F412663

General Info

Members Datasets Scaffolds Average Seq Length
336 259 674 216

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10047410|Ga0157374_100474104
Length 245
Sequence MISPKDLNSATDNTAATRRTVNARGDQILTFDLFGDETPKGSEREIMAPGATLLRGYALPSEAELLAAIAQIAADAPFRHMTTPGGFVMSVAMTNCGKVGWVTDRKGYRYDPLDPESGKSWPQMPASFSELAAGAAQAAGYPEFEPDACLINRYEPGARMSLHQDKDEKDFEQPIVSVSLGLPAVFQFGGAKRTDPVTKYALRHGDVVVWGGPSRAFYHGVPTLKEGDHPKLGRRRLNLTFRKAL

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
240 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2547132374 Acidovorax radicis N35 Isolate Unclassified
244 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
245 2643221609 Acidovorax sp. Root217 Isolate Unclassified
246 2643221618 Ensifer sp. Root231 Isolate Unclassified
247 2643221655 Ensifer sp. Root1252 Isolate Unclassified
248 2643221659 Ensifer sp. Root127 Isolate Unclassified
249 2643221698 Ensifer sp. Root142 Isolate Unclassified
250 2643221712 Ensifer sp. Root258 Isolate Unclassified
251 2844163670 Ensifer sp. 1H6 Isolate Unclassified
252 2855730933 Achromobacter sp. HZ28 Isolate Nodule
253 2855767633 Achromobacter sp. HZ34 Isolate Nodule
254 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
255 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
256 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
257 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
258 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
259 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0.3
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.77
Nodule 0.89
Rhizoplane 2.08
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10047410 3300013296 Bacteria 3984
2 JGI25156J39149_1000212 3300002705 Bacteria 40452
3 JGI25154J39366_1001959 3300002738 Bacteria 6090
4 JGI25157J39369_1000075 3300002741 Bacteria 88169
5 JGI25151J46595_10000190 3300003187 Bacteria 75765
6 rootH1_10009260 3300003316 Bacteria 2036
7 rootH1_10009260 3300003323 Bacteria 16518
8 rootH1_10053130 3300003316 Bacteria 2306
9 rootH1_10053130 3300003323 Bacteria 6288
10 rootH2_10222366 3300003320 Bacteria 1344
11 rootH1_10031052 3300003323 Bacteria 7115
12 Ga0055529_1001167 3300003763 Bacteria 10792
13 Ga0055540_1002816 3300003792 Bacteria 8891
14 Ga0070676_10460481 3300005328 Unclassified 896
15 Ga0070680_100049153 3300005336 Bacteria 3437
16 Ga0070680_100673579 3300005336 Bacteria 890
17 Ga0070660_100022011 3300005339 Bacteria 4709
18 Ga0070660_100058223 3300005339 Bacteria 2995
19 Ga0070689_100315857 3300005340 Bacteria 1303
20 Ga0070692_10017873 3300005345 Bacteria 3399
21 Ga0070688_100317937 3300005365 Bacteria 1130
22 Ga0070659_100014508 3300005366 Bacteria 5889
23 Ga0070709_10042323 3300005434 Bacteria 2812
24 Ga0070701_10010032 3300005438 Bacteria 4173
25 Ga0070700_100041671 3300005441 Bacteria 2815
26 Ga0070663_100017625 3300005455 Bacteria 4665
27 Ga0070678_100044222 3300005456 Bacteria 3179
28 Ga0070662_100133133 3300005457 Bacteria 1919
29 Ga0070681_10018314 3300005458 Bacteria 6999
30 Ga0070681_10625685 3300005458 Bacteria 991
31 Ga0070706_100213045 3300005467 Bacteria 1803
32 Ga0070684_100166983 3300005535 Bacteria 1998
33 Ga0068853_100037059 3300005539 Bacteria 4148
34 Ga0070695_100156900 3300005545 Bacteria 1593
35 Ga0070665_100091930 3300005548 Bacteria 3039
36 Ga0070704_100165446 3300005549 Bacteria 1753
37 Ga0068855_100003502 3300005563 Bacteria 19224
38 Ga0068855_100004310 3300005563 Bacteria 17394
39 Ga0068855_100082686 3300005563 Bacteria 3721
40 Ga0068855_100110208 3300005563 Bacteria 3160
41 Ga0068855_100214447 3300005563 Bacteria 2162
42 Ga0068855_100459968 3300005563 Bacteria 1388
43 Ga0068857_100002629 3300005577 Bacteria 14741
44 Ga0068857_100272111 3300005577 Bacteria 1557
45 Ga0068854_100002212 3300005578 Bacteria 11972
46 Ga0068854_100036051 3300005578 Bacteria 3466
47 Ga0068856_100000871 3300005614 Bacteria 32354
48 Ga0068852_100039527 3300005616 Bacteria 3972
49 Ga0068852_100204822 3300005616 Bacteria 1868
50 Ga0068852_100552978 3300005616 Bacteria 1151
51 Ga0068866_10003204 3300005718 Bacteria 6744
52 Ga0068851_10002001 3300005834 Bacteria 8977
53 Ga0068851_10005246 3300005834 Bacteria 5880
54 Ga0068851_10298973 3300005834 Bacteria 925
55 Ga0068863_100366435 3300005841 Bacteria 1405
56 Ga0068858_100240714 3300005842 Bacteria 1717
57 Ga0068862_100308630 3300005844 Bacteria 1457
58 Ga0075365_10003306 3300006038 Bacteria 8275
59 Ga0075363_100051172 3300006048 Bacteria 2202
60 Ga0075364_10006610 3300006051 Bacteria 6827
61 Ga0075364_10444675 3300006051 Bacteria 885
62 Ga0070716_100241464 3300006173 Bacteria 1225
63 Ga0070712_100000982 3300006175 Bacteria 17141
64 Ga0075367_10051743 3300006178 Bacteria 2429
65 Ga0075367_10132026 3300006178 Bacteria 1544
66 Ga0075366_10031342 3300006195 Bacteria 3128
67 Ga0097621_100154441 3300006237 Bacteria 1969
68 Ga0068871_100183479 3300006358 Bacteria 1799
69 Ga0105240_10017256 3300009093 Bacteria 9738
70 Ga0105240_10021697 3300009093 Bacteria 8537
71 Ga0105240_10048021 3300009093 Bacteria 5397
72 Ga0111539_10022111 3300009094 Bacteria 7816
73 Ga0114129_10792718 3300009147 Bacteria 1209
74 Ga0105241_10026612 3300009174 Bacteria 4305
75 Ga0105242_10044092 3300009176 Bacteria 3610
76 Ga0105248_10197764 3300009177 Bacteria 2265
77 Ga0105237_10064124 3300009545 Bacteria 3671
78 Ga0105238_10002530 3300009551 Bacteria 18269
79 Ga0105238_10274644 3300009551 Bacteria 1666
80 Ga0105239_10375509 3300010375 Bacteria 1607
81 Ga0105246_10033754 3300011119 Bacteria 3404
82 Ga0157370_10506101 3300013104 Bacteria 1109
83 Ga0157369_10016991 3300013105 Bacteria 8178
84 Ga0157378_10106390 3300013297 Bacteria 2566
85 Ga0163162_10236550 3300013306 Bacteria 1957
86 Ga0157372_10004754 3300013307 Bacteria 14419
87 Ga0157380_10046086 3300014326 Bacteria 3423
88 Ga0157379_10015135 3300014968 Bacteria 6766
89 Ga0157376_10281386 3300014969 Bacteria 1567
90 Ga0206356_10172038 3300020070 Bacteria 1309
91 Ga0209258_100162 3300025242 Bacteria 151725
92 Ga0209646_1000066 3300025246 Bacteria 244823
93 Ga0209026_1000027 3300025250 Bacteria 351282
94 Ga0209677_100128 3300025253 Bacteria 76547
95 Ga0209759_1000387 3300025256 Bacteria 55041
96 Ga0209759_1000634 3300025256 Bacteria 33022
97 Ga0209759_1008305 3300025256 Bacteria 3249
98 Ga0207666_1002957 3300025271 Bacteria 2066
99 Ga0209455_1000128 3300025272 Bacteria 162413
100 Ga0209025_1000026 3300025294 Bacteria 519850
101 Ga0209564_1000385 3300025295 Bacteria 80273
102 Ga0209051_1000354 3300025303 Bacteria 68119
103 Ga0209051_1031762 3300025303 Bacteria 2026
104 Ga0207697_10001936 3300025315 Bacteria 10998
105 Ga0207656_10026678 3300025321 Bacteria 2357
106 Ga0207682_10000740 3300025893 Bacteria 15117
107 Ga0207692_10055970 3300025898 Bacteria 2021
108 Ga0207642_10056877 3300025899 Bacteria 1796
109 Ga0207688_10000602 3300025901 Bacteria 17683
110 Ga0207647_10093788 3300025904 Bacteria 1789
111 Ga0207643_10000480 3300025908 Bacteria 25852
112 Ga0207705_10468168 3300025909 Bacteria 978
113 Ga0207684_10407945 3300025910 Bacteria 1168
114 Ga0207654_10000757 3300025911 Bacteria 17843
115 Ga0207707_10267086 3300025912 Bacteria 1483
116 Ga0207695_10000424 3300025913 Bacteria 93657
117 Ga0207695_10077313 3300025913 Bacteria 3381
118 Ga0207671_10098128 3300025914 Bacteria 2216
119 Ga0207693_10000649 3300025915 Bacteria 31124
120 Ga0207660_10223068 3300025917 Bacteria 1480
121 Ga0207662_10003173 3300025918 Bacteria 8407
122 Ga0207657_10008136 3300025919 Bacteria 10690
123 Ga0207657_10008364 3300025919 Bacteria 10507
124 Ga0207657_10030873 3300025919 Bacteria 4857
125 Ga0207694_10000119 3300025924 Bacteria 83771
126 Ga0207694_10050607 3300025924 Bacteria 3218
127 Ga0207694_10232266 3300025924 Bacteria 1506
128 Ga0207694_10455293 3300025924 Unclassified 1068
129 Ga0207650_10034864 3300025925 Bacteria 3651
130 Ga0207700_10639245 3300025928 Bacteria 948
131 Ga0207664_10308198 3300025929 Bacteria 1394
132 Ga0207644_10040337 3300025931 Bacteria 3299
133 Ga0207690_10021060 3300025932 Bacteria 4039
134 Ga0207706_10006029 3300025933 Bacteria 11274
135 Ga0207669_10464558 3300025937 Bacteria 1005
136 Ga0207704_10191419 3300025938 Bacteria 1488
137 Ga0207665_10000407 3300025939 Bacteria 29572
138 Ga0207665_10112100 3300025939 Bacteria 1918
139 Ga0207691_10067244 3300025940 Bacteria 3240
140 Ga0207661_10116226 3300025944 Bacteria 2271
141 Ga0207667_10001159 3300025949 Bacteria 33115
142 Ga0207667_10011792 3300025949 Bacteria 10126
143 Ga0207667_10014365 3300025949 Bacteria 9031
144 Ga0207667_10104515 3300025949 Bacteria 2921
145 Ga0207667_10123972 3300025949 Bacteria 2662
146 Ga0207667_10223197 3300025949 Bacteria 1930
147 Ga0207667_10254931 3300025949 Bacteria 1795
148 Ga0207668_10165862 3300025972 Bacteria 1726
149 Ga0207640_10009833 3300025981 Bacteria 5365
150 Ga0207640_10048633 3300025981 Bacteria 2742
151 Ga0207658_10092751 3300025986 Bacteria 2346
152 Ga0207703_10129365 3300026035 Bacteria 2178
153 Ga0207703_10385564 3300026035 Bacteria 1297
154 Ga0207639_10274024 3300026041 Bacteria 1481
155 Ga0207639_10574899 3300026041 Bacteria 1037
156 Ga0207678_10004746 3300026067 Bacteria 12210
157 Ga0207708_10062938 3300026075 Bacteria 2834
158 Ga0207702_10000002 3300026078 Bacteria 491507
159 Ga0207702_10000128 3300026078 Bacteria 89386
160 Ga0207702_10000244 3300026078 Bacteria 63493
161 Ga0207702_10000432 3300026078 Bacteria 47878
162 Ga0207648_10084202 3300026089 Bacteria 2773
163 Ga0207676_10043823 3300026095 Bacteria 3447
164 Ga0207674_10001403 3300026116 Bacteria 31095
165 Ga0207674_10014341 3300026116 Bacteria 8756
166 Ga0207675_100022204 3300026118 Bacteria 5909
167 Ga0207683_10077383 3300026121 Bacteria 2946
168 Ga0207698_10041407 3300026142 Bacteria 3432
169 Ga0207698_10146731 3300026142 Bacteria 2041
170 Ga0209813_10015355 3300027866 Bacteria 2073
171 Ga0268266_10465302 3300028379 Bacteria 1203
172 Ga0268264_10144795 3300028381 Bacteria 2123
173 Ga0265326_10008052 3300028558 Bacteria 3196
174 Ga0265319_1027058 3300028563 Bacteria 2038
175 Ga0265334_10001696 3300028573 Bacteria 10529
176 Ga0265322_10001590 3300028654 Bacteria 7289
177 Ga0265336_10000008 3300028666 Bacteria 336082
178 Ga0265336_10000135 3300028666 Bacteria 52478
179 Ga0307515_10197034 3300028794 Bacteria 1903
180 Ga0265338_10000034 3300028800 Bacteria 244623
181 Ga0265338_10164700 3300028800 Bacteria 1708
182 Ga0265324_10004339 3300029957 Bacteria 6458
183 Ga0265327_10000225 3300031251 Bacteria 115061
184 Ga0307513_10159773 3300031456 Bacteria 2148
185 Ga0307508_10022377 3300031616 Bacteria 5746
186 Ga0307516_10000060 3300031730 Bacteria 118638
187 Ga0307516_10027386 3300031730 Bacteria 5779
188 Ga0307413_10172782 3300031824 Bacteria 1531
189 Ga0307410_10183066 3300031852 Bacteria 1587
190 Ga0307412_10150727 3300031911 Bacteria 1715
191 Ga0307409_100155556 3300031995 Bacteria 1991
192 Ga0307414_10108530 3300032004 Bacteria 2106
193 Ga0307415_100160608 3300032126 Bacteria 1741
194 Ga0307510_10047128 3300033180 Bacteria 4623
195 Ga0373931_0008073 3300035691 Bacteria 4982
196 Ga0373931_0086197 3300035691 Bacteria 1742
197 Ga0395900_0130125 3300037418 Bacteria 2580
198 Ga0395898_0021688 3300037466 Bacteria 6511
199 Ga0395898_0363548 3300037466 Bacteria 1380
200 Ga0395905_0484108 3300037471 Bacteria 1137
201 Ga0395905_0957580 3300037471 Bacteria 759
202 Ga0395901_0001198 3300038443 Bacteria 27598
203 Ga0436361_0687601 3300039447 Bacteria 3369
204 Ga0436363_1095038 3300039450 Bacteria 4701
205 Ga0451853_0483640 3300041512 Bacteria 788
206 Ga0466969_0024761 3300044656 Bacteria 3087
207 Ga0466972_0060016 3300044658 Bacteria 1825
208 Ga0466965_0061408 3300044683 Bacteria 1878
209 Ga0466961_0246869 3300044693 Bacteria 1096
210 Ga0466963_0058819 3300044694 Bacteria 2564
211 Ga0466963_0179887 3300044694 Bacteria 1476
212 Ga0466963_0245040 3300044694 Bacteria 1257
213 Ga0466963_0346702 3300044694 Unclassified 1046
214 Ga0466971_0037921 3300044719 Bacteria 2161
215 Ga0466970_0009106 3300044765 Bacteria 5010
216 Ga0466957_0025379 3300044842 Bacteria 3512
217 Ga0466957_0443819 3300044842 Bacteria 893
218 Ga0466960_0009499 3300044901 Bacteria 4012
219 Ga0466959_0059550 3300045049 Bacteria 2781
220 Ga0466959_0145460 3300045049 Bacteria 1673
221 Ga0466958_0006865 3300045836 Bacteria 6223
222 Ga0466967_0091246 3300045976 Bacteria 2768
223 Ga0466967_0807606 3300045976 Bacteria 931
224 Ga0495629_0056500 3300046459 Bacteria 2744
225 Ga0495638_0005277 3300046460 Bacteria 9656
226 Ga0495638_0008841 3300046460 Bacteria 7110
227 Ga0495580_0138344 3300046472 Bacteria 1688
228 Ga0495606_0003759 3300046507 Bacteria 15784
229 Ga0495610_0020734 3300046512 Bacteria 3641
230 Ga0495616_0026432 3300046513 Bacteria 3090
231 Ga0495643_0052052 3300046522 Bacteria 2200
232 Ga0495648_0172820 3300046524 Bacteria 1106
233 Ga0495666_0000016 3300046526 Bacteria 68631
234 Ga0495621_0094622 3300046539 Bacteria 1130
235 Ga0495622_0000045 3300046557 Bacteria 114324
236 Ga0495622_0018702 3300046557 Bacteria 3227
237 Ga0495625_0068896 3300046660 Bacteria 2486
238 Ga0495661_0030247 3300046665 Bacteria 3450
239 Ga0495588_0074893 3300046674 Bacteria 1763
240 Ga0495669_0033014 3300046684 Bacteria 2277
241 Ga0495649_0000396 3300046694 Bacteria 37744
242 Ga0495589_0011393 3300046794 Bacteria 4618
243 Ga0495604_0400801 3300047317 Bacteria 904
244 Ga0495674_0010710 3300047319 Bacteria 8674
245 Ga0495686_0011260 3300047472 Bacteria 6306
246 Ga0495686_0016769 3300047472 Bacteria 4955
247 Ga0495686_0446525 3300047472 Bacteria 688
248 Ga0495626_0140571 3300048091 Bacteria 1024
249 Ga0496101_0067225 3300048904 Bacteria 2616
250 Ga0496106_0057143 3300048909 Bacteria 2950
251 Ga0496106_0099104 3300048909 Bacteria 2259
252 Ga0496108_0421362 3300048911 Bacteria 1166
253 Ga0496114_0035986 3300048917 Bacteria 4091
254 Ga0496114_0792732 3300048917 Bacteria 826
255 Ga0496116_0042143 3300048919 Bacteria 3124
256 Ga0496117_0062861 3300048920 Bacteria 2541
257 Ga0496117_0063559 3300048920 Bacteria 2522
258 Ga0496117_0067523 3300048920 Bacteria 2419
259 Ga0496118_0110798 3300048921 Bacteria 1822
260 Ga0496120_0071650 3300048923 Bacteria 1902
261 Ga0496121_0005159 3300048924 Bacteria 16967
262 Ga0496121_0458149 3300048924 Bacteria 820
263 Ga0496122_0069322 3300048925 Bacteria 2526
264 Ga0496122_0186045 3300048925 Bacteria 1232
265 Ga0496123_0079188 3300048926 Bacteria 2009
266 Ga0496125_0008234 3300048928 Bacteria 10959
267 Ga0496125_0225155 3300048928 Bacteria 1204
268 Ga0496126_0206966 3300048929 Bacteria 1653
269 Ga0496126_0338925 3300048929 Bacteria 1232
270 Ga0496126_0546894 3300048929 Bacteria 919
271 Ga0501033_0161294 3300049570 Bacteria 1614
272 Ga0501033_0296231 3300049570 Bacteria 1140
273 Ga0501038_0200637 3300049574 Bacteria 1601
274 Ga0501038_0532981 3300049574 Bacteria 895
275 Ga0501042_0202534 3300049578 Bacteria 1431
276 Ga0501071_0214673 3300049587 Bacteria 1447
277 Ga0501072_0490569 3300049588 Bacteria 972
278 Ga0501073_0090915 3300049589 Bacteria 2121
279 Ga0501080_0142256 3300049742 Bacteria 2218
280 Ga0501083_0059432 3300049744 Bacteria 2557
281 Ga0501044_0125382 3300049823 Bacteria 2566
282 nmdc:mga03n38_10272_c1 3300050490 Bacteria 3435
283 nmdc:mga03n38_31494_c1 3300050490 Bacteria 2238
284 nmdc:mga00v17_12825_c1 3300050491 Bacteria 4634
285 nmdc:mga0yw44_342847_c1 3300050492 Bacteria 1005
286 nmdc:mga06z11_126961_c1 3300050494 Bacteria 1428
287 nmdc:mga06z11_46749_c1 3300050494 Bacteria 2195
288 nmdc:mga04h51_10452_c1 3300050495 Bacteria 2549
289 nmdc:mga07m45_18985_c1 3300050496 Bacteria 3720
290 nmdc:mga05p37_37524_c1 3300050507 Bacteria 5942
291 nmdc:mga0n895_12644_c1 3300050512 Bacteria 7577
292 Ga0500635_0011870 3300053080 Bacteria 2487
293 Ga0500643_027379 3300053087 Bacteria 1773
294 Ga0500644_0054269 3300053088 Bacteria 1386
295 Ga0500581_083549 3300053089 Bacteria 1591
296 Ga0500651_0215295 3300053093 Bacteria 1128
297 Ga0500566_0000370 3300053094 Bacteria 24642
298 Ga0500650_0000365 3300053098 Bacteria 10988
299 Ga0500556_0000468 3300053104 Bacteria 28502
300 Ga0500562_017886 3300053108 Bacteria 1829
301 Ga0500562_103495 3300053108 Bacteria 775
302 Ga0500592_005556 3300053116 Bacteria 2008
303 Ga0500595_017788 3300053119 Bacteria 2615
304 Ga0500595_028661 3300053119 Bacteria 1897
305 Ga0500608_055243 3300053122 Bacteria 1904
306 Ga0500642_0000019 3300053130 Bacteria 159944
307 Ga0500658_0320360 3300053134 Bacteria 712
308 Ga0500559_0001011 3300053136 Bacteria 17309
309 Ga0500568_0031207 3300053139 Bacteria 2200
310 Ga0500590_087912 3300053148 Bacteria 1514
311 Ga0500616_0000041 3300053153 Bacteria 359328
312 Ga0500622_0004419 3300053156 Bacteria 8842
313 Ga0500633_0052974 3300053160 Bacteria 1406
314 Ga0500636_0075535 3300053177 Bacteria 1949
315 Ga0500636_0130468 3300053177 Bacteria 1400
316 Ga0500637_0086448 3300053178 Bacteria 1813
317 Ga0500570_145243 3300053724 Bacteria 860
318 Ga0500596_009332 3300053735 Bacteria 1534
319 Ga0501082_0131831 3300060353 Bacteria 2169
320 Ga0466962_0006644 3300061719 Bacteria 5550
321 Ga0466962_0033810 3300061719 Bacteria 2447
322 2548497194 2547132374 Bacteria 5530232
323 2603860910 2602042107 Bacteria 6226103
324 2644060535 2643221609 Bacteria 6756331
325 2644106340 2643221618 Bacteria 7717186
326 2644308417 2643221655 Bacteria 7722067
327 2644331782 2643221659 Bacteria 7890716
328 2644542162 2643221698 Bacteria 7756764
329 2644615610 2643221712 Bacteria 7729434
330 2844166818 2844163670 Bacteria 7266046
331 2855732075 2855730933 Bacteria 7047938
332 2855768782 2855767633 Bacteria 7049357
333 2881415266 2881412998 Bacteria 6492157
334 2893069159 2893066018 Bacteria 6158120
335 2895395719 2895395659 Bacteria 3983269
336 2906627331 2906626472 Bacteria 8826946
337 2919078520 2919073203 Bacteria 6531949
338 8016594320 8016583857 Bacteria 10421953
339 Ga0157374_10047410
340 JGI25156J39149_1000212
341 JGI25154J39366_1001959
342 JGI25157J39369_1000075
343 JGI25151J46595_10000190
344 rootH1_10009260
345 rootH1_10053130
346 rootH2_10222366
347 rootH1_10031052
348 Ga0055529_1001167
349 Ga0055540_1002816
350 Ga0070676_10460481
351 Ga0070680_100049153
352 Ga0070680_100673579
353 Ga0070660_100022011
354 Ga0070660_100058223
355 Ga0070689_100315857
356 Ga0070692_10017873
357 Ga0070688_100317937
358 Ga0070659_100014508
359 Ga0070709_10042323
360 Ga0070701_10010032
361 Ga0070700_100041671
362 Ga0070663_100017625
363 Ga0070678_100044222
364 Ga0070662_100133133
365 Ga0070681_10018314
366 Ga0070681_10625685
367 Ga0070706_100213045
368 Ga0070684_100166983
369 Ga0068853_100037059
370 Ga0070695_100156900
371 Ga0070665_100091930
372 Ga0070704_100165446
373 Ga0068855_100003502
374 Ga0068855_100004310
375 Ga0068855_100082686
376 Ga0068855_100110208
377 Ga0068855_100214447
378 Ga0068855_100459968
379 Ga0068857_100002629
380 Ga0068857_100272111
381 Ga0068854_100002212
382 Ga0068854_100036051
383 Ga0068856_100000871
384 Ga0068852_100039527
385 Ga0068852_100204822
386 Ga0068852_100552978
387 Ga0068866_10003204
388 Ga0068851_10002001
389 Ga0068851_10005246
390 Ga0068851_10298973
391 Ga0068863_100366435
392 Ga0068858_100240714
393 Ga0068862_100308630
394 Ga0075365_10003306
395 Ga0075363_100051172
396 Ga0075364_10006610
397 Ga0075364_10444675
398 Ga0070716_100241464
399 Ga0070712_100000982
400 Ga0075367_10051743
401 Ga0075367_10132026
402 Ga0075366_10031342
403 Ga0097621_100154441
404 Ga0068871_100183479
405 Ga0105240_10017256
406 Ga0105240_10021697
407 Ga0105240_10048021
408 Ga0111539_10022111
409 Ga0114129_10792718
410 Ga0105241_10026612
411 Ga0105242_10044092
412 Ga0105248_10197764
413 Ga0105237_10064124
414 Ga0105238_10002530
415 Ga0105238_10274644
416 Ga0105239_10375509
417 Ga0105246_10033754
418 Ga0157370_10506101
419 Ga0157369_10016991
420 Ga0157378_10106390
421 Ga0163162_10236550
422 Ga0157372_10004754
423 Ga0157380_10046086
424 Ga0157379_10015135
425 Ga0157376_10281386
426 Ga0206356_10172038
427 Ga0209258_100162
428 Ga0209646_1000066
429 Ga0209026_1000027
430 Ga0209677_100128
431 Ga0209759_1000387
432 Ga0209759_1000634
433 Ga0209759_1008305
434 Ga0207666_1002957
435 Ga0209455_1000128
436 Ga0209025_1000026
437 Ga0209564_1000385
438 Ga0209051_1000354
439 Ga0209051_1031762
440 Ga0207697_10001936
441 Ga0207656_10026678
442 Ga0207682_10000740
443 Ga0207692_10055970
444 Ga0207642_10056877
445 Ga0207688_10000602
446 Ga0207647_10093788
447 Ga0207643_10000480
448 Ga0207705_10468168
449 Ga0207684_10407945
450 Ga0207654_10000757
451 Ga0207707_10267086
452 Ga0207695_10000424
453 Ga0207695_10077313
454 Ga0207671_10098128
455 Ga0207693_10000649
456 Ga0207660_10223068
457 Ga0207662_10003173
458 Ga0207657_10008136
459 Ga0207657_10008364
460 Ga0207657_10030873
461 Ga0207694_10000119
462 Ga0207694_10050607
463 Ga0207694_10232266
464 Ga0207694_10455293
465 Ga0207650_10034864
466 Ga0207700_10639245
467 Ga0207664_10308198
468 Ga0207644_10040337
469 Ga0207690_10021060
470 Ga0207706_10006029
471 Ga0207669_10464558
472 Ga0207704_10191419
473 Ga0207665_10000407
474 Ga0207665_10112100
475 Ga0207691_10067244
476 Ga0207661_10116226
477 Ga0207667_10001159
478 Ga0207667_10011792
479 Ga0207667_10014365
480 Ga0207667_10104515
481 Ga0207667_10123972
482 Ga0207667_10223197
483 Ga0207667_10254931
484 Ga0207668_10165862
485 Ga0207640_10009833
486 Ga0207640_10048633
487 Ga0207658_10092751
488 Ga0207703_10129365
489 Ga0207703_10385564
490 Ga0207639_10274024
491 Ga0207639_10574899
492 Ga0207678_10004746
493 Ga0207708_10062938
494 Ga0207702_10000002
495 Ga0207702_10000128
496 Ga0207702_10000244
497 Ga0207702_10000432
498 Ga0207648_10084202
499 Ga0207676_10043823
500 Ga0207674_10001403
501 Ga0207674_10014341
502 Ga0207675_100022204
503 Ga0207683_10077383
504 Ga0207698_10041407
505 Ga0207698_10146731
506 Ga0209813_10015355
507 Ga0268266_10465302
508 Ga0268264_10144795
509 Ga0265326_10008052
510 Ga0265319_1027058
511 Ga0265334_10001696
512 Ga0265322_10001590
513 Ga0265336_10000008
514 Ga0265336_10000135
515 Ga0307515_10197034
516 Ga0265338_10000034
517 Ga0265338_10164700
518 Ga0265324_10004339
519 Ga0265327_10000225
520 Ga0307513_10159773
521 Ga0307508_10022377
522 Ga0307516_10000060
523 Ga0307516_10027386
524 Ga0307413_10172782
525 Ga0307410_10183066
526 Ga0307412_10150727
527 Ga0307409_100155556
528 Ga0307414_10108530
529 Ga0307415_100160608
530 Ga0307510_10047128
531 Ga0373931_0008073
532 Ga0373931_0086197
533 Ga0395900_0130125
534 Ga0395898_0021688
535 Ga0395898_0363548
536 Ga0395905_0484108
537 Ga0395905_0957580
538 Ga0395901_0001198
539 Ga0436361_0687601
540 Ga0436363_1095038
541 Ga0451853_0483640
542 Ga0466969_0024761
543 Ga0466972_0060016
544 Ga0466965_0061408
545 Ga0466961_0246869
546 Ga0466963_0058819
547 Ga0466963_0179887
548 Ga0466963_0245040
549 Ga0466963_0346702
550 Ga0466971_0037921
551 Ga0466970_0009106
552 Ga0466957_0025379
553 Ga0466957_0443819
554 Ga0466960_0009499
555 Ga0466959_0059550
556 Ga0466959_0145460
557 Ga0466958_0006865
558 Ga0466967_0091246
559 Ga0466967_0807606
560 Ga0495629_0056500
561 Ga0495638_0005277
562 Ga0495638_0008841
563 Ga0495580_0138344
564 Ga0495606_0003759
565 Ga0495610_0020734
566 Ga0495616_0026432
567 Ga0495643_0052052
568 Ga0495648_0172820
569 Ga0495666_0000016
570 Ga0495621_0094622
571 Ga0495622_0000045
572 Ga0495622_0018702
573 Ga0495625_0068896
574 Ga0495661_0030247
575 Ga0495588_0074893
576 Ga0495669_0033014
577 Ga0495649_0000396
578 Ga0495589_0011393
579 Ga0495604_0400801
580 Ga0495674_0010710
581 Ga0495686_0011260
582 Ga0495686_0016769
583 Ga0495686_0446525
584 Ga0495626_0140571
585 Ga0496101_0067225
586 Ga0496106_0057143
587 Ga0496106_0099104
588 Ga0496108_0421362
589 Ga0496114_0035986
590 Ga0496114_0792732
591 Ga0496116_0042143
592 Ga0496117_0062861
593 Ga0496117_0063559
594 Ga0496117_0067523
595 Ga0496118_0110798
596 Ga0496120_0071650
597 Ga0496121_0005159
598 Ga0496121_0458149
599 Ga0496122_0069322
600 Ga0496122_0186045
601 Ga0496123_0079188
602 Ga0496125_0008234
603 Ga0496125_0225155
604 Ga0496126_0206966
605 Ga0496126_0338925
606 Ga0496126_0546894
607 Ga0501033_0161294
608 Ga0501033_0296231
609 Ga0501038_0200637
610 Ga0501038_0532981
611 Ga0501042_0202534
612 Ga0501071_0214673
613 Ga0501072_0490569
614 Ga0501073_0090915
615 Ga0501080_0142256
616 Ga0501083_0059432
617 Ga0501044_0125382
618 nmdc:mga03n38_10272_c1
619 nmdc:mga03n38_31494_c1
620 nmdc:mga00v17_12825_c1
621 nmdc:mga0yw44_342847_c1
622 nmdc:mga06z11_126961_c1
623 nmdc:mga06z11_46749_c1
624 nmdc:mga04h51_10452_c1
625 nmdc:mga07m45_18985_c1
626 nmdc:mga05p37_37524_c1
627 nmdc:mga0n895_12644_c1
628 Ga0500635_0011870
629 Ga0500643_027379
630 Ga0500644_0054269
631 Ga0500581_083549
632 Ga0500651_0215295
633 Ga0500566_0000370
634 Ga0500650_0000365
635 Ga0500556_0000468
636 Ga0500562_017886
637 Ga0500562_103495
638 Ga0500592_005556
639 Ga0500595_017788
640 Ga0500595_028661
641 Ga0500608_055243
642 Ga0500642_0000019
643 Ga0500658_0320360
644 Ga0500559_0001011
645 Ga0500568_0031207
646 Ga0500590_087912
647 Ga0500616_0000041
648 Ga0500622_0004419
649 Ga0500633_0052974
650 Ga0500636_0075535
651 Ga0500636_0130468
652 Ga0500637_0086448
653 Ga0500570_145243
654 Ga0500596_009332
655 Ga0501082_0131831
656 Ga0466962_0006644
657 Ga0466962_0033810
658 2548497194
659 2603860910
660 2644060535
661 2644106340
662 2644308417
663 2644331782
664 2644542162
665 2644615610
666 2844166818
667 2855732075
668 2855768782
669 2881415266
670 2893069159
671 2895395719
672 2906627331
673 2919078520
674 8016594320

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

50

242

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bkz-assembly1.cif.gz_A x-ray structure of e coli alkb crosslinked to dsdna in the active site 0.9892 18 215
2fdf-assembly1.cif.gz_A crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9876 18 216
3khc-assembly1.cif.gz_B crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion 0.9873 14 215
2fdf-assembly1.cif.gz_A crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9827 18 216
4zhn-assembly1.cif.gz_A crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9756 18 215
ID Description Score Start End Superfamily
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9682 18 217 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9493 18 217 2.60.120.590
af_Q13686_178_346_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9043 91 215 2.60.120.590
af_C6TKW1_99_311_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8871 18 214 2.60.120.590
af_A0A1Q0YC58_8_168_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8723 82 215 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A534BW94-F1-model_v4 DNA oxidative demethylase AlkB (EC 1.14.11.33) 0.9992 60 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A6I1W1U9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9991 49 141 GO:0051213
AF-A0A2W0BF37-F1-model_v4 DNA oxidative demethylase AlkB 0.9974 63 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A537DLG2-F1-model_v4 DNA oxidative demethylase AlkB (EC 1.14.11.33) 0.9971 14 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A645H2Q6-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB (EC 1.14.11.33) 0.9969 95 216 GO:0005737
GO:0006281
GO:0008198
GO:0016020
GO:0035513
GO:0035515
GO:0035516

Map