F412728

General Info

Members Datasets Scaffolds Average Seq Length
336 232 672 344

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10006369|Ga0265338_100063692
Length 378
Sequence MTLRLPLVLSSFMLSRWRWWNRATQDSRHFDNQTGNLMKALVKKERKAGLWLEDVPKPQVGINDVLIQVDRTGICGTDLHIYKWDDWAQRTIPVPMVVGHEFVGEVAEVGSNVTDFFPGEVVSAEGHVVCGRCRNCLAGRRHLCKDTQGIGVNRPGAFAEYISVPMTNVWHHRPDIDRDVAAIFDPFGNAVHTALSFPLLGEDVLITGAGPIGIMAAAVVKHAGARFVVVTDINEDRLELAKKMGATVALNVAKGSLSDVQKQLGMREGFDVGLEMSGSPAALRSMIDNMAHGGKIAMLGIPAEQAPFDWNKVVFGMLTIKGIYGREMYETWYKMTVMLETGLDIKPAITHRFHYTEFEKGFAAMMSGKSGKVILNWR

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
124 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
125 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
227 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
228 2643221591 Devosia sp. Root685 Isolate Unclassified
229 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
230 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
231 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
232 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 0
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0.89
Rhizoplane 7.74
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10006369 3300028800 Bacteria 15068
2 Ga0070658_10001385 3300005327 Bacteria 20720
3 Ga0070690_100041301 3300005330 Bacteria 2920
4 Ga0070690_100172535 3300005330 Bacteria 1489
5 Ga0070690_100264980 3300005330 Bacteria 1220
6 Ga0068869_100049605 3300005334 Bacteria 3039
7 Ga0068869_100205335 3300005334 Bacteria 1555
8 Ga0070666_10022063 3300005335 Bacteria 4131
9 Ga0068868_100146145 3300005338 Bacteria 1944
10 Ga0070689_100002029 3300005340 Bacteria 13133
11 Ga0070689_100135238 3300005340 Bacteria 1979
12 Ga0070687_100043930 3300005343 Bacteria 2274
13 Ga0070692_10034896 3300005345 Bacteria 2544
14 Ga0070671_100085649 3300005355 Bacteria 2636
15 Ga0070673_100051425 3300005364 Bacteria 3227
16 Ga0070673_100182520 3300005364 Bacteria 1797
17 Ga0070667_100027761 3300005367 Bacteria 4710
18 Ga0070713_100072610 3300005436 Bacteria 2911
19 Ga0070700_100097413 3300005441 Bacteria 1931
20 Ga0070708_100002039 3300005445 Bacteria 15552
21 Ga0070708_100140898 3300005445 Bacteria 2236
22 Ga0070678_100010722 3300005456 Bacteria 5613
23 Ga0070662_100137698 3300005457 Bacteria 1889
24 Ga0068867_100133050 3300005459 Bacteria 1935
25 Ga0070706_100002573 3300005467 Bacteria 18233
26 Ga0070706_100419838 3300005467 Bacteria 1245
27 Ga0070707_100002692 3300005468 Bacteria 16892
28 Ga0070707_100028014 3300005468 Bacteria 5358
29 Ga0070707_100049492 3300005468 Bacteria 4029
30 Ga0070679_100060787 3300005530 Bacteria 3765
31 Ga0070684_100040300 3300005535 Bacteria 4021
32 Ga0068853_100032352 3300005539 Bacteria 4430
33 Ga0070686_100000501 3300005544 Bacteria 23585
34 Ga0070696_100022163 3300005546 Bacteria 4314
35 Ga0070704_100105682 3300005549 Bacteria 2132
36 Ga0068855_100001570 3300005563 Bacteria 28673
37 Ga0070664_100125614 3300005564 Bacteria 2250
38 Ga0068856_100000571 3300005614 Bacteria 40367
39 Ga0068863_100008914 3300005841 Bacteria 9794
40 Ga0068863_100011442 3300005841 Bacteria 8581
41 Ga0068863_100141543 3300005841 Bacteria 2299
42 Ga0068858_100241795 3300005842 Bacteria 1713
43 Ga0075363_100013447 3300006048 Bacteria 3969
44 Ga0070716_100183668 3300006173 Bacteria 1375
45 Ga0097621_100000229 3300006237 Bacteria 37450
46 Ga0097621_100044352 3300006237 Bacteria 3587
47 Ga0097621_100072370 3300006237 Bacteria 2851
48 Ga0068871_100000071 3300006358 Bacteria 57255
49 Ga0068871_100275656 3300006358 Bacteria 1470
50 Ga0075428_100017297 3300006844 Bacteria 7969
51 Ga0075428_100410093 3300006844 Bacteria 1452
52 Ga0075430_100204516 3300006846 Bacteria 1639
53 Ga0075431_100048793 3300006847 Bacteria 4366
54 Ga0075434_100184293 3300006871 Bacteria 2108
55 Ga0075429_100120577 3300006880 Bacteria 2292
56 Ga0068865_100025013 3300006881 Bacteria 3923
57 Ga0068865_100035373 3300006881 Bacteria 3358
58 Ga0105244_10002611 3300009036 Bacteria 13502
59 Ga0105240_10008746 3300009093 Bacteria 14435
60 Ga0105240_10062453 3300009093 Bacteria 4638
61 Ga0105240_10144750 3300009093 Bacteria 2837
62 Ga0105240_10298292 3300009093 Bacteria 1844
63 Ga0111539_10078632 3300009094 Bacteria 3880
64 Ga0111539_10228912 3300009094 Bacteria 2165
65 Ga0111539_10303621 3300009094 Bacteria 1858
66 Ga0111539_10434477 3300009094 Bacteria 1529
67 Ga0105245_10099046 3300009098 Bacteria 2694
68 Ga0105245_10202507 3300009098 Bacteria 1906
69 Ga0105245_10513031 3300009098 Bacteria 1216
70 Ga0105243_10014569 3300009148 Bacteria 5949
71 Ga0105243_10403177 3300009148 Bacteria 1271
72 Ga0105242_10014329 3300009176 Bacteria 6141
73 Ga0105242_10109032 3300009176 Bacteria 2357
74 Ga0105242_10396185 3300009176 Bacteria 1287
75 Ga0105248_10326077 3300009177 Bacteria 1730
76 Ga0105239_10222194 3300010375 Bacteria 2118
77 Ga0105246_10010717 3300011119 Bacteria 5679
78 Ga0157371_10000225 3300013102 Bacteria 82635
79 Ga0157371_10071956 3300013102 Bacteria 2448
80 Ga0157371_10203662 3300013102 Bacteria 1419
81 Ga0157370_10039336 3300013104 Bacteria 4570
82 Ga0157374_10002559 3300013296 Bacteria 15345
83 Ga0157374_10068589 3300013296 Bacteria 3337
84 Ga0157374_10119195 3300013296 Bacteria 2545
85 Ga0157378_10003630 3300013297 Bacteria 13653
86 Ga0157378_10005107 3300013297 Bacteria 11523
87 Ga0157372_10002160 3300013307 Bacteria 21394
88 Ga0157372_10031633 3300013307 Bacteria 5794
89 Ga0157372_10040609 3300013307 Bacteria 5139
90 Ga0157375_10000027 3300013308 Bacteria 220909
91 Ga0157375_10121587 3300013308 Bacteria 2721
92 Ga0157375_10330901 3300013308 Bacteria 1688
93 Ga0163163_10007093 3300014325 Bacteria 9853
94 Ga0163163_10007530 3300014325 Bacteria 9612
95 Ga0163163_10173712 3300014325 Bacteria 2201
96 Ga0157380_10286985 3300014326 Bacteria 1509
97 Ga0157377_10111576 3300014745 Bacteria 1644
98 Ga0157379_10012339 3300014968 Bacteria 7465
99 Ga0157376_10015311 3300014969 Bacteria 5791
100 Ga0207655_1000178 3300025728 Bacteria 113749
101 Ga0207680_10033793 3300025903 Bacteria 2921
102 Ga0207685_10007648 3300025905 Bacteria 3025
103 Ga0207705_10016419 3300025909 Bacteria 5307
104 Ga0207684_10002573 3300025910 Bacteria 18206
105 Ga0207695_10008807 3300025913 Bacteria 12571
106 Ga0207695_10314063 3300025913 Bacteria 1457
107 Ga0207693_10008878 3300025915 Bacteria 8211
108 Ga0207663_10139557 3300025916 Bacteria 1686
109 Ga0207652_10317417 3300025921 Bacteria 1407
110 Ga0207646_10006179 3300025922 Bacteria 12451
111 Ga0207646_10025084 3300025922 Bacteria 5457
112 Ga0207687_10073979 3300025927 Bacteria 2441
113 Ga0207700_10061367 3300025928 Bacteria 2851
114 Ga0207664_10092931 3300025929 Bacteria 2477
115 Ga0207690_10030786 3300025932 Bacteria 3426
116 Ga0207686_10006345 3300025934 Bacteria 6362
117 Ga0207709_10003051 3300025935 Bacteria 10145
118 Ga0207709_10066771 3300025935 Bacteria 2267
119 Ga0207670_10012083 3300025936 Bacteria 5036
120 Ga0207670_10034024 3300025936 Bacteria 3289
121 Ga0207670_10215080 3300025936 Bacteria 1468
122 Ga0207704_10013553 3300025938 Bacteria 4084
123 Ga0207704_10032986 3300025938 Bacteria 2939
124 Ga0207711_10199915 3300025941 Bacteria 1823
125 Ga0207667_10000827 3300025949 Bacteria 39994
126 Ga0207651_10020394 3300025960 Bacteria 4000
127 Ga0207651_10153183 3300025960 Bacteria 1797
128 Ga0207658_10006292 3300025986 Bacteria 8109
129 Ga0207658_10153918 3300025986 Bacteria 1877
130 Ga0207677_10029293 3300026023 Bacteria 3496
131 Ga0207677_10080499 3300026023 Bacteria 2334
132 Ga0207703_10038124 3300026035 Bacteria 3833
133 Ga0207639_10139368 3300026041 Bacteria 2019
134 Ga0207708_10037313 3300026075 Bacteria 3702
135 Ga0207702_10000612 3300026078 Bacteria 39396
136 Ga0207702_10306392 3300026078 Bacteria 1509
137 Ga0207641_10006495 3300026088 Bacteria 9847
138 Ga0207648_10001496 3300026089 Bacteria 25748
139 Ga0207676_10126260 3300026095 Bacteria 2167
140 Ga0207683_10014252 3300026121 Bacteria 6773
141 Ga0207683_10115052 3300026121 Bacteria 2411
142 Ga0265338_10000463 3300028800 Bacteria 72298
143 Ga0265338_10001683 3300028800 Bacteria 35130
144 Ga0265338_10022227 3300028800 Bacteria 6575
145 Ga0265338_10027257 3300028800 Bacteria 5736
146 Ga0265324_10010624 3300029957 Bacteria 3539
147 Ga0265324_10027176 3300029957 Bacteria 2021
148 Ga0265330_10004077 3300031235 Bacteria 7493
149 Ga0265320_10001528 3300031240 Bacteria 16786
150 Ga0265325_10003237 3300031241 Bacteria 10718
151 Ga0265325_10016667 3300031241 Bacteria 4103
152 Ga0265339_10002265 3300031249 Bacteria 13891
153 Ga0265327_10001447 3300031251 Bacteria 29880
154 Ga0265316_10192512 3300031344 Bacteria 1514
155 Ga0307508_10194291 3300031616 Bacteria 1631
156 Ga0316575_10021200 3300031665 Bacteria 2499
157 Ga0265342_10004559 3300031712 Bacteria 10838
158 Ga0316576_10003692 3300031727 Bacteria 9034
159 Ga0307413_10031790 3300031824 Bacteria 2983
160 Ga0307414_10156610 3300032004 Bacteria 1804
161 Ga0316583_10006320 3300032133 Bacteria 4255
162 Ga0316580_10004105 3300032139 Bacteria 4198
163 Ga0373926_0000214 3300035083 Bacteria 13559
164 Ga0373944_0000084 3300035089 Bacteria 16188
165 Ga0373936_0000266 3300035113 Bacteria 17214
166 Ga0373946_0000224 3300035171 Bacteria 17692
167 Ga0316574_0020935 3300035398 Bacteria 3876
168 Ga0373924_0004966 3300035410 Bacteria 4682
169 Ga0373935_0002098 3300035692 Bacteria 11320
170 Ga0373935_0008733 3300035692 Bacteria 6071
171 Ga0373935_0103199 3300035692 Bacteria 1883
172 Ga0373927_0005844 3300035695 Bacteria 8436
173 Ga0373947_0023472 3300035725 Bacteria 3588
174 Ga0373937_0062674 3300036401 Bacteria 3419
175 Ga0316582_0028472 3300036647 Unclassified 3385
176 Ga0316584_0035514 3300036712 Bacteria 3699
177 Ga0373925_0043199 3300037068 Bacteria 3345
178 Ga0373925_0120363 3300037068 Bacteria 2037
179 Ga0373925_0188516 3300037068 Bacteria 1636
180 Ga0395905_0276521 3300037471 Bacteria 1565
181 Ga0436364_1119825 3300037853 Bacteria 3416
182 Ga0400483_253509 3300039062 Bacteria 1732
183 Ga0451855_1616634 3300041511 Bacteria 2071
184 Ga0439441_005985 3300042001 Bacteria 1911
185 Ga0451577_0134911 3300042876 Bacteria 2216
186 Ga0453683_0002913 3300044673 Bacteria 12928
187 Ga0453684_0039990 3300044712 Bacteria 6377
188 Ga0453684_0216018 3300044712 Bacteria 2225
189 Ga0453684_0647576 3300044712 Bacteria 1153
190 Ga0451576_0016773 3300045051 Bacteria 8075
191 Ga0451576_0072256 3300045051 Bacteria 3591
192 Ga0451576_0276782 3300045051 Bacteria 1755
193 Ga0466967_0115117 3300045976 Bacteria 2476
194 Ga0495592_0000231 3300046454 Bacteria 48322
195 Ga0495603_0130336 3300046455 Bacteria 1465
196 Ga0495629_0006999 3300046459 Bacteria 8308
197 Ga0495629_0157260 3300046459 Bacteria 1579
198 Ga0495641_0007131 3300046461 Bacteria 7065
199 Ga0495582_0012523 3300046473 Bacteria 4675
200 Ga0495582_0020309 3300046473 Bacteria 3635
201 Ga0495605_0042809 3300046474 Bacteria 2248
202 Ga0495639_0003133 3300046475 Bacteria 7187
203 Ga0495662_0000878 3300046476 Bacteria 14688
204 Ga0495585_0022201 3300046492 Bacteria 3644
205 Ga0495594_0002233 3300046499 Bacteria 10078
206 Ga0495607_0062419 3300046501 Bacteria 2112
207 Ga0495628_0000634 3300046516 Bacteria 32129
208 Ga0495630_0000191 3300046517 Bacteria 47951
209 Ga0495630_0004118 3300046517 Bacteria 10185
210 Ga0495630_0004986 3300046517 Bacteria 9340
211 Ga0495630_0008754 3300046517 Bacteria 7269
212 Ga0495631_0073974 3300046518 Bacteria 1471
213 Ga0495643_0000370 3300046522 Bacteria 61012
214 Ga0495644_0018230 3300046523 Bacteria 2681
215 Ga0495644_0047304 3300046523 Bacteria 1616
216 Ga0495663_0027788 3300046525 Bacteria 1662
217 Ga0495666_0000761 3300046526 Bacteria 14846
218 Ga0495666_0015912 3300046526 Bacteria 3746
219 Ga0495666_0086454 3300046526 Bacteria 1481
220 Ga0495642_0051909 3300046528 Bacteria 1688
221 Ga0495665_0002648 3300046531 Bacteria 9660
222 Ga0495640_0001711 3300046533 Bacteria 17385
223 Ga0495586_0000113 3300046535 Bacteria 48115
224 Ga0495586_0000978 3300046535 Bacteria 16176
225 Ga0495586_0025851 3300046535 Bacteria 3141
226 Ga0495609_0053599 3300046538 Bacteria 1793
227 Ga0495621_0008487 3300046539 Bacteria 3085
228 Ga0495645_0092447 3300046543 Bacteria 2160
229 Ga0495667_0115154 3300046559 Bacteria 1737
230 Ga0495656_0203604 3300046615 Bacteria 983
231 Ga0495634_0003404 3300046642 Bacteria 12775
232 Ga0495634_0007006 3300046642 Bacteria 8505
233 Ga0495634_0060705 3300046642 Bacteria 2515
234 Ga0495635_0000642 3300046663 Bacteria 22421
235 Ga0495588_0000493 3300046674 Bacteria 19356
236 Ga0495647_0000862 3300046681 Bacteria 9072
237 Ga0495658_0000770 3300046683 Bacteria 17325
238 Ga0495658_0029317 3300046683 Bacteria 2978
239 Ga0495658_0032732 3300046683 Bacteria 2841
240 Ga0495658_0069770 3300046683 Bacteria 2038
241 Ga0495613_0002760 3300046689 Bacteria 13194
242 Ga0495613_0049331 3300046689 Bacteria 3107
243 Ga0495624_0000962 3300046690 Bacteria 22727
244 Ga0495624_0052604 3300046690 Bacteria 2573
245 Ga0495670_0038616 3300046691 Bacteria 2381
246 Ga0495671_0136268 3300046692 Bacteria 1197
247 Ga0495581_0034425 3300047315 Bacteria 2931
248 Ga0495674_0000804 3300047319 Bacteria 29853
249 Ga0495674_0003010 3300047319 Bacteria 16424
250 Ga0495676_0006187 3300047321 Bacteria 11005
251 Ga0495680_0002843 3300047322 Bacteria 17399
252 Ga0495593_0002042 3300047673 Bacteria 12040
253 Ga0496100_0019201 3300048903 Bacteria 4072
254 Ga0496100_0123473 3300048903 Bacteria 1815
255 Ga0496101_0003850 3300048904 Bacteria 9382
256 Ga0496101_0068214 3300048904 Bacteria 2600
257 Ga0496102_0053717 3300048905 Bacteria 3672
258 Ga0496102_0150984 3300048905 Bacteria 2183
259 Ga0496103_0062166 3300048906 Bacteria 2324
260 Ga0496104_0039312 3300048907 Bacteria 4429
261 Ga0496104_0116532 3300048907 Bacteria 2564
262 Ga0496105_0011213 3300048908 Bacteria 7072
263 Ga0496106_0038021 3300048909 Bacteria 3600
264 Ga0496107_0001347 3300048910 Bacteria 15096
265 Ga0496108_0033793 3300048911 Bacteria 4247
266 Ga0496108_0162713 3300048911 Bacteria 1929
267 Ga0496108_0208207 3300048911 Bacteria 1697
268 Ga0496109_0003073 3300048912 Bacteria 13920
269 Ga0496109_0003504 3300048912 Bacteria 13107
270 Ga0496109_0193822 3300048912 Bacteria 1909
271 Ga0496110_0058179 3300048913 Bacteria 3404
272 Ga0496110_0354019 3300048913 Bacteria 1337
273 Ga0496111_0023256 3300048914 Bacteria 4350
274 Ga0496111_0072093 3300048914 Bacteria 2514
275 Ga0496111_0312907 3300048914 Bacteria 1163
276 Ga0496112_0064796 3300048915 Bacteria 3606
277 Ga0496112_0370681 3300048915 Bacteria 1373
278 Ga0496113_0009460 3300048916 Bacteria 6393
279 Ga0496116_0004900 3300048919 Bacteria 12620
280 Ga0496116_0102764 3300048919 Bacteria 1703
281 Ga0496117_0082918 3300048920 Bacteria 2098
282 Ga0496118_0010656 3300048921 Bacteria 9069
283 Ga0496118_0171713 3300048921 Bacteria 1323
284 Ga0496119_0002336 3300048922 Bacteria 20880
285 Ga0496120_0000314 3300048923 Bacteria 80307
286 Ga0496125_0000180 3300048928 Bacteria 138952
287 Ga0496126_0006849 3300048929 Bacteria 12634
288 Ga0501032_0000480 3300049569 Bacteria 32309
289 Ga0501032_0031284 3300049569 Bacteria 3649
290 Ga0501033_0004726 3300049570 Bacteria 10897
291 Ga0501033_0051708 3300049570 Bacteria 3046
292 Ga0501034_0000349 3300049571 Bacteria 79675
293 Ga0501034_0011423 3300049571 Bacteria 9202
294 Ga0501034_0032230 3300049571 Bacteria 5324
295 Ga0501036_0009824 3300049572 Bacteria 7879
296 Ga0501037_0004336 3300049573 Bacteria 10298
297 Ga0501038_0000768 3300049574 Bacteria 28502
298 Ga0501047_0350651 3300049581 Bacteria 1313
299 Ga0501048_0003403 3300049582 Bacteria 12091
300 Ga0501067_0053541 3300049583 Bacteria 2236
301 Ga0501069_0001959 3300049585 Bacteria 10282
302 Ga0501070_0005030 3300049586 Bacteria 11278
303 Ga0501073_0035834 3300049589 Bacteria 3525
304 Ga0501074_0003283 3300049590 Bacteria 11437
305 Ga0501075_0302977 3300049591 Bacteria 1218
306 Ga0501080_0005299 3300049742 Bacteria 11489
307 Ga0501083_0022476 3300049744 Bacteria 4376
308 Ga0501035_0009358 3300049822 Bacteria 9106
309 Ga0501035_0038163 3300049822 Bacteria 4349
310 Ga0501035_0169281 3300049822 Bacteria 1888
311 Ga0501044_0010053 3300049823 Bacteria 10282
312 Ga0501044_0036718 3300049823 Bacteria 5124
313 nmdc:mga03n38_2284_c1 3300050490 Bacteria 5871
314 nmdc:mga00v17_219754_c1 3300050491 Bacteria 1230
315 nmdc:mga0yw44_111760_c1 3300050492 Bacteria 1752
316 nmdc:mga04h51_24131_c1 3300050495 Bacteria 1859
317 nmdc:mga05p37_60336_c1 3300050507 Bacteria 4670
318 nmdc:mga09592_127580_c1 3300050508 Bacteria 2187
319 nmdc:mga09592_84578_c1 3300050508 Bacteria 2705
320 nmdc:mga06r32_113512_c1 3300050510 Bacteria 2667
321 nmdc:mga08y16_453557_c1 3300050511 Bacteria 1307
322 nmdc:mga08y16_94283_c1 3300050511 Bacteria 3118
323 nmdc:mga0n895_191264_c1 3300050512 Bacteria 2077
324 Ga0495612_0000450 3300053078 Bacteria 16446
325 Ga0495619_0003826 3300053085 Bacteria 9690
326 Ga0500555_048164 3300053103 Bacteria 1172
327 Ga0501084_0007047 3300054114 Bacteria 9268
328 Ga0590071_009866 3300059421 Bacteria 2238
329 Ga0590074_003935 3300059423 Bacteria 2457
330 2524003128 2523533628 Bacteria 4098242
331 2585993180 2585427633 Bacteria 6413184
332 2643963010 2643221591 Bacteria 4397626
333 2687234123 2684623219 Bacteria 8442773
334 2688393702 2687453341 Bacteria 6534136
335 2964629268 2964628898 Bacteria 7083044
336 2967741305 2967735183 Bacteria 6827012
337 Ga0265338_10006369
338 Ga0070658_10001385
339 Ga0070690_100041301
340 Ga0070690_100172535
341 Ga0070690_100264980
342 Ga0068869_100049605
343 Ga0068869_100205335
344 Ga0070666_10022063
345 Ga0068868_100146145
346 Ga0070689_100002029
347 Ga0070689_100135238
348 Ga0070687_100043930
349 Ga0070692_10034896
350 Ga0070671_100085649
351 Ga0070673_100051425
352 Ga0070673_100182520
353 Ga0070667_100027761
354 Ga0070713_100072610
355 Ga0070700_100097413
356 Ga0070708_100002039
357 Ga0070708_100140898
358 Ga0070678_100010722
359 Ga0070662_100137698
360 Ga0068867_100133050
361 Ga0070706_100002573
362 Ga0070706_100419838
363 Ga0070707_100002692
364 Ga0070707_100028014
365 Ga0070707_100049492
366 Ga0070679_100060787
367 Ga0070684_100040300
368 Ga0068853_100032352
369 Ga0070686_100000501
370 Ga0070696_100022163
371 Ga0070704_100105682
372 Ga0068855_100001570
373 Ga0070664_100125614
374 Ga0068856_100000571
375 Ga0068863_100008914
376 Ga0068863_100011442
377 Ga0068863_100141543
378 Ga0068858_100241795
379 Ga0075363_100013447
380 Ga0070716_100183668
381 Ga0097621_100000229
382 Ga0097621_100044352
383 Ga0097621_100072370
384 Ga0068871_100000071
385 Ga0068871_100275656
386 Ga0075428_100017297
387 Ga0075428_100410093
388 Ga0075430_100204516
389 Ga0075431_100048793
390 Ga0075434_100184293
391 Ga0075429_100120577
392 Ga0068865_100025013
393 Ga0068865_100035373
394 Ga0105244_10002611
395 Ga0105240_10008746
396 Ga0105240_10062453
397 Ga0105240_10144750
398 Ga0105240_10298292
399 Ga0111539_10078632
400 Ga0111539_10228912
401 Ga0111539_10303621
402 Ga0111539_10434477
403 Ga0105245_10099046
404 Ga0105245_10202507
405 Ga0105245_10513031
406 Ga0105243_10014569
407 Ga0105243_10403177
408 Ga0105242_10014329
409 Ga0105242_10109032
410 Ga0105242_10396185
411 Ga0105248_10326077
412 Ga0105239_10222194
413 Ga0105246_10010717
414 Ga0157371_10000225
415 Ga0157371_10071956
416 Ga0157371_10203662
417 Ga0157370_10039336
418 Ga0157374_10002559
419 Ga0157374_10068589
420 Ga0157374_10119195
421 Ga0157378_10003630
422 Ga0157378_10005107
423 Ga0157372_10002160
424 Ga0157372_10031633
425 Ga0157372_10040609
426 Ga0157375_10000027
427 Ga0157375_10121587
428 Ga0157375_10330901
429 Ga0163163_10007093
430 Ga0163163_10007530
431 Ga0163163_10173712
432 Ga0157380_10286985
433 Ga0157377_10111576
434 Ga0157379_10012339
435 Ga0157376_10015311
436 Ga0207655_1000178
437 Ga0207680_10033793
438 Ga0207685_10007648
439 Ga0207705_10016419
440 Ga0207684_10002573
441 Ga0207695_10008807
442 Ga0207695_10314063
443 Ga0207693_10008878
444 Ga0207663_10139557
445 Ga0207652_10317417
446 Ga0207646_10006179
447 Ga0207646_10025084
448 Ga0207687_10073979
449 Ga0207700_10061367
450 Ga0207664_10092931
451 Ga0207690_10030786
452 Ga0207686_10006345
453 Ga0207709_10003051
454 Ga0207709_10066771
455 Ga0207670_10012083
456 Ga0207670_10034024
457 Ga0207670_10215080
458 Ga0207704_10013553
459 Ga0207704_10032986
460 Ga0207711_10199915
461 Ga0207667_10000827
462 Ga0207651_10020394
463 Ga0207651_10153183
464 Ga0207658_10006292
465 Ga0207658_10153918
466 Ga0207677_10029293
467 Ga0207677_10080499
468 Ga0207703_10038124
469 Ga0207639_10139368
470 Ga0207708_10037313
471 Ga0207702_10000612
472 Ga0207702_10306392
473 Ga0207641_10006495
474 Ga0207648_10001496
475 Ga0207676_10126260
476 Ga0207683_10014252
477 Ga0207683_10115052
478 Ga0265338_10000463
479 Ga0265338_10001683
480 Ga0265338_10022227
481 Ga0265338_10027257
482 Ga0265324_10010624
483 Ga0265324_10027176
484 Ga0265330_10004077
485 Ga0265320_10001528
486 Ga0265325_10003237
487 Ga0265325_10016667
488 Ga0265339_10002265
489 Ga0265327_10001447
490 Ga0265316_10192512
491 Ga0307508_10194291
492 Ga0316575_10021200
493 Ga0265342_10004559
494 Ga0316576_10003692
495 Ga0307413_10031790
496 Ga0307414_10156610
497 Ga0316583_10006320
498 Ga0316580_10004105
499 Ga0373926_0000214
500 Ga0373944_0000084
501 Ga0373936_0000266
502 Ga0373946_0000224
503 Ga0316574_0020935
504 Ga0373924_0004966
505 Ga0373935_0002098
506 Ga0373935_0008733
507 Ga0373935_0103199
508 Ga0373927_0005844
509 Ga0373947_0023472
510 Ga0373937_0062674
511 Ga0316582_0028472
512 Ga0316584_0035514
513 Ga0373925_0043199
514 Ga0373925_0120363
515 Ga0373925_0188516
516 Ga0395905_0276521
517 Ga0436364_1119825
518 Ga0400483_253509
519 Ga0451855_1616634
520 Ga0439441_005985
521 Ga0451577_0134911
522 Ga0453683_0002913
523 Ga0453684_0039990
524 Ga0453684_0216018
525 Ga0453684_0647576
526 Ga0451576_0016773
527 Ga0451576_0072256
528 Ga0451576_0276782
529 Ga0466967_0115117
530 Ga0495592_0000231
531 Ga0495603_0130336
532 Ga0495629_0006999
533 Ga0495629_0157260
534 Ga0495641_0007131
535 Ga0495582_0012523
536 Ga0495582_0020309
537 Ga0495605_0042809
538 Ga0495639_0003133
539 Ga0495662_0000878
540 Ga0495585_0022201
541 Ga0495594_0002233
542 Ga0495607_0062419
543 Ga0495628_0000634
544 Ga0495630_0000191
545 Ga0495630_0004118
546 Ga0495630_0004986
547 Ga0495630_0008754
548 Ga0495631_0073974
549 Ga0495643_0000370
550 Ga0495644_0018230
551 Ga0495644_0047304
552 Ga0495663_0027788
553 Ga0495666_0000761
554 Ga0495666_0015912
555 Ga0495666_0086454
556 Ga0495642_0051909
557 Ga0495665_0002648
558 Ga0495640_0001711
559 Ga0495586_0000113
560 Ga0495586_0000978
561 Ga0495586_0025851
562 Ga0495609_0053599
563 Ga0495621_0008487
564 Ga0495645_0092447
565 Ga0495667_0115154
566 Ga0495656_0203604
567 Ga0495634_0003404
568 Ga0495634_0007006
569 Ga0495634_0060705
570 Ga0495635_0000642
571 Ga0495588_0000493
572 Ga0495647_0000862
573 Ga0495658_0000770
574 Ga0495658_0029317
575 Ga0495658_0032732
576 Ga0495658_0069770
577 Ga0495613_0002760
578 Ga0495613_0049331
579 Ga0495624_0000962
580 Ga0495624_0052604
581 Ga0495670_0038616
582 Ga0495671_0136268
583 Ga0495581_0034425
584 Ga0495674_0000804
585 Ga0495674_0003010
586 Ga0495676_0006187
587 Ga0495680_0002843
588 Ga0495593_0002042
589 Ga0496100_0019201
590 Ga0496100_0123473
591 Ga0496101_0003850
592 Ga0496101_0068214
593 Ga0496102_0053717
594 Ga0496102_0150984
595 Ga0496103_0062166
596 Ga0496104_0039312
597 Ga0496104_0116532
598 Ga0496105_0011213
599 Ga0496106_0038021
600 Ga0496107_0001347
601 Ga0496108_0033793
602 Ga0496108_0162713
603 Ga0496108_0208207
604 Ga0496109_0003073
605 Ga0496109_0003504
606 Ga0496109_0193822
607 Ga0496110_0058179
608 Ga0496110_0354019
609 Ga0496111_0023256
610 Ga0496111_0072093
611 Ga0496111_0312907
612 Ga0496112_0064796
613 Ga0496112_0370681
614 Ga0496113_0009460
615 Ga0496116_0004900
616 Ga0496116_0102764
617 Ga0496117_0082918
618 Ga0496118_0010656
619 Ga0496118_0171713
620 Ga0496119_0002336
621 Ga0496120_0000314
622 Ga0496125_0000180
623 Ga0496126_0006849
624 Ga0501032_0000480
625 Ga0501032_0031284
626 Ga0501033_0004726
627 Ga0501033_0051708
628 Ga0501034_0000349
629 Ga0501034_0011423
630 Ga0501034_0032230
631 Ga0501036_0009824
632 Ga0501037_0004336
633 Ga0501038_0000768
634 Ga0501047_0350651
635 Ga0501048_0003403
636 Ga0501067_0053541
637 Ga0501069_0001959
638 Ga0501070_0005030
639 Ga0501073_0035834
640 Ga0501074_0003283
641 Ga0501075_0302977
642 Ga0501080_0005299
643 Ga0501083_0022476
644 Ga0501035_0009358
645 Ga0501035_0038163
646 Ga0501035_0169281
647 Ga0501044_0010053
648 Ga0501044_0036718
649 nmdc:mga03n38_2284_c1
650 nmdc:mga00v17_219754_c1
651 nmdc:mga0yw44_111760_c1
652 nmdc:mga04h51_24131_c1
653 nmdc:mga05p37_60336_c1
654 nmdc:mga09592_127580_c1
655 nmdc:mga09592_84578_c1
656 nmdc:mga06r32_113512_c1
657 nmdc:mga08y16_453557_c1
658 nmdc:mga08y16_94283_c1
659 nmdc:mga0n895_191264_c1
660 Ga0495612_0000450
661 Ga0495619_0003826
662 Ga0500555_048164
663 Ga0501084_0007047
664 Ga0590071_009866
665 Ga0590074_003935
666 2524003128
667 2585993180
668 2643963010
669 2687234123
670 2688393702
671 2964629268
672 2967741305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

211

341

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

61

175

0.91

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

187

323

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kia-assembly1.cif.gz_A-2 crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis 0.9692 1 340
2dfv-assembly3.cif.gz_C hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii 0.969 2 339
5kia-assembly1.cif.gz_A-2 crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis 0.9608 1 340
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9607 1 339
2d8a-assembly1.cif.gz_A crystal structure of ph0655 from pyrococcus horikoshii ot3 0.9575 1 340
ID Description Score Start End Superfamily
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9942 2 150 3.90.180.10
af_P07913_155_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.99 155 286 3.40.50.720
af_P07913_155_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9827 155 286 3.40.50.720
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9811 2 150 3.90.180.10
5kiaA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9589 1 340 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A3N6GBZ0-F1-model_v4 L-threonine 3-dehydrogenase (TDH) (EC 1.1.1.103) 0.9928 2 341 GO:0005737
GO:0008270
GO:0008743
GO:0019518
AF-A0A3D5WZU5-F1-model_v4 deleted 0.9893 37 340
AF-A0A3S2DYK7-F1-model_v4 deleted 0.9889 62 340
AF-A0A1V3QVJ9-F1-model_v4 deleted 0.9887 35 307
AF-A0A3D1S9W8-F1-model_v4 L-threonine 3-dehydrogenase 0.9859 1 259 GO:0008270
GO:0016491

Map