F412709

General Info

Members Datasets Scaffolds Average Seq Length
336 233 672 144

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10059027|Ga0207690_100590272
Length 155
Sequence MAGPKDPYVNFNFLVEIDGIVRAAFHEASGLDSTIDVIEHREGGENITTRKYPGQVKFSNISLKWGVADDHDLYDWHRQWVTGDSAAARKNGSVVLLDRQGQEKVRWNFFNAWPAKWTGPAFNAEQSDIAIETLELAHYSATVDEAYNAASSDTV

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
158 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
216 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
233 2643221641 Nocardioides sp. Root122 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 2.68
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.3
Rhizoplane 2.98
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10059027 3300025932 Bacteria 2598
2 rootH1_10004905 3300003323 Bacteria 1764
3 rootH1_10159009 3300003323 Bacteria 4120
4 Ga0058863_10994343 3300004799 Bacteria 709
5 Ga0058863_11232239 3300004799 Bacteria 885
6 Ga0058862_11874229 3300004803 Bacteria 948
7 Ga0058862_12540599 3300004803 Bacteria 1670
8 Ga0065704_10190956 3300005289 Bacteria 1190
9 Ga0065715_10469861 3300005293 Bacteria 807
10 Ga0065707_10139732 3300005295 Bacteria 1789
11 Ga0065707_10971060 3300005295 Bacteria 547
12 Ga0070683_100031180 3300005329 Bacteria 4845
13 Ga0070683_101283696 3300005329 Bacteria 704
14 Ga0070670_100070840 3300005331 Bacteria 2993
15 Ga0070670_100496565 3300005331 Unclassified 1085
16 Ga0070677_10107271 3300005333 Bacteria 1241
17 Ga0070677_10143762 3300005333 Bacteria 1103
18 Ga0070677_10222656 3300005333 Unclassified 922
19 Ga0068869_101209417 3300005334 Bacteria 664
20 Ga0070666_10312881 3300005335 Bacteria 1119
21 Ga0070666_10797718 3300005335 Bacteria 695
22 Ga0070680_100721536 3300005336 Unclassified 858
23 Ga0070660_100265564 3300005339 Bacteria 1402
24 Ga0070660_100458260 3300005339 Bacteria 1058
25 Ga0070689_100365849 3300005340 Bacteria 1212
26 Ga0070692_10496491 3300005345 Bacteria 790
27 Ga0070668_100242905 3300005347 Unclassified 1492
28 Ga0070668_100554951 3300005347 Bacteria 1000
29 Ga0070669_100110795 3300005353 Bacteria 2083
30 Ga0070675_100388578 3300005354 Unclassified 1243
31 Ga0070671_100006085 3300005355 Bacteria 9616
32 Ga0070671_100056082 3300005355 Bacteria 3278
33 Ga0070673_100000353 3300005364 Bacteria 24161
34 Ga0070673_100093878 3300005364 Bacteria 2458
35 Ga0070673_100765515 3300005364 Bacteria 890
36 Ga0070688_100370967 3300005365 Unclassified 1053
37 Ga0070659_100571491 3300005366 Bacteria 969
38 Ga0070701_10125422 3300005438 Bacteria 1452
39 Ga0070705_101308774 3300005440 Bacteria 601
40 Ga0070700_100235415 3300005441 Unclassified 1305
41 Ga0070708_100000054 3300005445 Bacteria 76469
42 Ga0070663_100650992 3300005455 Bacteria 891
43 Ga0070662_100004231 3300005457 Bacteria 9049
44 Ga0070662_100742058 3300005457 Bacteria 832
45 Ga0070681_10023826 3300005458 Bacteria 6161
46 Ga0068867_101155364 3300005459 Bacteria 709
47 Ga0070707_100001707 3300005468 Bacteria 21190
48 Ga0070698_100051154 3300005471 Unclassified 4209
49 Ga0070699_100135994 3300005518 Bacteria 2168
50 Ga0070679_100113845 3300005530 Unclassified 2690
51 Ga0070679_100656201 3300005530 Bacteria 992
52 Ga0070684_100313872 3300005535 Bacteria 1440
53 Ga0070684_100443817 3300005535 Unclassified 1199
54 Ga0068853_101062842 3300005539 Bacteria 780
55 Ga0070672_100043810 3300005543 Bacteria 3454
56 Ga0070672_100212550 3300005543 Bacteria 1620
57 Ga0070672_100922221 3300005543 Bacteria 772
58 Ga0070686_100000343 3300005544 Bacteria 30108
59 Ga0070695_101334499 3300005545 Bacteria 593
60 Ga0070693_101527446 3300005547 Unclassified 522
61 Ga0068855_100024454 3300005563 Bacteria 7226
62 Ga0070664_100033188 3300005564 Bacteria 4321
63 Ga0070664_100122284 3300005564 Unclassified 2280
64 Ga0070702_100703855 3300005615 Bacteria 770
65 Ga0068852_100606849 3300005616 Bacteria 1099
66 Ga0068852_100620342 3300005616 Bacteria 1087
67 Ga0068852_101107377 3300005616 Bacteria 812
68 Ga0068859_100415669 3300005617 Bacteria 1441
69 Ga0068864_100515753 3300005618 Bacteria 1152
70 Ga0068864_101536256 3300005618 Bacteria 669
71 Ga0068864_102034880 3300005618 Bacteria 581
72 Ga0068863_100614712 3300005841 Bacteria 1076
73 Ga0068860_101024252 3300005843 Bacteria 844
74 Ga0068860_102319643 3300005843 Unclassified 557
75 Ga0068862_100006577 3300005844 Bacteria 9638
76 Ga0081539_10185284 3300005985 Unclassified 973
77 Ga0070715_10227621 3300006163 Bacteria 962
78 Ga0097621_100036162 3300006237 Bacteria 3950
79 Ga0075428_100001043 3300006844 Bacteria 29404
80 Ga0075428_100013634 3300006844 Bacteria 9051
81 Ga0075428_100019211 3300006844 Bacteria 7556
82 Ga0075428_100348218 3300006844 Bacteria 1590
83 Ga0075430_100000500 3300006846 Bacteria 29427
84 Ga0075431_100000610 3300006847 Bacteria 30160
85 Ga0075431_101036510 3300006847 Unclassified 786
86 Ga0075433_10226294 3300006852 Bacteria 1661
87 Ga0075433_10495123 3300006852 Bacteria 1076
88 Ga0075434_100846630 3300006871 Bacteria 930
89 Ga0075429_100000290 3300006880 Bacteria 35432
90 Ga0075429_100024201 3300006880 Bacteria 5267
91 Ga0075429_100542471 3300006880 Bacteria 1019
92 Ga0075429_100918050 3300006880 Bacteria 766
93 Ga0068865_100681990 3300006881 Bacteria 876
94 Ga0075436_100518171 3300006914 Bacteria 873
95 Ga0097620_100415682 3300006931 Bacteria 1441
96 Ga0105240_10042526 3300009093 Bacteria 5789
97 Ga0111539_10000518 3300009094 Bacteria 48829
98 Ga0111539_10589559 3300009094 Bacteria 1294
99 Ga0111539_10762743 3300009094 Bacteria 1126
100 Ga0111539_10844413 3300009094 Bacteria 1066
101 Ga0111539_12187613 3300009094 Bacteria 642
102 Ga0111539_12823480 3300009094 Unclassified 562
103 Ga0114129_10001739 3300009147 Bacteria 29644
104 Ga0114129_10112496 3300009147 Bacteria 3754
105 Ga0114129_10367635 3300009147 Bacteria 1902
106 Ga0114129_10684286 3300009147 Unclassified 1320
107 Ga0114129_10938155 3300009147 Bacteria 1094
108 Ga0105248_10042037 3300009177 Bacteria 5126
109 Ga0105248_12246814 3300009177 Unclassified 621
110 Ga0105249_11853085 3300009553 Bacteria 676
111 Ga0105239_10675298 3300010375 Bacteria 1180
112 Ga0157373_10297522 3300013100 Bacteria 1145
113 Ga0157371_10321910 3300013102 Bacteria 1122
114 Ga0157369_10663304 3300013105 Bacteria 1075
115 Ga0157374_10329838 3300013296 Bacteria 1513
116 Ga0157378_10122435 3300013297 Bacteria 2399
117 Ga0163162_12992229 3300013306 Bacteria 543
118 Ga0157372_10225362 3300013307 Bacteria 2173
119 Ga0163163_10639004 3300014325 Bacteria 1128
120 Ga0163163_11304240 3300014325 Bacteria 788
121 Ga0157376_10000132 3300014969 Bacteria 51733
122 Ga0206352_10724948 3300020078 Bacteria 720
123 Ga0213875_10000056 3300021388 Bacteria 136543
124 Ga0224712_10201852 3300022467 Bacteria 904
125 Ga0207682_10148654 3300025893 Bacteria 1055
126 Ga0207682_10189409 3300025893 Bacteria 942
127 Ga0207707_10013864 3300025912 Bacteria 7030
128 Ga0207695_10246516 3300025913 Bacteria 1686
129 Ga0207660_10354141 3300025917 Bacteria 1177
130 Ga0207657_10268728 3300025919 Bacteria 1356
131 Ga0207652_10063815 3300025921 Unclassified 3186
132 Ga0207646_10010252 3300025922 Bacteria 9175
133 Ga0207681_10163442 3300025923 Bacteria 1681
134 Ga0207650_10408087 3300025925 Unclassified 1125
135 Ga0207650_10830534 3300025925 Bacteria 783
136 Ga0207700_10912955 3300025928 Unclassified 786
137 Ga0207644_10020187 3300025931 Bacteria 4527
138 Ga0207644_10077219 3300025931 Bacteria 2452
139 Ga0207706_10132464 3300025933 Bacteria 2193
140 Ga0207706_10151259 3300025933 Bacteria 2041
141 Ga0207706_11371092 3300025933 Bacteria 582
142 Ga0207670_10223139 3300025936 Bacteria 1444
143 Ga0207669_10537129 3300025937 Bacteria 941
144 Ga0207704_10624009 3300025938 Bacteria 885
145 Ga0207691_10535818 3300025940 Bacteria 993
146 Ga0207711_10023249 3300025941 Bacteria 5187
147 Ga0207711_10941135 3300025941 Unclassified 803
148 Ga0207661_10133939 3300025944 Bacteria 2126
149 Ga0207661_11073503 3300025944 Bacteria 741
150 Ga0207679_10019933 3300025945 Bacteria 4517
151 Ga0207667_11231966 3300025949 Bacteria 727
152 Ga0207651_10005598 3300025960 Bacteria 6471
153 Ga0207651_10228478 3300025960 Bacteria 1509
154 Ga0207651_10271922 3300025960 Bacteria 1396
155 Ga0207651_10393042 3300025960 Bacteria 1178
156 Ga0207712_11624845 3300025961 Bacteria 579
157 Ga0207668_11067982 3300025972 Bacteria 723
158 Ga0207668_11388018 3300025972 Bacteria 633
159 Ga0207640_10905458 3300025981 Bacteria 771
160 Ga0207658_11928637 3300025986 Bacteria 538
161 Ga0207677_12200388 3300026023 Bacteria 513
162 Ga0207639_10517843 3300026041 Bacteria 1092
163 Ga0207678_10669351 3300026067 Bacteria 912
164 Ga0207678_11820117 3300026067 Bacteria 533
165 Ga0207708_10237570 3300026075 Unclassified 1465
166 Ga0207641_11170478 3300026088 Unclassified 768
167 Ga0207641_11715061 3300026088 Bacteria 630
168 Ga0207674_10347229 3300026116 Unclassified 1435
169 Ga0207683_11060136 3300026121 Bacteria 752
170 Ga0207698_10310257 3300026142 Bacteria 1473
171 Ga0207698_10829375 3300026142 Bacteria 929
172 Ga0207698_10952010 3300026142 Bacteria 868
173 Ga0207698_12566452 3300026142 Unclassified 519
174 Ga0207428_10000615 3300027907 Bacteria 42129
175 Ga0207428_10288425 3300027907 Unclassified 1217
176 Ga0268266_11706875 3300028379 Bacteria 605
177 Ga0268265_10901185 3300028380 Bacteria 868
178 Ga0268264_10277492 3300028381 Bacteria 1568
179 Ga0268264_10326879 3300028381 Bacteria 1452
180 Ga0265340_10028455 3300031247 Bacteria 2811
181 Ga0265339_10055028 3300031249 Bacteria 2159
182 Ga0307408_100008304 3300031548 Bacteria 6855
183 Ga0307408_100305947 3300031548 Bacteria 1333
184 Ga0307408_101980824 3300031548 Unclassified 560
185 Ga0265314_10027336 3300031711 Bacteria 4272
186 Ga0316576_10149489 3300031727 Unclassified 1760
187 Ga0307405_10008792 3300031731 Bacteria 5141
188 Ga0307405_10116148 3300031731 Bacteria 1822
189 Ga0307405_10555710 3300031731 Bacteria 930
190 Ga0307413_10031373 3300031824 Bacteria 2998
191 Ga0307413_10074746 3300031824 Bacteria 2147
192 Ga0307410_10114000 3300031852 Bacteria 1960
193 Ga0307410_10158427 3300031852 Bacteria 1693
194 Ga0326468_10031010 3300031889 Bacteria 708
195 Ga0307406_10037747 3300031901 Bacteria 2986
196 Ga0307407_10003540 3300031903 Bacteria 6437
197 Ga0307407_10013185 3300031903 Bacteria 4000
198 Ga0307412_10227765 3300031911 Bacteria 1433
199 Ga0307409_100012439 3300031995 Bacteria 5423
200 Ga0307409_100202401 3300031995 Bacteria 1777
201 Ga0307416_100188120 3300032002 Bacteria 1943
202 Ga0307416_100509394 3300032002 Bacteria 1269
203 Ga0307414_10015929 3300032004 Bacteria 4554
204 Ga0307414_10060250 3300032004 Bacteria 2683
205 Ga0307411_10006555 3300032005 Bacteria 5836
206 Ga0307411_10026913 3300032005 Bacteria 3469
207 Ga0307411_10613024 3300032005 Bacteria 937
208 Ga0307415_100012744 3300032126 Bacteria 4874
209 Ga0307415_100037136 3300032126 Bacteria 3199
210 Ga0316586_1074955 3300033527 Bacteria 627
211 Ga0316588_1171412 3300033528 Unclassified 561
212 Ga0373934_0115275 3300035086 Unclassified 1091
213 Ga0373954_0054630 3300035118 Unclassified 1878
214 Ga0373957_0242600 3300035120 Unclassified 757
215 Ga0373931_0069022 3300035691 Bacteria 1925
216 Ga0373933_0338078 3300035724 Bacteria 977
217 Ga0373947_0280259 3300035725 Unclassified 1108
218 Ga0373937_0008844 3300036401 Bacteria 8738
219 Ga0373937_0593477 3300036401 Bacteria 1052
220 Ga0316582_0004489 3300036647 Bacteria 7068
221 Ga0316584_0298585 3300036712 Unclassified 1167
222 Ga0316584_1041191 3300036712 Unclassified 545
223 Ga0395899_0193149 3300037312 Bacteria 1424
224 Ga0395899_0263709 3300037312 Bacteria 1177
225 Ga0395900_0100929 3300037418 Bacteria 2964
226 Ga0395900_0383140 3300037418 Bacteria 1374
227 Ga0395905_0015601 3300037471 Bacteria 7218
228 Ga0395905_0206466 3300037471 Bacteria 1841
229 Ga0316581_0187642 3300037588 Unclassified 637
230 Ga0436364_0196389 3300037853 Bacteria 74609
231 Ga0436364_1214568 3300037853 Unclassified 2108
232 Ga0395901_0074032 3300038443 Bacteria 3553
233 Ga0395901_0444868 3300038443 Bacteria 1326
234 Ga0436365_1780602 3300039437 Bacteria 1472
235 Ga0436361_0987418 3300039447 Unclassified 562
236 Ga0436362_0151694 3300039453 Unclassified 617
237 Ga0451807_2429275 3300041486 Bacteria 1021
238 Ga0451853_2899530 3300041512 Unclassified 547
239 Ga0450916_028095 3300042530 Bacteria 807
240 Ga0450893_0001079 3300042532 Bacteria 4101
241 Ga0466969_0011996 3300044656 Bacteria 4580
242 Ga0466972_0016305 3300044658 Bacteria 3713
243 Ga0453683_0006915 3300044673 Bacteria 7736
244 Ga0466965_0014301 3300044683 Bacteria 3754
245 Ga0466965_0033965 3300044683 Bacteria 2494
246 Ga0466966_0049045 3300044684 Bacteria 2689
247 Ga0466961_0016628 3300044693 Bacteria 4730
248 Ga0466963_0065396 3300044694 Bacteria 2438
249 Ga0466964_0012140 3300044706 Bacteria 3257
250 Ga0466971_0002683 3300044719 Bacteria 7519
251 Ga0466968_0000274 3300044735 Bacteria 16425
252 Ga0466968_0047167 3300044735 Bacteria 1831
253 Ga0466970_0044691 3300044765 Bacteria 2358
254 Ga0466957_0031743 3300044842 Bacteria 3158
255 Ga0466960_0005990 3300044901 Bacteria 4854
256 Ga0466959_0000741 3300045049 Bacteria 19082
257 Ga0466958_0013896 3300045836 Bacteria 4592
258 Ga0466967_0166973 3300045976 Bacteria 2069
259 Ga0495650_0020050 3300046471 Bacteria 3271
260 Ga0495580_0007992 3300046472 Bacteria 8452
261 Ga0495594_0144855 3300046499 Unclassified 1348
262 Ga0495665_0370936 3300046531 Unclassified 728
263 Ga0495621_0015909 3300046539 Bacteria 2406
264 Ga0495668_0000052 3300046616 Bacteria 212864
265 Ga0495625_0003223 3300046660 Bacteria 16519
266 Ga0495670_0081491 3300046691 Bacteria 1649
267 Ga0495670_0478140 3300046691 Unclassified 676
268 Ga0495604_0872307 3300047317 Unclassified 564
269 Ga0495602_0038886 3300048088 Bacteria 4390
270 Ga0496102_1623166 3300048905 Bacteria 565
271 Ga0496103_0198395 3300048906 Bacteria 1290
272 Ga0496104_0034507 3300048907 Bacteria 4718
273 Ga0496105_0005670 3300048908 Bacteria 9501
274 Ga0496109_0000063 3300048912 Bacteria 112773
275 Ga0496113_0842786 3300048916 Bacteria 727
276 Ga0496115_0006206 3300048918 Bacteria 8741
277 Ga0496115_0013763 3300048918 Bacteria 6125
278 Ga0496115_0015624 3300048918 Bacteria 5763
279 Ga0496117_0002332 3300048920 Bacteria 24283
280 Ga0496118_0000126 3300048921 Bacteria 135644
281 Ga0496121_0011446 3300048924 Bacteria 9849
282 Ga0501036_0043786 3300049572 Bacteria 3791
283 Ga0501038_0044390 3300049574 Bacteria 3862
284 Ga0501039_0008791 3300049575 Bacteria 7695
285 Ga0501040_0035273 3300049576 Bacteria 3392
286 Ga0501041_0053999 3300049577 Bacteria 2451
287 Ga0501041_0285042 3300049577 Unclassified 1040
288 Ga0501042_0141589 3300049578 Bacteria 1734
289 Ga0501046_0122238 3300049580 Bacteria 1980
290 Ga0501048_0155409 3300049582 Bacteria 1618
291 Ga0501070_0636308 3300049586 Bacteria 848
292 Ga0501071_0365338 3300049587 Bacteria 1099
293 Ga0501071_0407216 3300049587 Bacteria 1039
294 Ga0501072_0240167 3300049588 Bacteria 1443
295 Ga0501074_0145457 3300049590 Bacteria 1695
296 Ga0501075_0000265 3300049591 Bacteria 28570
297 Ga0501076_0000132 3300049592 Bacteria 41750
298 Ga0501077_0083818 3300049593 Bacteria 2020
299 Ga0501077_0546561 3300049593 Bacteria 743
300 Ga0501242_016972 3300049674 Bacteria 915
301 Ga0501079_0089216 3300049741 Bacteria 2388
302 Ga0501080_0037311 3300049742 Bacteria 4538
303 Ga0501081_0008717 3300049743 Bacteria 6592
304 Ga0501083_0072378 3300049744 Bacteria 2292
305 Ga0501265_020984 3300049762 Unclassified 883
306 Ga0501273_021610 3300049770 Bacteria 875
307 Ga0501045_0231525 3300049824 Bacteria 1375
308 nmdc:mga05p37_1208_c1 3300050507 Bacteria 29907
309 nmdc:mga05p37_546370_c1 3300050507 Unclassified 1320
310 nmdc:mga05p37_736125_c1 3300050507 Bacteria 1089
311 nmdc:mga05p37_770411_c1 3300050507 Bacteria 1057
312 nmdc:mga05p37_91507_c1 3300050507 Bacteria 3748
313 nmdc:mga09592_12285_c1 3300050508 Bacteria 6972
314 nmdc:mga09592_296_c1 3300050508 Bacteria 36100
315 nmdc:mga0qj67_333_c1 3300050509 Bacteria 32503
316 nmdc:mga06r32_1388978_c1 3300050510 Bacteria 644
317 nmdc:mga06r32_426_c1 3300050510 Bacteria 35460
318 nmdc:mga08y16_1255930_c1 3300050511 Bacteria 709
319 nmdc:mga08y16_1311731_c1 3300050511 Unclassified 690
320 nmdc:mga08y16_163_c1 3300050511 Bacteria 57931
321 nmdc:mga08y16_281670_c1 3300050511 Bacteria 1715
322 nmdc:mga08y16_426892_c1 3300050511 Bacteria 1354
323 nmdc:mga08y16_854442_c1 3300050511 Bacteria 899
324 nmdc:mga0n895_18261_c1 3300050512 Bacteria 6486
325 nmdc:mga0n895_762170_c1 3300050512 Bacteria 960
326 nmdc:mga0rr50_13095_c1 3300050513 Bacteria 5386
327 nmdc:mga0rr50_492088_c1 3300050513 Bacteria 1042
328 nmdc:mga08x19_89176_c1 3300050514 Bacteria 2034
329 nmdc:mga0a205_105519_c1 3300050515 Bacteria 2716
330 Ga0501084_0003024 3300054114 Bacteria 13623
331 Ga0587079_032839 3300059647 Bacteria 1007
332 Ga0501082_0003636 3300060353 Bacteria 13469
333 Ga0466962_0008341 3300061719 Bacteria 4965
334 Ga0530510_0000011 3300061734 Bacteria 125603
335 2515685788 2515154122 Bacteria 8609520
336 2644228932 2643221641 Bacteria 4490190
337 Ga0207690_10059027
338 rootH1_10004905
339 rootH1_10159009
340 Ga0058863_10994343
341 Ga0058863_11232239
342 Ga0058862_11874229
343 Ga0058862_12540599
344 Ga0065704_10190956
345 Ga0065715_10469861
346 Ga0065707_10139732
347 Ga0065707_10971060
348 Ga0070683_100031180
349 Ga0070683_101283696
350 Ga0070670_100070840
351 Ga0070670_100496565
352 Ga0070677_10107271
353 Ga0070677_10143762
354 Ga0070677_10222656
355 Ga0068869_101209417
356 Ga0070666_10312881
357 Ga0070666_10797718
358 Ga0070680_100721536
359 Ga0070660_100265564
360 Ga0070660_100458260
361 Ga0070689_100365849
362 Ga0070692_10496491
363 Ga0070668_100242905
364 Ga0070668_100554951
365 Ga0070669_100110795
366 Ga0070675_100388578
367 Ga0070671_100006085
368 Ga0070671_100056082
369 Ga0070673_100000353
370 Ga0070673_100093878
371 Ga0070673_100765515
372 Ga0070688_100370967
373 Ga0070659_100571491
374 Ga0070701_10125422
375 Ga0070705_101308774
376 Ga0070700_100235415
377 Ga0070708_100000054
378 Ga0070663_100650992
379 Ga0070662_100004231
380 Ga0070662_100742058
381 Ga0070681_10023826
382 Ga0068867_101155364
383 Ga0070707_100001707
384 Ga0070698_100051154
385 Ga0070699_100135994
386 Ga0070679_100113845
387 Ga0070679_100656201
388 Ga0070684_100313872
389 Ga0070684_100443817
390 Ga0068853_101062842
391 Ga0070672_100043810
392 Ga0070672_100212550
393 Ga0070672_100922221
394 Ga0070686_100000343
395 Ga0070695_101334499
396 Ga0070693_101527446
397 Ga0068855_100024454
398 Ga0070664_100033188
399 Ga0070664_100122284
400 Ga0070702_100703855
401 Ga0068852_100606849
402 Ga0068852_100620342
403 Ga0068852_101107377
404 Ga0068859_100415669
405 Ga0068864_100515753
406 Ga0068864_101536256
407 Ga0068864_102034880
408 Ga0068863_100614712
409 Ga0068860_101024252
410 Ga0068860_102319643
411 Ga0068862_100006577
412 Ga0081539_10185284
413 Ga0070715_10227621
414 Ga0097621_100036162
415 Ga0075428_100001043
416 Ga0075428_100013634
417 Ga0075428_100019211
418 Ga0075428_100348218
419 Ga0075430_100000500
420 Ga0075431_100000610
421 Ga0075431_101036510
422 Ga0075433_10226294
423 Ga0075433_10495123
424 Ga0075434_100846630
425 Ga0075429_100000290
426 Ga0075429_100024201
427 Ga0075429_100542471
428 Ga0075429_100918050
429 Ga0068865_100681990
430 Ga0075436_100518171
431 Ga0097620_100415682
432 Ga0105240_10042526
433 Ga0111539_10000518
434 Ga0111539_10589559
435 Ga0111539_10762743
436 Ga0111539_10844413
437 Ga0111539_12187613
438 Ga0111539_12823480
439 Ga0114129_10001739
440 Ga0114129_10112496
441 Ga0114129_10367635
442 Ga0114129_10684286
443 Ga0114129_10938155
444 Ga0105248_10042037
445 Ga0105248_12246814
446 Ga0105249_11853085
447 Ga0105239_10675298
448 Ga0157373_10297522
449 Ga0157371_10321910
450 Ga0157369_10663304
451 Ga0157374_10329838
452 Ga0157378_10122435
453 Ga0163162_12992229
454 Ga0157372_10225362
455 Ga0163163_10639004
456 Ga0163163_11304240
457 Ga0157376_10000132
458 Ga0206352_10724948
459 Ga0213875_10000056
460 Ga0224712_10201852
461 Ga0207682_10148654
462 Ga0207682_10189409
463 Ga0207707_10013864
464 Ga0207695_10246516
465 Ga0207660_10354141
466 Ga0207657_10268728
467 Ga0207652_10063815
468 Ga0207646_10010252
469 Ga0207681_10163442
470 Ga0207650_10408087
471 Ga0207650_10830534
472 Ga0207700_10912955
473 Ga0207644_10020187
474 Ga0207644_10077219
475 Ga0207706_10132464
476 Ga0207706_10151259
477 Ga0207706_11371092
478 Ga0207670_10223139
479 Ga0207669_10537129
480 Ga0207704_10624009
481 Ga0207691_10535818
482 Ga0207711_10023249
483 Ga0207711_10941135
484 Ga0207661_10133939
485 Ga0207661_11073503
486 Ga0207679_10019933
487 Ga0207667_11231966
488 Ga0207651_10005598
489 Ga0207651_10228478
490 Ga0207651_10271922
491 Ga0207651_10393042
492 Ga0207712_11624845
493 Ga0207668_11067982
494 Ga0207668_11388018
495 Ga0207640_10905458
496 Ga0207658_11928637
497 Ga0207677_12200388
498 Ga0207639_10517843
499 Ga0207678_10669351
500 Ga0207678_11820117
501 Ga0207708_10237570
502 Ga0207641_11170478
503 Ga0207641_11715061
504 Ga0207674_10347229
505 Ga0207683_11060136
506 Ga0207698_10310257
507 Ga0207698_10829375
508 Ga0207698_10952010
509 Ga0207698_12566452
510 Ga0207428_10000615
511 Ga0207428_10288425
512 Ga0268266_11706875
513 Ga0268265_10901185
514 Ga0268264_10277492
515 Ga0268264_10326879
516 Ga0265340_10028455
517 Ga0265339_10055028
518 Ga0307408_100008304
519 Ga0307408_100305947
520 Ga0307408_101980824
521 Ga0265314_10027336
522 Ga0316576_10149489
523 Ga0307405_10008792
524 Ga0307405_10116148
525 Ga0307405_10555710
526 Ga0307413_10031373
527 Ga0307413_10074746
528 Ga0307410_10114000
529 Ga0307410_10158427
530 Ga0326468_10031010
531 Ga0307406_10037747
532 Ga0307407_10003540
533 Ga0307407_10013185
534 Ga0307412_10227765
535 Ga0307409_100012439
536 Ga0307409_100202401
537 Ga0307416_100188120
538 Ga0307416_100509394
539 Ga0307414_10015929
540 Ga0307414_10060250
541 Ga0307411_10006555
542 Ga0307411_10026913
543 Ga0307411_10613024
544 Ga0307415_100012744
545 Ga0307415_100037136
546 Ga0316586_1074955
547 Ga0316588_1171412
548 Ga0373934_0115275
549 Ga0373954_0054630
550 Ga0373957_0242600
551 Ga0373931_0069022
552 Ga0373933_0338078
553 Ga0373947_0280259
554 Ga0373937_0008844
555 Ga0373937_0593477
556 Ga0316582_0004489
557 Ga0316584_0298585
558 Ga0316584_1041191
559 Ga0395899_0193149
560 Ga0395899_0263709
561 Ga0395900_0100929
562 Ga0395900_0383140
563 Ga0395905_0015601
564 Ga0395905_0206466
565 Ga0316581_0187642
566 Ga0436364_0196389
567 Ga0436364_1214568
568 Ga0395901_0074032
569 Ga0395901_0444868
570 Ga0436365_1780602
571 Ga0436361_0987418
572 Ga0436362_0151694
573 Ga0451807_2429275
574 Ga0451853_2899530
575 Ga0450916_028095
576 Ga0450893_0001079
577 Ga0466969_0011996
578 Ga0466972_0016305
579 Ga0453683_0006915
580 Ga0466965_0014301
581 Ga0466965_0033965
582 Ga0466966_0049045
583 Ga0466961_0016628
584 Ga0466963_0065396
585 Ga0466964_0012140
586 Ga0466971_0002683
587 Ga0466968_0000274
588 Ga0466968_0047167
589 Ga0466970_0044691
590 Ga0466957_0031743
591 Ga0466960_0005990
592 Ga0466959_0000741
593 Ga0466958_0013896
594 Ga0466967_0166973
595 Ga0495650_0020050
596 Ga0495580_0007992
597 Ga0495594_0144855
598 Ga0495665_0370936
599 Ga0495621_0015909
600 Ga0495668_0000052
601 Ga0495625_0003223
602 Ga0495670_0081491
603 Ga0495670_0478140
604 Ga0495604_0872307
605 Ga0495602_0038886
606 Ga0496102_1623166
607 Ga0496103_0198395
608 Ga0496104_0034507
609 Ga0496105_0005670
610 Ga0496109_0000063
611 Ga0496113_0842786
612 Ga0496115_0006206
613 Ga0496115_0013763
614 Ga0496115_0015624
615 Ga0496117_0002332
616 Ga0496118_0000126
617 Ga0496121_0011446
618 Ga0501036_0043786
619 Ga0501038_0044390
620 Ga0501039_0008791
621 Ga0501040_0035273
622 Ga0501041_0053999
623 Ga0501041_0285042
624 Ga0501042_0141589
625 Ga0501046_0122238
626 Ga0501048_0155409
627 Ga0501070_0636308
628 Ga0501071_0365338
629 Ga0501071_0407216
630 Ga0501072_0240167
631 Ga0501074_0145457
632 Ga0501075_0000265
633 Ga0501076_0000132
634 Ga0501077_0083818
635 Ga0501077_0546561
636 Ga0501242_016972
637 Ga0501079_0089216
638 Ga0501080_0037311
639 Ga0501081_0008717
640 Ga0501083_0072378
641 Ga0501265_020984
642 Ga0501273_021610
643 Ga0501045_0231525
644 nmdc:mga05p37_1208_c1
645 nmdc:mga05p37_546370_c1
646 nmdc:mga05p37_736125_c1
647 nmdc:mga05p37_770411_c1
648 nmdc:mga05p37_91507_c1
649 nmdc:mga09592_12285_c1
650 nmdc:mga09592_296_c1
651 nmdc:mga0qj67_333_c1
652 nmdc:mga06r32_1388978_c1
653 nmdc:mga06r32_426_c1
654 nmdc:mga08y16_1255930_c1
655 nmdc:mga08y16_1311731_c1
656 nmdc:mga08y16_163_c1
657 nmdc:mga08y16_281670_c1
658 nmdc:mga08y16_426892_c1
659 nmdc:mga08y16_854442_c1
660 nmdc:mga0n895_18261_c1
661 nmdc:mga0n895_762170_c1
662 nmdc:mga0rr50_13095_c1
663 nmdc:mga0rr50_492088_c1
664 nmdc:mga08x19_89176_c1
665 nmdc:mga0a205_105519_c1
666 Ga0501084_0003024
667 Ga0587079_032839
668 Ga0501082_0003636
669 Ga0466962_0008341
670 Ga0530510_0000011
671 2515685788
672 2644228932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

9

142

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.8908 5 144
7b5h-assembly1.cif.gz_AN cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.8828 4 144
7aeb-assembly1.cif.gz_Y cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.8805 6 144
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.8732 5 144
7b5h-assembly1.cif.gz_AN cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.8655 4 144
ID Description Score Start End Superfamily
af_F4K1A0_22_133_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7053 89 106 3.30.420.10
af_Q0JFQ3_268_343_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6841 88 106 3.30.420.10
af_Q9VF86_1_117_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6649 91 109 3.30.420.40
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6608 31 141 2.30.110.20
af_Q9QZ08_1_118_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6437 91 111 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A5C6YJ43-F1-model_v4 Phage tail protein 0.9533 32 144 GO:0005198
AF-A0A2G6JA31-F1-model_v4 Phage tail protein 0.9471 6 144 GO:0005198
AF-A0A1Q7Q1G9-F1-model_v4 Phage tail protein 0.9463 13 144 GO:0005198
AF-A0A5C6YJ43-F1-model_v4 Phage tail protein 0.9453 32 144 GO:0005198
AF-A0A7X3D8I7-F1-model_v4 Phage tail protein 0.9452 23 144 GO:0005198

Map