041917 3300006028 Bacteria 3733
57 Ga0070717_10138764 3300006028 Bacteria 2096
58 Ga0075363_100016581 3300006048 Bacteria 3641
59 Ga0075364_10067152 3300006051 Bacteria 2357
60 Ga0075362_10289769 3300006177 Bacteria 811
61 Ga0075367_10092870 3300006178 Bacteria 1838
62 Ga0097621_100218385 3300006237 Bacteria 1660
63 Ga0075370_10004326 3300006353 Bacteria 6884
64 Ga0068871_100272239 3300006358 Bacteria 1479
65 Ga0068871_100841876 3300006358 Bacteria 847
66 Ga0075428_100117115 3300006844 Bacteria 2902
67 Ga0068865_100690532 3300006881 Bacteria 871
68 Ga0075436_100013150 3300006914 Bacteria 5676
69 Ga0097620_100237577 3300006931 Bacteria 1911
70 Ga0075435_100097332 3300007076 Unclassified 2435
71 Ga0099795_10000002 3300007788 Bacteria 161112
72 Ga0105240_10029247 3300009093 Bacteria 7184
73 Ga0111539_11012836 3300009094 Bacteria 966
74 Ga0105245_10186298 3300009098 Bacteria 1986
75 Ga0105247_10001647 3300009101 Bacteria 15782
76 Ga0114129_10082269 3300009147 Bacteria 4474
77 Ga0105243_11120720 3300009148 Bacteria 796
78 Ga0105248_11090342 3300009177 Bacteria 902
79 Ga0105238_10043338 3300009551 Bacteria 4553
80 Ga0105238_11441195 3300009551 Bacteria 716
81 Ga0105249_10158555 3300009553 Bacteria 2185
82 Ga0105249_10210400 3300009553 Bacteria 1908
83 Ga0105249_11171780 3300009553 Bacteria 839
84 Ga0099796_10000004 3300010159 Bacteria 77538
85 Ga0105239_10229246 3300010375 Bacteria 2084
86 Ga0157373_10287222 3300013100 Bacteria 1166
87 Ga0157374_10752915 3300013296 Bacteria 989
88 Ga0157372_10472449 3300013307 Bacteria 1462
89 Ga0157375_10779508 3300013308 Bacteria 1106
90 Ga0163163_11185022 3300014325 Bacteria 826
91 Ga0157380_10014575 3300014326 Bacteria 5755
92 Ga0157380_10088710 3300014326 Bacteria 2546
93 Ga0157380_10531014 3300014326 Bacteria 1150
94 Ga0157380_10608933 3300014326 Bacteria 1082
95 Ga0157380_11125521 3300014326 Bacteria 825
96 Ga0157379_11052081 3300014968 Bacteria 778
97 Ga0224712_10116163 3300022467 Unclassified 1153
98 Ga0207425_1000025 3300025245 Bacteria 321872
99 Ga0209129_1001489 3300025258 Bacteria 13016
100 Ga0209565_1000209 3300025263 Bacteria 68237
101 Ga0209673_1012397 3300025273 Bacteria 3435
102 Ga0209676_1003373 3300025292 Bacteria 9929
103 Ga0209025_1000630 3300025294 Bacteria 62487
104 Ga0209564_1000745 3300025295 Bacteria 46163
105 Ga0209758_1000002 3300025297 Bacteria 1400310
106 Ga0209758_1000108 3300025297 Bacteria 216541
107 Ga0209050_1000001 3300025298 Bacteria 3563507
108 Ga0209050_1012429 3300025298 Bacteria 3903
109 Ga0209050_1019709 3300025298 Bacteria 2547
110 Ga0209051_1000699 3300025303 Bacteria 36947
111 Ga0209257_1000033 3300025304 Bacteria 671006
112 Ga0209257_1016065 3300025304 Bacteria 3057
113 Ga0207656_10031198 3300025321 Bacteria 2206
114 Ga0207682_10139842 3300025893 Bacteria 1086
115 Ga0207710_10000860 3300025900 Bacteria 16332
116 Ga0207705_10190921 3300025909 Bacteria 1549
117 Ga0207684_10011340 3300025910 Bacteria 7802
118 Ga0207707_10101572 3300025912 Bacteria 2514
119 Ga0207695_10074851 3300025913 Bacteria 3446
120 Ga0207671_10135067 3300025914 Bacteria 1896
121 Ga0207652_10297840 3300025921 Bacteria 1456
122 Ga0207646_10285325 3300025922 Bacteria 1492
123 Ga0207681_10029693 3300025923 Bacteria 3556
124 Ga0207681_10118063 3300025923 Bacteria 1941
125 Ga0207694_10069938 3300025924 Bacteria 2742
126 Ga0207650_10005640 3300025925 Bacteria 8546
127 Ga0207650_10043201 3300025925 Bacteria 3308
128 Ga0207687_10136720 3300025927 Bacteria 1854
129 Ga0207644_10104169 3300025931 Bacteria 2136
130 Ga0207706_10065877 3300025933 Bacteria 3189
131 Ga0207670_10320152 3300025936 Bacteria 1220
132 Ga0207691_10459993 3300025940 Bacteria 1082
133 Ga0207689_10119268 3300025942 Bacteria 2170
134 Ga0207667_10007188 3300025949 Bacteria 13431
135 Ga0207651_10072200 3300025960 Bacteria 2449
136 Ga0207712_10105324 3300025961 Bacteria 2105
137 Ga0207712_10350348 3300025961 Bacteria 1227
138 Ga0207668_10179794 3300025972 Bacteria 1667
139 Ga0207640_10464750 3300025981 Bacteria 1046
140 Ga0207658_10332247 3300025986 Bacteria 1319
141 Ga0207658_10343286 3300025986 Bacteria 1298
142 Ga0207658_10423083 3300025986 Bacteria 1175
143 Ga0207639_10031987 3300026041 Bacteria 3870
144 Ga0207702_11025750 3300026078 Bacteria 819
145 Ga0207641_10030661 3300026088 Bacteria 4455
146 Ga0207648_10060997 3300026089 Bacteria 3289
147 Ga0207675_100102852 3300026118 Bacteria 2692
148 Ga0207683_10477032 3300026121 Bacteria 1151
149 Ga0209179_1000003 3300027512 Bacteria 121837
150 Ga0209982_1007185 3300027552 Bacteria 1627
151 Ga0307515_10022360 3300028794 Bacteria 11146
152 Ga0265338_10017848 3300028800 Bacteria 7628
153 Ga0316182_1101815 3300030745 Bacteria 1975
154 Ga0265332_10009183 3300031238 Bacteria 4422
155 Ga0265325_10177670 3300031241 Bacteria 993
156 Ga0307509_10098288 3300031507 Bacteria 2972
157 Ga0307509_10212103 3300031507 Bacteria 1759
158 Ga0307408_100000581 3300031548 Bacteria 31371
159 Ga0307408_100177453 3300031548 Bacteria 1705
160 Ga0307408_100390172 3300031548 Bacteria 1193
161 Ga0307408_101020310 3300031548 Bacteria 763
162 Ga0307508_10001570 3300031616 Bacteria 25499
163 Ga0307508_10025419 3300031616 Bacteria 5370
164 Ga0307508_10135619 3300031616 Bacteria 2064
165 Ga0307514_10011549 3300031649 Bacteria 7342
166 Ga0307516_10013033 3300031730 Bacteria 8903
167 Ga0307516_10018121 3300031730 Bacteria 7321
168 Ga0307516_10066867 3300031730 Bacteria 3465
169 Ga0307516_10085101 3300031730 Bacteria 3000
170 Ga0307405_10149021 3300031731 Bacteria 1642
171 Ga0307413_10028268 3300031824 Bacteria 3120
172 Ga0307413_10139596 3300031824 Bacteria 1672
173 Ga0307413_10194003 3300031824 Bacteria 1460
174 Ga0307413_10661234 3300031824 Bacteria 863
175 Ga0307410_10022894 3300031852 Bacteria 3872
176 Ga0307410_10053791 3300031852 Bacteria 2726
177 Ga0307410_10084024 3300031852 Bacteria 2243
178 Ga0307410_10121623 3300031852 Bacteria 1904
179 Ga0307410_10392871 3300031852 Bacteria 1119
180 Ga0307407_10042664 3300031903 Bacteria 2545
181 Ga0307407_10150570 3300031903 Bacteria 1511
182 Ga0307407_10321064 3300031903 Bacteria 1087
183 Ga0307412_10074705 3300031911 Bacteria 2323
184 Ga0307412_10285099 3300031911 Bacteria 1298
185 Ga0307409_100068728 3300031995 Bacteria 2803
186 Ga0307409_100159909 3300031995 Bacteria 1968
187 Ga0307409_100219823 3300031995 Bacteria 1714
188 Ga0307409_100520296 3300031995 Bacteria 1162
189 Ga0307409_100544430 3300031995 Bacteria 1138
190 Ga0307409_100663898 3300031995 Bacteria 1038
191 Ga0307409_101112697 3300031995 Bacteria 811
192 Ga0307416_100185792 3300032002 Bacteria 1953
193 Ga0307416_101159765 3300032002 Bacteria 878
194 Ga0307414_10000602 3300032004 Bacteria 18524
195 Ga0307414_10007591 3300032004 Bacteria 6100
196 Ga0307414_10165456 3300032004 Bacteria 1762
197 Ga0307414_10166400 3300032004 Bacteria 1758
198 Ga0307414_10208739 3300032004 Bacteria 1594
199 Ga0307414_10312525 3300032004 Bacteria 1334
200 Ga0307414_10344484 3300032004 Bacteria 1277
201 Ga0307414_10649079 3300032004 Bacteria 951
202 Ga0307411_10001709 3300032005 Bacteria 9218
203 Ga0307411_10009215 3300032005 Bacteria 5173
204 Ga0307411_10038136 3300032005 Bacteria 3028
205 Ga0307411_10058375 3300032005 Bacteria 2553
206 Ga0307411_10077140 3300032005 Bacteria 2280
207 Ga0307411_10083736 3300032005 Bacteria 2204
208 Ga0307411_10092745 3300032005 Bacteria 2113
209 Ga0307411_10102572 3300032005 Bacteria 2027
210 Ga0307411_10220669 3300032005 Bacteria 1470
211 Ga0307415_100019734 3300032126 Bacteria 4098
212 Ga0307415_100676622 3300032126 Bacteria 928
213 Ga0307415_101223819 3300032126 Bacteria 708
214 Ga0307507_10292047 3300033179 Bacteria 1008
215 Ga0373936_0000002 3300035113 Bacteria 452874
216 Ga0373961_0000105 3300035241 Bacteria 44080
217 Ga0316574_0028118 3300035398 Bacteria 3390
218 Ga0373937_0675750 3300036401 Bacteria 979
219 Ga0395905_0092882 3300037471 Bacteria 2830
220 Ga0395905_0749554 3300037471 Bacteria 879
221 Ga0439447_000230 3300041407 Bacteria 19716
222 Ga0439466_0002200 3300041411 Bacteria 7630
223 Ga0451793_0625347 3300041452 Bacteria 1623
224 Ga0451849_1304009 3300041505 Bacteria 924
225 Ga0439431_0020422 3300041997 Bacteria 1582
226 Ga0439443_011956 3300042003 Bacteria 1279
227 Ga0439449_0206964 3300042007 Bacteria 735
228 Ga0439452_052300 3300042010 Bacteria 932
229 Ga0439456_000027 3300042013 Bacteria 54335
230 Ga0439462_0081551 3300042015 Bacteria 884
231 Ga0450889_016879 3300042144 Bacteria 790
232 Ga0439434_0184789 3300042435 Bacteria 699
233 Ga0450893_0005353 3300042532 Bacteria 2061
234 Ga0466961_0302813 3300044693 Bacteria 976
235 Ga0453684_1331856 3300044712 Bacteria 748
236 Ga0466960_0355449 3300044901 Bacteria 836
237 Ga0495617_031375 3300046452 Bacteria 1784
238 Ga0495629_0317134 3300046459 Bacteria 1066
239 Ga0495653_0158976 3300046463 Bacteria 1570
240 Ga0495650_0001788 3300046471 Bacteria 19451
241 Ga0495582_0004652 3300046473 Bacteria 7717
242 Ga0495594_0133472 3300046499 Bacteria 1406
243 Ga0495594_0239976 3300046499 Bacteria 1033
244 Ga0495596_0068518 3300046500 Bacteria 1379
245 Ga0495628_0301457 3300046516 Bacteria 1186
246 Ga0495630_0201584 3300046517 Bacteria 1518
247 Ga0495630_0234214 3300046517 Bacteria 1403
248 Ga0495648_0011151 3300046524 Bacteria 6793
249 Ga0495648_0088280 3300046524 Bacteria 1743
250 Ga0495648_0291750 3300046524 Bacteria 768
251 Ga0495663_0002744 3300046525 Bacteria 5215
252 Ga0495666_0133077 3300046526 Bacteria 1161
253 Ga0495587_0037895 3300046536 Bacteria 2892
254 Ga0495598_0057316 3300046537 Bacteria 1192
255 Ga0495598_0068527 3300046537 Bacteria 1112
256 Ga0495609_0063326 3300046538 Bacteria 1632
257 Ga0495621_0023211 3300046539 Bacteria 2062
258 Ga0495645_0146251 3300046543 Bacteria 1646
259 Ga0495633_0094501 3300046558 Bacteria 1389
260 Ga0495656_0205594 3300046615 Bacteria 979
261 Ga0495635_0005882 3300046663 Bacteria 8550
262 Ga0495659_0059108 3300046664 Bacteria 1412
263 Ga0495659_0199451 3300046664 Bacteria 820
264 Ga0495646_0018341 3300046680 Bacteria 4432
265 Ga0495658_0423179 3300046683 Bacteria 850
266 Ga0495669_0382247 3300046684 Bacteria 681
267 Ga0495613_0020167 3300046689 Bacteria 4967
268 Ga0495670_0022580 3300046691 Bacteria 3107
269 Ga0495670_0033958 3300046691 Bacteria 2539
270 Ga0495670_0044031 3300046691 Bacteria 2228
271 Ga0495670_0098243 3300046691 Bacteria 1505
272 Ga0495604_0228858 3300047317 Bacteria 1276
273 Ga0495636_0007063 3300047318 Bacteria 4417
274 Ga0495636_0081171 3300047318 Bacteria 1397
275 Ga0495636_0101842 3300047318 Bacteria 1257
276 Ga0495672_0064052 3300047320 Bacteria 2106
277 Ga0495680_0007570 3300047322 Bacteria 9929
278 Ga0495687_000808 3300047443 Bacteria 33677
279 Ga0495675_0000981 3300047444 Bacteria 17308
280 Ga0495685_074267 3300047447 Bacteria 1137
281 Ga0495673_0042059 3300047469 Bacteria 2054
282 Ga0495673_0086581 3300047469 Bacteria 1287
283 Ga0495681_0029055 3300047470 Bacteria 2835
284 Ga0495681_0187132 3300047470 Bacteria 847
285 Ga0495593_0054930 3300047673 Bacteria 2098
286 Ga0495614_0278181 3300048089 Bacteria 770
287 Ga0495615_0139713 3300048090 Bacteria 714
288 Ga0496108_0411356 3300048911 Bacteria 1181
289 Ga0496109_0026309 3300048912 Bacteria 5188
290 Ga0496109_0339584 3300048912 Bacteria 1418
291 Ga0496112_0009658 3300048915 Bacteria 8706
292 Ga0496121_0000374 3300048924 Bacteria 92048
293 Ga0501068_0392682 3300049584 Bacteria 894
294 Ga0501069_0000498 3300049585 Bacteria 17879
295 Ga0501070_0000026 3300049586 Bacteria 150349
296 Ga0501071_0005619 3300049587 Bacteria 8081
297 Ga0501217_138119 3300049661 Bacteria 720
298 Ga0501080_0002679 3300049742 Bacteria 15590
299 nmdc:mga0k408_428527_c1 3300050493 Bacteria 786
300 nmdc:mga0k408_471830_c1 3300050493 Bacteria 744
301 nmdc:mga07m45_13804_c1 3300050496 Bacteria 3557
302 nmdc:mga07m45_208457_c1 3300050496 Bacteria 1137
303 nmdc:mga07m45_9479_c1 3300050496 Bacteria 5053
304 nmdc:mga0a205_380214_c1 3300050515 Unclassified 1277
305 nmdc:mga0a205_48775_c1 3300050515 Bacteria 4087
306 nmdc:mga0sz30_183988_c1 3300050516 Bacteria 927
307 Ga0500651_0055194 3300053093 Bacteria 2489
308 Ga0500553_212386 3300053101 Bacteria 644
309 Ga0500595_000943 3300053119 Bacteria 16406
310 Ga0500614_006403 3300053123 Bacteria 2475
311 Ga0500603_031817 3300053150 Bacteria 1366
312 Ga0500636_0111537 3300053177 Bacteria 1545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0001788 Ga0495650_0001788_7570_8094 172
2 3300053101 Ga0500553_212386 Ga0500553_212386_105_632 175
3 3300009147 Ga0114129_10082269 Ga0114129_100822693 177
4 3300035113 Ga0373936_0000002 Ga0373936_0000002_194577_195125 177
5 3300050493 nmdc:mga0k408_428527_c1 nmdc:mga0k408_428527_c1_183_734 179
6 3300006914 Ga0075436_100013150 Ga0075436_1000131503 180
7 3300007076 Ga0075435_100097332 Ga0075435_1000973322 180
8 3300014326 Ga0157380_10531014 Ga0157380_105310142 180
9 3300041997 Ga0439431_0020422 Ga0439431_0020422_374_937 180
10 3300042007 Ga0439449_0206964 Ga0439449_0206964_83_637 180
11 3300042010 Ga0439452_052300 Ga0439452_052300_81_635 180
12 3300042015 Ga0439462_0081551 Ga0439462_0081551_248_802 180
13 3300042435 Ga0439434_0184789 Ga0439434_0184789_110_664 180
14 3300046459 Ga0495629_0317134 Ga0495629_0317134_136_678 180
15 3300046517 Ga0495630_0234214 Ga0495630_0234214_734_1300 180
16 3300046683 Ga0495658_0423179 Ga0495658_0423179_63_608 180
17 3300047318 Ga0495636_0007063 Ga0495636_0007063_1567_2136 180
18 3300048912 Ga0496109_0026309 Ga0496109_0026309_924_1484 180
19 3300048915 Ga0496112_0009658 Ga0496112_0009658_4511_5083 180
20 3300050493 nmdc:mga0k408_471830_c1 nmdc:mga0k408_471830_c1_159_719 180
21 3300050515 nmdc:mga0a205_48775_c1 nmdc:mga0a205_48775_c1_3085_3630 180
22 3300014326 Ga0157380_10608933 Ga0157380_106089332 185
23 iso_pu_bacteria 2511231017 2511334457 185
24 iso_pu_bacteria 2554235341 2555668564 185
25 iso_pu_bacteria 2599185160 2599356936 185
26 iso_pu_bacteria 2599185161 2599362277 185
27 iso_pu_bacteria 2599185162 2599368597 185
28 iso_pu_bacteria 2599185163 2599375386 185
29 iso_pu_bacteria 2599185164 2599382041 185
30 iso_pu_bacteria 2599185165 2599388488 185
31 iso_pu_bacteria 2599185166 2599394244 185
32 iso_pu_bacteria 2599185168 2599406009 185
33 iso_pu_bacteria 2599185181 2599464559 185
34 iso_pu_bacteria 2599185182 2599468883 185
35 iso_pu_bacteria 2599185186 2599493582 185
36 iso_pu_bacteria 2599185356 2600216836 185
37 iso_pu_bacteria 2600255313 2601776567 185
38 iso_pu_bacteria 2643221589 2643952464 185
39 iso_pu_bacteria 2643221602 2644022226 185
40 iso_pu_bacteria 2667528171 2671098916 185
41 iso_pu_bacteria 2738543004 2739200748 185
42 iso_pu_bacteria 2818991464 2819704037 185
43 iso_pu_bacteria 2858688981 2858699890 185
44 iso_pu_bacteria 2917070673 2917072335 185
45 iso_pu_bacteria 2935353572 2935354499 185
46 iso_pu_bacteria 637000220 637318925 185
47 3300022467 Ga0224712_10116163 Ga0224712_101161632 186
48 3300053177 Ga0500636_0111537 Ga0500636_0111537_897_1463 186
49 3300031616 Ga0307508_10135619 Ga0307508_101356192 187
50 3300031730 Ga0307516_10085101 Ga0307516_100851011 187
51 3300033179 Ga0307507_10292047 Ga0307507_102920471 187
52 3300053123 Ga0500614_006403 Ga0500614_006403_75_644 187
53 3300053150 Ga0500603_031817 Ga0500603_031817_47_616 187
54 3300031238 Ga0265332_10009183 Ga0265332_100091833 188
55 3300031548 Ga0307408_100000581 Ga0307408_10000058121 188
56 3300031730 Ga0307516_10013033 Ga0307516_100130335 188
57 3300041505 Ga0451849_1304009 Ga0451849_1304009_256_846 188
58 3300042144 Ga0450889_016879 Ga0450889_016879_73_660 188
59 3300049661 Ga0501217_138119 Ga0501217_138119_110_691 188
60 3300003320 rootH2_10264734 rootH2_102647343 189
61 3300003794 Ga0055531_10000001 Ga0055531_10000001427 189
62 3300003794 Ga0055531_10000010 Ga0055531_1000001037 189
63 3300005289 Ga0065704_10148096 Ga0065704_101480961 189
64 3300005331 Ga0070670_100066352 Ga0070670_1000663523 189
65 3300005333 Ga0070677_10099475 Ga0070677_100994752 189
66 3300005355 Ga0070671_100352333 Ga0070671_1003523332 189
67 3300005364 Ga0070673_100096572 Ga0070673_1000965722 189
68 3300005367 Ga0070667_100622124 Ga0070667_1006221241 189
69 3300005456 Ga0070678_100570953 Ga0070678_1005709532 189
70 3300005471 Ga0070698_100700483 Ga0070698_1007004832 189
71 3300005518 Ga0070699_100411286 Ga0070699_1004112862 189
72 3300005539 Ga0068853_100031358 Ga0068853_1000313586 189
73 3300005543 Ga0070672_100012287 Ga0070672_1000122875 189
74 3300005563 Ga0068855_100000772 Ga0068855_10000077213 189
75 3300005577 Ga0068857_100136362 Ga0068857_1001363623 189
76 3300005614 Ga0068856_100960638 Ga0068856_1009606381 189
77 3300005616 Ga0068852_101051602 Ga0068852_1010516022 189
78 3300005834 Ga0068851_10116032 Ga0068851_101160322 189
79 3300006048 Ga0075363_100016581 Ga0075363_1000165812 189
80 3300006051 Ga0075364_10067152 Ga0075364_100671522 189
81 3300006177 Ga0075362_10289769 Ga0075362_102897692 189
82 3300006178 Ga0075367_10092870 Ga0075367_100928702 189
83 3300006237 Ga0097621_100218385 Ga0097621_1002183852 189
84 3300006353 Ga0075370_10004326 Ga0075370_100043265 189
85 3300006358 Ga0068871_100272239 Ga0068871_1002722392 189
86 3300009093 Ga0105240_10029247 Ga0105240_100292474 189
87 3300009148 Ga0105243_11120720 Ga0105243_111207202 189
88 3300009551 Ga0105238_10043338 Ga0105238_100433384 189
89 3300010375 Ga0105239_10229246 Ga0105239_102292462 189
90 3300013100 Ga0157373_10287222 Ga0157373_102872222 189
91 3300013296 Ga0157374_10752915 Ga0157374_107529152 189
92 3300013308 Ga0157375_10779508 Ga0157375_107795082 189
93 3300025298 Ga0209050_1012429 Ga0209050_10124293 189
94 3300025304 Ga0209257_1000033 Ga0209257_1000033516 189
95 3300025321 Ga0207656_10031198 Ga0207656_100311982 189
96 3300025893 Ga0207682_10139842 Ga0207682_101398422 189
97 3300025909 Ga0207705_10190921 Ga0207705_101909212 189
98 3300025910 Ga0207684_10011340 Ga0207684_100113402 189
99 3300025912 Ga0207707_10101572 Ga0207707_101015723 189
100 3300025913 Ga0207695_10074851 Ga0207695_100748513 189
101 3300025924 Ga0207694_10069938 Ga0207694_100699384 189
102 3300025925 Ga0207650_10005640 Ga0207650_100056403 189
103 3300025940 Ga0207691_10459993 Ga0207691_104599932 189
104 3300025949 Ga0207667_10007188 Ga0207667_100071882 189
105 3300025960 Ga0207651_10072200 Ga0207651_100722002 189
106 3300025981 Ga0207640_10464750 Ga0207640_104647501 189
107 3300025986 Ga0207658_10343286 Ga0207658_103432862 189
108 3300026041 Ga0207639_10031987 Ga0207639_100319875 189
109 3300026078 Ga0207702_11025750 Ga0207702_110257501 189
110 3300026121 Ga0207683_10477032 Ga0207683_104770322 189
111 3300031507 Ga0307509_10098288 Ga0307509_100982883 189
112 3300031616 Ga0307508_10001570 Ga0307508_1000157024 189
113 3300031730 Ga0307516_10066867 Ga0307516_100668673 189
114 3300031852 Ga0307410_10392871 Ga0307410_103928712 189
115 3300041407 Ga0439447_000230 Ga0439447_000230_1668_2258 189
116 3300041411 Ga0439466_0002200 Ga0439466_0002200_5915_6505 189
117 3300042003 Ga0439443_011956 Ga0439443_011956_649_1233 189
118 3300042013 Ga0439456_000027 Ga0439456_000027_7277_7870 189
119 3300042532 Ga0450893_0005353 Ga0450893_0005353_905_1489 189
120 3300044693 Ga0466961_0302813 Ga0466961_0302813_261_842 189
121 3300046452 Ga0495617_031375 Ga0495617_031375_570_1160 189
122 3300046463 Ga0495653_0158976 Ga0495653_0158976_475_1065 189
123 3300046473 Ga0495582_0004652 Ga0495582_0004652_6534_7124 189
124 3300046499 Ga0495594_0133472 Ga0495594_0133472_245_835 189
125 3300046516 Ga0495628_0301457 Ga0495628_0301457_136_726 189
126 3300046517 Ga0495630_0201584 Ga0495630_0201584_491_1081 189
127 3300046524 Ga0495648_0011151 Ga0495648_0011151_4350_4940 189
128 3300046524 Ga0495648_0088280 Ga0495648_0088280_572_1162 189
129 3300046525 Ga0495663_0002744 Ga0495663_0002744_1020_1607 189
130 3300046526 Ga0495666_0133077 Ga0495666_0133077_470_1060 189
131 3300046536 Ga0495587_0037895 Ga0495587_0037895_471_1061 189
132 3300046537 Ga0495598_0057316 Ga0495598_0057316_575_1162 189
133 3300046538 Ga0495609_0063326 Ga0495609_0063326_507_1097 189
134 3300046543 Ga0495645_0146251 Ga0495645_0146251_471_1061 189
135 3300046663 Ga0495635_0005882 Ga0495635_0005882_2617_3207 189
136 3300046664 Ga0495659_0199451 Ga0495659_0199451_31_618 189
137 3300046680 Ga0495646_0018341 Ga0495646_0018341_1764_2354 189
138 3300046684 Ga0495669_0382247 Ga0495669_0382247_31_618 189
139 3300046689 Ga0495613_0020167 Ga0495613_0020167_2558_3148 189
140 3300046691 Ga0495670_0022580 Ga0495670_0022580_1994_2584 189
141 3300046691 Ga0495670_0098243 Ga0495670_0098243_168_755 189
142 3300047317 Ga0495604_0228858 Ga0495604_0228858_76_666 189
143 3300047318 Ga0495636_0101842 Ga0495636_0101842_251_838 189
144 3300047320 Ga0495672_0064052 Ga0495672_0064052_525_1115 189
145 3300047322 Ga0495680_0007570 Ga0495680_0007570_7579_8169 189
146 3300047443 Ga0495687_000808 Ga0495687_000808_2679_3269 189
147 3300047444 Ga0495675_0000981 Ga0495675_0000981_3184_3774 189
148 3300047447 Ga0495685_074267 Ga0495685_074267_287_874 189
149 3300047469 Ga0495673_0042059 Ga0495673_0042059_732_1325 189
150 3300047469 Ga0495673_0086581 Ga0495673_0086581_299_889 189
151 3300047470 Ga0495681_0029055 Ga0495681_0029055_1536_2111 189
152 3300047470 Ga0495681_0187132 Ga0495681_0187132_198_785 189
153 3300047673 Ga0495593_0054930 Ga0495593_0054930_1019_1609 189
154 3300048089 Ga0495614_0278181 Ga0495614_0278181_25_615 189
155 3300048911 Ga0496108_0411356 Ga0496108_0411356_359_967 189
156 3300048912 Ga0496109_0339584 Ga0496109_0339584_675_1283 189
157 3300050496 nmdc:mga07m45_208457_c1 nmdc:mga07m45_208457_c1_221_802 189
158 3300050496 nmdc:mga07m45_9479_c1 nmdc:mga07m45_9479_c1_1553_2149 189
159 3300005353 Ga0070669_100062201 Ga0070669_1000622012 190
160 3300005355 Ga0070671_100740259 Ga0070671_1007402591 190
161 3300006844 Ga0075428_100117115 Ga0075428_1001171151 190
162 3300009094 Ga0111539_11012836 Ga0111539_110128361 190
163 3300009553 Ga0105249_10210400 Ga0105249_102104002 190
164 3300014326 Ga0157380_10014575 Ga0157380_100145753 190
165 3300014326 Ga0157380_10088710 Ga0157380_100887102 190
166 3300025923 Ga0207681_10118063 Ga0207681_101180632 190
167 3300025961 Ga0207712_10350348 Ga0207712_103503481 190
168 3300031824 Ga0307413_10194003 Ga0307413_101940032 190
169 3300031824 Ga0307413_10661234 Ga0307413_106612342 190
170 3300031852 Ga0307410_10121623 Ga0307410_101216232 190
171 3300031903 Ga0307407_10150570 Ga0307407_101505702 190
172 3300031995 Ga0307409_100520296 Ga0307409_1005202962 190
173 3300031995 Ga0307409_100663898 Ga0307409_1006638982 190
174 3300031995 Ga0307409_101112697 Ga0307409_1011126972 190
175 3300032004 Ga0307414_10166400 Ga0307414_101664002 190
176 3300032004 Ga0307414_10208739 Ga0307414_102087392 190
177 3300032005 Ga0307411_10058375 Ga0307411_100583752 190
178 3300046500 Ga0495596_0068518 Ga0495596_0068518_753_1343 190
179 3300046537 Ga0495598_0068527 Ga0495598_0068527_390_980 190
180 3300046539 Ga0495621_0023211 Ga0495621_0023211_1328_1918 190
181 3300046558 Ga0495633_0094501 Ga0495633_0094501_709_1299 190
182 3300046615 Ga0495656_0205594 Ga0495656_0205594_350_940 190
183 3300046664 Ga0495659_0059108 Ga0495659_0059108_385_975 190
184 3300047318 Ga0495636_0081171 Ga0495636_0081171_470_1060 190
185 3300048090 Ga0495615_0139713 Ga0495615_0139713_34_624 190
186 3300005530 Ga0070679_100773978 Ga0070679_1007739782 191
187 3300009101 Ga0105247_10001647 Ga0105247_100016476 191
188 3300013307 Ga0157372_10472449 Ga0157372_104724492 191
189 3300025900 Ga0207710_10000860 Ga0207710_100008605 191
190 3300025921 Ga0207652_10297840 Ga0207652_102978402 191
191 3300002774 JGI25150J39212_1000195 JGI25150J39212_100019518 192
192 3300003187 JGI25151J46595_10042355 JGI25151J46595_100423551 192
193 3300003215 JGI25153J46596_10000208 JGI25153J46596_1000020828 192
194 3300003773 Ga0055537_1006245 Ga0055537_10062453 192
195 3300003781 Ga0055536_1011468 Ga0055536_10114683 192
196 3300003792 Ga0055540_1001676 Ga0055540_10016763 192
197 3300004798 Ga0058859_10010417 Ga0058859_100104171 192
198 3300005330 Ga0070690_100008033 Ga0070690_1000080335 192
199 3300005331 Ga0070670_100122329 Ga0070670_1001223292 192
200 3300005340 Ga0070689_100119890 Ga0070689_1001198902 192
201 3300005347 Ga0070668_100045700 Ga0070668_1000457003 192
202 3300005347 Ga0070668_100278218 Ga0070668_1002782182 192
203 3300005353 Ga0070669_100331427 Ga0070669_1003314271 192
204 3300005355 Ga0070671_100252826 Ga0070671_1002528262 192
205 3300005356 Ga0070674_100494991 Ga0070674_1004949912 192
206 3300005365 Ga0070688_100388202 Ga0070688_1003882022 192
207 3300005366 Ga0070659_100123507 Ga0070659_1001235071 192
208 3300005367 Ga0070667_100313202 Ga0070667_1003132022 192
209 3300005406 Ga0070703_10068573 Ga0070703_100685732 192
210 3300005440 Ga0070705_100182399 Ga0070705_1001823992 192
211 3300005455 Ga0070663_100719599 Ga0070663_1007195992 192
212 3300005457 Ga0070662_100146080 Ga0070662_1001460802 192
213 3300005458 Ga0070681_10913025 Ga0070681_109130251 192
214 3300005459 Ga0068867_100069726 Ga0068867_1000697262 192
215 3300005543 Ga0070672_100053781 Ga0070672_1000537812 192
216 3300005545 Ga0070695_100053747 Ga0070695_1000537473 192
217 3300005546 Ga0070696_100075441 Ga0070696_1000754413 192
218 3300005617 Ga0068859_100237582 Ga0068859_1002375822 192
219 3300005618 Ga0068864_100507634 Ga0068864_1005076342 192
220 3300005719 Ga0068861_100011778 Ga0068861_1000117782 192
221 3300005841 Ga0068863_100005774 Ga0068863_1000057746 192
222 3300005844 Ga0068862_100048481 Ga0068862_1000484812 192
223 3300005844 Ga0068862_100407600 Ga0068862_1004076002 192
224 3300006028 Ga0070717_10041917 Ga0070717_100419175 192
225 3300006028 Ga0070717_10138764 Ga0070717_101387642 192
226 3300006358 Ga0068871_100841876 Ga0068871_1008418762 192
227 3300006881 Ga0068865_100690532 Ga0068865_1006905321 192
228 3300006931 Ga0097620_100237577 Ga0097620_1002375772 192
229 3300007788 Ga0099795_10000002 Ga0099795_1000000298 192
230 3300009098 Ga0105245_10186298 Ga0105245_101862981 192
231 3300009177 Ga0105248_11090342 Ga0105248_110903422 192
232 3300009551 Ga0105238_11441195 Ga0105238_114411951 192
233 3300009553 Ga0105249_10158555 Ga0105249_101585552 192
234 3300009553 Ga0105249_11171780 Ga0105249_111717802 192
235 3300010159 Ga0099796_10000004 Ga0099796_1000000435 192
236 3300014325 Ga0163163_11185022 Ga0163163_111850221 192
237 3300014326 Ga0157380_11125521 Ga0157380_111255211 192
238 3300014968 Ga0157379_11052081 Ga0157379_110520812 192
239 3300025245 Ga0207425_1000025 Ga0207425_100002527 192
240 3300025258 Ga0209129_1001489 Ga0209129_10014898 192
241 3300025263 Ga0209565_1000209 Ga0209565_100020914 192
242 3300025273 Ga0209673_1012397 Ga0209673_10123974 192
243 3300025292 Ga0209676_1003373 Ga0209676_10033732 192
244 3300025294 Ga0209025_1000630 Ga0209025_100063052 192
245 3300025295 Ga0209564_1000745 Ga0209564_100074534 192
246 3300025297 Ga0209758_1000002 Ga0209758_1000002111 192
247 3300025297 Ga0209758_1000108 Ga0209758_1000108106 192
248 3300025298 Ga0209050_1000001 Ga0209050_100000119 192
249 3300025298 Ga0209050_1019709 Ga0209050_10197092 192
250 3300025303 Ga0209051_1000699 Ga0209051_100069919 192
251 3300025304 Ga0209257_1016065 Ga0209257_10160652 192
252 3300025914 Ga0207671_10135067 Ga0207671_101350672 192
253 3300025922 Ga0207646_10285325 Ga0207646_102853252 192
254 3300025923 Ga0207681_10029693 Ga0207681_100296933 192
255 3300025925 Ga0207650_10043201 Ga0207650_100432013 192
256 3300025927 Ga0207687_10136720 Ga0207687_101367201 192
257 3300025931 Ga0207644_10104169 Ga0207644_101041692 192
258 3300025933 Ga0207706_10065877 Ga0207706_100658772 192
259 3300025936 Ga0207670_10320152 Ga0207670_103201522 192
260 3300025942 Ga0207689_10119268 Ga0207689_101192682 192
261 3300025961 Ga0207712_10105324 Ga0207712_101053242 192
262 3300025972 Ga0207668_10179794 Ga0207668_101797942 192
263 3300025986 Ga0207658_10332247 Ga0207658_103322472 192
264 3300025986 Ga0207658_10423083 Ga0207658_104230831 192
265 3300026088 Ga0207641_10030661 Ga0207641_100306613 192
266 3300026089 Ga0207648_10060997 Ga0207648_100609972 192
267 3300026118 Ga0207675_100102852 Ga0207675_1001028523 192
268 3300027512 Ga0209179_1000003 Ga0209179_100000354 192
269 3300027552 Ga0209982_1007185 Ga0209982_10071852 192
270 3300028794 Ga0307515_10022360 Ga0307515_100223607 192
271 3300028800 Ga0265338_10017848 Ga0265338_100178483 192
272 3300030745 Ga0316182_1101815 Ga0316182_11018152 192
273 3300031241 Ga0265325_10177670 Ga0265325_101776701 192
274 3300031507 Ga0307509_10212103 Ga0307509_102121032 192
275 3300031548 Ga0307408_100177453 Ga0307408_1001774532 192
276 3300031548 Ga0307408_100390172 Ga0307408_1003901721 192
277 3300031548 Ga0307408_101020310 Ga0307408_1010203101 192
278 3300031616 Ga0307508_10025419 Ga0307508_100254196 192
279 3300031649 Ga0307514_10011549 Ga0307514_100115494 192
280 3300031730 Ga0307516_10018121 Ga0307516_100181215 192
281 3300031731 Ga0307405_10149021 Ga0307405_101490212 192
282 3300031824 Ga0307413_10028268 Ga0307413_100282682 192
283 3300031824 Ga0307413_10139596 Ga0307413_101395961 192
284 3300031852 Ga0307410_10022894 Ga0307410_100228944 192
285 3300031852 Ga0307410_10053791 Ga0307410_100537912 192
286 3300031852 Ga0307410_10084024 Ga0307410_100840241 192
287 3300031903 Ga0307407_10042664 Ga0307407_100426642 192
288 3300031903 Ga0307407_10321064 Ga0307407_103210642 192
289 3300031911 Ga0307412_10074705 Ga0307412_100747052 192
290 3300031911 Ga0307412_10285099 Ga0307412_102850992 192
291 3300031995 Ga0307409_100068728 Ga0307409_1000687282 192
292 3300031995 Ga0307409_100159909 Ga0307409_1001599091 192
293 3300031995 Ga0307409_100219823 Ga0307409_1002198232 192
294 3300031995 Ga0307409_100544430 Ga0307409_1005444302 192
295 3300032002 Ga0307416_100185792 Ga0307416_1001857922 192
296 3300032002 Ga0307416_101159765 Ga0307416_1011597652 192
297 3300032004 Ga0307414_10000602 Ga0307414_1000060210 192
298 3300032004 Ga0307414_10007591 Ga0307414_100075913 192
299 3300032004 Ga0307414_10165456 Ga0307414_101654562 192
300 3300032004 Ga0307414_10312525 Ga0307414_103125252 192
301 3300032004 Ga0307414_10344484 Ga0307414_103444842 192
302 3300032004 Ga0307414_10649079 Ga0307414_106490792 192
303 3300032005 Ga0307411_10001709 Ga0307411_100017094 192
304 3300032005 Ga0307411_10009215 Ga0307411_100092152 192
305 3300032005 Ga0307411_10038136 Ga0307411_100381362 192
306 3300032005 Ga0307411_10077140 Ga0307411_100771401 192
307 3300032005 Ga0307411_10083736 Ga0307411_100837362 192
308 3300032005 Ga0307411_10092745 Ga0307411_100927452 192
309 3300032005 Ga0307411_10102572 Ga0307411_101025722 192
310 3300032005 Ga0307411_10220669 Ga0307411_102206692 192
311 3300032126 Ga0307415_100019734 Ga0307415_1000197343 192
312 3300032126 Ga0307415_100676622 Ga0307415_1006766222 192
313 3300032126 Ga0307415_101223819 Ga0307415_1012238192 192
314 3300035241 Ga0373961_0000105 Ga0373961_0000105_6417_7010 192
315 3300035398 Ga0316574_0028118 Ga0316574_0028118_2406_3002 192
316 3300036401 Ga0373937_0675750 Ga0373937_0675750_73_660 192
317 3300037471 Ga0395905_0092882 Ga0395905_0092882_1995_2585 192
318 3300037471 Ga0395905_0749554 Ga0395905_0749554_183_764 192
319 3300041452 Ga0451793_0625347 Ga0451793_0625347_462_1049 192
320 3300044712 Ga0453684_1331856 Ga0453684_1331856_14_607 192
321 3300044901 Ga0466960_0355449 Ga0466960_0355449_236_823 192
322 3300046499 Ga0495594_0239976 Ga0495594_0239976_66_650 192
323 3300046524 Ga0495648_0291750 Ga0495648_0291750_85_696 192
324 3300046691 Ga0495670_0033958 Ga0495670_0033958_51_641 192
325 3300046691 Ga0495670_0044031 Ga0495670_0044031_136_747 192
326 3300048924 Ga0496121_0000374 Ga0496121_0000374_76872_77465 192
327 3300049584 Ga0501068_0392682 Ga0501068_0392682_45_680 192
328 3300049585 Ga0501069_0000498 Ga0501069_0000498_17077_17712 192
329 3300049586 Ga0501070_0000026 Ga0501070_0000026_131077_131712 192
330 3300049587 Ga0501071_0005619 Ga0501071_0005619_2222_2857 192
331 3300049742 Ga0501080_0002679 Ga0501080_0002679_2914_3549 192
332 3300050496 nmdc:mga07m45_13804_c1 nmdc:mga07m45_13804_c1_2879_3475 192
333 3300050515 nmdc:mga0a205_380214_c1 nmdc:mga0a205_380214_c1_444_1034 192
334 3300050516 nmdc:mga0sz30_183988_c1 nmdc:mga0sz30_183988_c1_272_868 192
335 3300053093 Ga0500651_0055194 Ga0500651_0055194_1003_1593 192
336 3300053119 Ga0500595_000943 Ga0500595_000943_6320_6913 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

59

154

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly3.cif.gz_D x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8191 32 182
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.8182 32 182
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.8005 32 182
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.7962 32 182
6npa-assembly4.cif.gz_D x-ray crystal structure of tmpb, (r)-1-hydroxy-2-trimethylaminoethylphosphonate oxygenase, with (r)-1-hydroxy-2-trimethylaminoethylphosphonate 0.7887 32 182
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7803 31 182 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6641 31 182 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.618 26 186 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5259 26 186 1.10.3210.10
af_A0A1D6IZ35_686_847_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4062 68 149 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2A5EKD9-F1-model_v4 Phosphohydrolase 0.9955 7 189 GO:0016787
AF-A0A7C7Y4W0-F1-model_v4 HD domain-containing protein 0.9952 6 182
AF-A0A7Y1TB96-F1-model_v4 HD domain-containing protein 0.9951 13 180
AF-A0A2U0VKN6-F1-model_v4 deleted 0.9941 1 192
AF-A0A2D8EL55-F1-model_v4 Phosphohydrolase 0.9934 4 191 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.64 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map