F412663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 336 | 259 | 674 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10047410|Ga0157374_100474104 |
| Length | 245 |
| Sequence | MISPKDLNSATDNTAATRRTVNARGDQILTFDLFGDETPKGSEREIMAPGATLLRGYALPSEAELLAAIAQIAADAPFRHMTTPGGFVMSVAMTNCGKVGWVTDRKGYRYDPLDPESGKSWPQMPASFSELAAGAAQAAGYPEFEPDACLINRYEPGARMSLHQDKDEKDFEQPIVSVSLGLPAVFQFGGAKRTDPVTKYALRHGDVVVWGGPSRAFYHGVPTLKEGDHPKLGRRRLNLTFRKAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 138 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 152 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 153 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 189 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 192 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 193 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 194 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 210 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 213 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 214 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 218 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 219 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 220 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 223 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 224 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 225 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 226 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 227 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 229 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 230 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 234 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 236 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 237 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 239 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 240 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 243 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 244 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 245 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 246 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 247 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 248 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 249 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 250 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 251 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 252 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 253 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 254 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 255 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 256 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 257 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 258 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 259 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.64 |
| Metatranscriptomes | 0.3 |
| Isolates | 5.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.77 |
| Nodule | 0.89 |
| Rhizoplane | 2.08 |
| Rhizosphere | 66.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157374_10047410 | 3300013296 | Bacteria | 3984 |
| 2 | JGI25156J39149_1000212 | 3300002705 | Bacteria | 40452 |
| 3 | JGI25154J39366_1001959 | 3300002738 | Bacteria | 6090 |
| 4 | JGI25157J39369_1000075 | 3300002741 | Bacteria | 88169 |
| 5 | JGI25151J46595_10000190 | 3300003187 | Bacteria | 75765 |
| 6 | rootH1_10009260 | 3300003316 | Bacteria | 2036 |
| 7 | rootH1_10009260 | 3300003323 | Bacteria | 16518 |
| 8 | rootH1_10053130 | 3300003316 | Bacteria | 2306 |
| 9 | rootH1_10053130 | 3300003323 | Bacteria | 6288 |
| 10 | rootH2_10222366 | 3300003320 | Bacteria | 1344 |
| 11 | rootH1_10031052 | 3300003323 | Bacteria | 7115 |
| 12 | Ga0055529_1001167 | 3300003763 | Bacteria | 10792 |
| 13 | Ga0055540_1002816 | 3300003792 | Bacteria | 8891 |
| 14 | Ga0070676_10460481 | 3300005328 | Unclassified | 896 |
| 15 | Ga0070680_100049153 | 3300005336 | Bacteria | 3437 |
| 16 | Ga0070680_100673579 | 3300005336 | Bacteria | 890 |
| 17 | Ga0070660_100022011 | 3300005339 | Bacteria | 4709 |
| 18 | Ga0070660_100058223 | 3300005339 | Bacteria | 2995 |
| 19 | Ga0070689_100315857 | 3300005340 | Bacteria | 1303 |
| 20 | Ga0070692_10017873 | 3300005345 | Bacteria | 3399 |
| 21 | Ga0070688_100317937 | 3300005365 | Bacteria | 1130 |
| 22 | Ga0070659_100014508 | 3300005366 | Bacteria | 5889 |
| 23 | Ga0070709_10042323 | 3300005434 | Bacteria | 2812 |
| 24 | Ga0070701_10010032 | 3300005438 | Bacteria | 4173 |
| 25 | Ga0070700_100041671 | 3300005441 | Bacteria | 2815 |
| 26 | Ga0070663_100017625 | 3300005455 | Bacteria | 4665 |
| 27 | Ga0070678_100044222 | 3300005456 | Bacteria | 3179 |
| 28 | Ga0070662_100133133 | 3300005457 | Bacteria | 1919 |
| 29 | Ga0070681_10018314 | 3300005458 | Bacteria | 6999 |
| 30 | Ga0070681_10625685 | 3300005458 | Bacteria | 991 |
| 31 | Ga0070706_100213045 | 3300005467 | Bacteria | 1803 |
| 32 | Ga0070684_100166983 | 3300005535 | Bacteria | 1998 |
| 33 | Ga0068853_100037059 | 3300005539 | Bacteria | 4148 |
| 34 | Ga0070695_100156900 | 3300005545 | Bacteria | 1593 |
| 35 | Ga0070665_100091930 | 3300005548 | Bacteria | 3039 |
| 36 | Ga0070704_100165446 | 3300005549 | Bacteria | 1753 |
| 37 | Ga0068855_100003502 | 3300005563 | Bacteria | 19224 |
| 38 | Ga0068855_100004310 | 3300005563 | Bacteria | 17394 |
| 39 | Ga0068855_100082686 | 3300005563 | Bacteria | 3721 |
| 40 | Ga0068855_100110208 | 3300005563 | Bacteria | 3160 |
| 41 | Ga0068855_100214447 | 3300005563 | Bacteria | 2162 |
| 42 | Ga0068855_100459968 | 3300005563 | Bacteria | 1388 |
| 43 | Ga0068857_100002629 | 3300005577 | Bacteria | 14741 |
| 44 | Ga0068857_100272111 | 3300005577 | Bacteria | 1557 |
| 45 | Ga0068854_100002212 | 3300005578 | Bacteria | 11972 |
| 46 | Ga0068854_100036051 | 3300005578 | Bacteria | 3466 |
| 47 | Ga0068856_100000871 | 3300005614 | Bacteria | 32354 |
| 48 | Ga0068852_100039527 | 3300005616 | Bacteria | 3972 |
| 49 | Ga0068852_100204822 | 3300005616 | Bacteria | 1868 |
| 50 | Ga0068852_100552978 | 3300005616 | Bacteria | 1151 |
| 51 | Ga0068866_10003204 | 3300005718 | Bacteria | 6744 |
| 52 | Ga0068851_10002001 | 3300005834 | Bacteria | 8977 |
| 53 | Ga0068851_10005246 | 3300005834 | Bacteria | 5880 |
| 54 | Ga0068851_10298973 | 3300005834 | Bacteria | 925 |
| 55 | Ga0068863_100366435 | 3300005841 | Bacteria | 1405 |
| 56 | Ga0068858_100240714 | 3300005842 | Bacteria | 1717 |
| 57 | Ga0068862_100308630 | 3300005844 | Bacteria | 1457 |
| 58 | Ga0075365_10003306 | 3300006038 | Bacteria | 8275 |
| 59 | Ga0075363_100051172 | 3300006048 | Bacteria | 2202 |
| 60 | Ga0075364_10006610 | 3300006051 | Bacteria | 6827 |
| 61 | Ga0075364_10444675 | 3300006051 | Bacteria | 885 |
| 62 | Ga0070716_100241464 | 3300006173 | Bacteria | 1225 |
| 63 | Ga0070712_100000982 | 3300006175 | Bacteria | 17141 |
| 64 | Ga0075367_10051743 | 3300006178 | Bacteria | 2429 |
| 65 | Ga0075367_10132026 | 3300006178 | Bacteria | 1544 |
| 66 | Ga0075366_10031342 | 3300006195 | Bacteria | 3128 |
| 67 | Ga0097621_100154441 | 3300006237 | Bacteria | 1969 |
| 68 | Ga0068871_100183479 | 3300006358 | Bacteria | 1799 |
| 69 | Ga0105240_10017256 | 3300009093 | Bacteria | 9738 |
| 70 | Ga0105240_10021697 | 3300009093 | Bacteria | 8537 |
| 71 | Ga0105240_10048021 | 3300009093 | Bacteria | 5397 |
| 72 | Ga0111539_10022111 | 3300009094 | Bacteria | 7816 |
| 73 | Ga0114129_10792718 | 3300009147 | Bacteria | 1209 |
| 74 | Ga0105241_10026612 | 3300009174 | Bacteria | 4305 |
| 75 | Ga0105242_10044092 | 3300009176 | Bacteria | 3610 |
| 76 | Ga0105248_10197764 | 3300009177 | Bacteria | 2265 |
| 77 | Ga0105237_10064124 | 3300009545 | Bacteria | 3671 |
| 78 | Ga0105238_10002530 | 3300009551 | Bacteria | 18269 |
| 79 | Ga0105238_10274644 | 3300009551 | Bacteria | 1666 |
| 80 | Ga0105239_10375509 | 3300010375 | Bacteria | 1607 |
| 81 | Ga0105246_10033754 | 3300011119 | Bacteria | 3404 |
| 82 | Ga0157370_10506101 | 3300013104 | Bacteria | 1109 |
| 83 | Ga0157369_10016991 | 3300013105 | Bacteria | 8178 |
| 84 | Ga0157378_10106390 | 3300013297 | Bacteria | 2566 |
| 85 | Ga0163162_10236550 | 3300013306 | Bacteria | 1957 |
| 86 | Ga0157372_10004754 | 3300013307 | Bacteria | 14419 |
| 87 | Ga0157380_10046086 | 3300014326 | Bacteria | 3423 |
| 88 | Ga0157379_10015135 | 3300014968 | Bacteria | 6766 |
| 89 | Ga0157376_10281386 | 3300014969 | Bacteria | 1567 |
| 90 | Ga0206356_10172038 | 3300020070 | Bacteria | 1309 |
| 91 | Ga0209258_100162 | 3300025242 | Bacteria | 151725 |
| 92 | Ga0209646_1000066 | 3300025246 | Bacteria | 244823 |
| 93 | Ga0209026_1000027 | 3300025250 | Bacteria | 351282 |
| 94 | Ga0209677_100128 | 3300025253 | Bacteria | 76547 |
| 95 | Ga0209759_1000387 | 3300025256 | Bacteria | 55041 |
| 96 | Ga0209759_1000634 | 3300025256 | Bacteria | 33022 |
| 97 | Ga0209759_1008305 | 3300025256 | Bacteria | 3249 |
| 98 | Ga0207666_1002957 | 3300025271 | Bacteria | 2066 |
| 99 | Ga0209455_1000128 | 3300025272 | Bacteria | 162413 |
| 100 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 101 | Ga0209564_1000385 | 3300025295 | Bacteria | 80273 |
| 102 | Ga0209051_1000354 | 3300025303 | Bacteria | 68119 |
| 103 | Ga0209051_1031762 | 3300025303 | Bacteria | 2026 |
| 104 | Ga0207697_10001936 | 3300025315 | Bacteria | 10998 |
| 105 | Ga0207656_10026678 | 3300025321 | Bacteria | 2357 |
| 106 | Ga0207682_10000740 | 3300025893 | Bacteria | 15117 |
| 107 | Ga0207692_10055970 | 3300025898 | Bacteria | 2021 |
| 108 | Ga0207642_10056877 | 3300025899 | Bacteria | 1796 |
| 109 | Ga0207688_10000602 | 3300025901 | Bacteria | 17683 |
| 110 | Ga0207647_10093788 | 3300025904 | Bacteria | 1789 |
| 111 | Ga0207643_10000480 | 3300025908 | Bacteria | 25852 |
| 112 | Ga0207705_10468168 | 3300025909 | Bacteria | 978 |
| 113 | Ga0207684_10407945 | 3300025910 | Bacteria | 1168 |
| 114 | Ga0207654_10000757 | 3300025911 | Bacteria | 17843 |
| 115 | Ga0207707_10267086 | 3300025912 | Bacteria | 1483 |
| 116 | Ga0207695_10000424 | 3300025913 | Bacteria | 93657 |
| 117 | Ga0207695_10077313 | 3300025913 | Bacteria | 3381 |
| 118 | Ga0207671_10098128 | 3300025914 | Bacteria | 2216 |
| 119 | Ga0207693_10000649 | 3300025915 | Bacteria | 31124 |
| 120 | Ga0207660_10223068 | 3300025917 | Bacteria | 1480 |
| 121 | Ga0207662_10003173 | 3300025918 | Bacteria | 8407 |
| 122 | Ga0207657_10008136 | 3300025919 | Bacteria | 10690 |
| 123 | Ga0207657_10008364 | 3300025919 | Bacteria | 10507 |
| 124 | Ga0207657_10030873 | 3300025919 | Bacteria | 4857 |
| 125 | Ga0207694_10000119 | 3300025924 | Bacteria | 83771 |
| 126 | Ga0207694_10050607 | 3300025924 | Bacteria | 3218 |
| 127 | Ga0207694_10232266 | 3300025924 | Bacteria | 1506 |
| 128 | Ga0207694_10455293 | 3300025924 | Unclassified | 1068 |
| 129 | Ga0207650_10034864 | 3300025925 | Bacteria | 3651 |
| 130 | Ga0207700_10639245 | 3300025928 | Bacteria | 948 |
| 131 | Ga0207664_10308198 | 3300025929 | Bacteria | 1394 |
| 132 | Ga0207644_10040337 | 3300025931 | Bacteria | 3299 |
| 133 | Ga0207690_10021060 | 3300025932 | Bacteria | 4039 |
| 134 | Ga0207706_10006029 | 3300025933 | Bacteria | 11274 |
| 135 | Ga0207669_10464558 | 3300025937 | Bacteria | 1005 |
| 136 | Ga0207704_10191419 | 3300025938 | Bacteria | 1488 |
| 137 | Ga0207665_10000407 | 3300025939 | Bacteria | 29572 |
| 138 | Ga0207665_10112100 | 3300025939 | Bacteria | 1918 |
| 139 | Ga0207691_10067244 | 3300025940 | Bacteria | 3240 |
| 140 | Ga0207661_10116226 | 3300025944 | Bacteria | 2271 |
| 141 | Ga0207667_10001159 | 3300025949 | Bacteria | 33115 |
| 142 | Ga0207667_10011792 | 3300025949 | Bacteria | 10126 |
| 143 | Ga0207667_10014365 | 3300025949 | Bacteria | 9031 |
| 144 | Ga0207667_10104515 | 3300025949 | Bacteria | 2921 |
| 145 | Ga0207667_10123972 | 3300025949 | Bacteria | 2662 |
| 146 | Ga0207667_10223197 | 3300025949 | Bacteria | 1930 |
| 147 | Ga0207667_10254931 | 3300025949 | Bacteria | 1795 |
| 148 | Ga0207668_10165862 | 3300025972 | Bacteria | 1726 |
| 149 | Ga0207640_10009833 | 3300025981 | Bacteria | 5365 |
| 150 | Ga0207640_10048633 | 3300025981 | Bacteria | 2742 |
| 151 | Ga0207658_10092751 | 3300025986 | Bacteria | 2346 |
| 152 | Ga0207703_10129365 | 3300026035 | Bacteria | 2178 |
| 153 | Ga0207703_10385564 | 3300026035 | Bacteria | 1297 |
| 154 | Ga0207639_10274024 | 3300026041 | Bacteria | 1481 |
| 155 | Ga0207639_10574899 | 3300026041 | Bacteria | 1037 |
| 156 | Ga0207678_10004746 | 3300026067 | Bacteria | 12210 |
| 157 | Ga0207708_10062938 | 3300026075 | Bacteria | 2834 |
| 158 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 159 | Ga0207702_10000128 | 3300026078 | Bacteria | 89386 |
| 160 | Ga0207702_10000244 | 3300026078 | Bacteria | 63493 |
| 161 | Ga0207702_10000432 | 3300026078 | Bacteria | 47878 |
| 162 | Ga0207648_10084202 | 3300026089 | Bacteria | 2773 |
| 163 | Ga0207676_10043823 | 3300026095 | Bacteria | 3447 |
| 164 | Ga0207674_10001403 | 3300026116 | Bacteria | 31095 |
| 165 | Ga0207674_10014341 | 3300026116 | Bacteria | 8756 |
| 166 | Ga0207675_100022204 | 3300026118 | Bacteria | 5909 |
| 167 | Ga0207683_10077383 | 3300026121 | Bacteria | 2946 |
| 168 | Ga0207698_10041407 | 3300026142 | Bacteria | 3432 |
| 169 | Ga0207698_10146731 | 3300026142 | Bacteria | 2041 |
| 170 | Ga0209813_10015355 | 3300027866 | Bacteria | 2073 |
| 171 | Ga0268266_10465302 | 3300028379 | Bacteria | 1203 |
| 172 | Ga0268264_10144795 | 3300028381 | Bacteria | 2123 |
| 173 | Ga0265326_10008052 | 3300028558 | Bacteria | 3196 |
| 174 | Ga0265319_1027058 | 3300028563 | Bacteria | 2038 |
| 175 | Ga0265334_10001696 | 3300028573 | Bacteria | 10529 |
| 176 | Ga0265322_10001590 | 3300028654 | Bacteria | 7289 |
| 177 | Ga0265336_10000008 | 3300028666 | Bacteria | 336082 |
| 178 | Ga0265336_10000135 | 3300028666 | Bacteria | 52478 |
| 179 | Ga0307515_10197034 | 3300028794 | Bacteria | 1903 |
| 180 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 181 | Ga0265338_10164700 | 3300028800 | Bacteria | 1708 |
| 182 | Ga0265324_10004339 | 3300029957 | Bacteria | 6458 |
| 183 | Ga0265327_10000225 | 3300031251 | Bacteria | 115061 |
| 184 | Ga0307513_10159773 | 3300031456 | Bacteria | 2148 |
| 185 | Ga0307508_10022377 | 3300031616 | Bacteria | 5746 |
| 186 | Ga0307516_10000060 | 3300031730 | Bacteria | 118638 |
| 187 | Ga0307516_10027386 | 3300031730 | Bacteria | 5779 |
| 188 | Ga0307413_10172782 | 3300031824 | Bacteria | 1531 |
| 189 | Ga0307410_10183066 | 3300031852 | Bacteria | 1587 |
| 190 | Ga0307412_10150727 | 3300031911 | Bacteria | 1715 |
| 191 | Ga0307409_100155556 | 3300031995 | Bacteria | 1991 |
| 192 | Ga0307414_10108530 | 3300032004 | Bacteria | 2106 |
| 193 | Ga0307415_100160608 | 3300032126 | Bacteria | 1741 |
| 194 | Ga0307510_10047128 | 3300033180 | Bacteria | 4623 |
| 195 | Ga0373931_0008073 | 3300035691 | Bacteria | 4982 |
| 196 | Ga0373931_0086197 | 3300035691 | Bacteria | 1742 |
| 197 | Ga0395900_0130125 | 3300037418 | Bacteria | 2580 |
| 198 | Ga0395898_0021688 | 3300037466 | Bacteria | 6511 |
| 199 | Ga0395898_0363548 | 3300037466 | Bacteria | 1380 |
| 200 | Ga0395905_0484108 | 3300037471 | Bacteria | 1137 |
| 201 | Ga0395905_0957580 | 3300037471 | Bacteria | 759 |
| 202 | Ga0395901_0001198 | 3300038443 | Bacteria | 27598 |
| 203 | Ga0436361_0687601 | 3300039447 | Bacteria | 3369 |
| 204 | Ga0436363_1095038 | 3300039450 | Bacteria | 4701 |
| 205 | Ga0451853_0483640 | 3300041512 | Bacteria | 788 |
| 206 | Ga0466969_0024761 | 3300044656 | Bacteria | 3087 |
| 207 | Ga0466972_0060016 | 3300044658 | Bacteria | 1825 |
| 208 | Ga0466965_0061408 | 3300044683 | Bacteria | 1878 |
| 209 | Ga0466961_0246869 | 3300044693 | Bacteria | 1096 |
| 210 | Ga0466963_0058819 | 3300044694 | Bacteria | 2564 |
| 211 | Ga0466963_0179887 | 3300044694 | Bacteria | 1476 |
| 212 | Ga0466963_0245040 | 3300044694 | Bacteria | 1257 |
| 213 | Ga0466963_0346702 | 3300044694 | Unclassified | 1046 |
| 214 | Ga0466971_0037921 | 3300044719 | Bacteria | 2161 |
| 215 | Ga0466970_0009106 | 3300044765 | Bacteria | 5010 |
| 216 | Ga0466957_0025379 | 3300044842 | Bacteria | 3512 |
| 217 | Ga0466957_0443819 | 3300044842 | Bacteria | 893 |
| 218 | Ga0466960_0009499 | 3300044901 | Bacteria | 4012 |
| 219 | Ga0466959_0059550 | 3300045049 | Bacteria | 2781 |
| 220 | Ga0466959_0145460 | 3300045049 | Bacteria | 1673 |
| 221 | Ga0466958_0006865 | 3300045836 | Bacteria | 6223 |
| 222 | Ga0466967_0091246 | 3300045976 | Bacteria | 2768 |
| 223 | Ga0466967_0807606 | 3300045976 | Bacteria | 931 |
| 224 | Ga0495629_0056500 | 3300046459 | Bacteria | 2744 |
| 225 | Ga0495638_0005277 | 3300046460 | Bacteria | 9656 |
| 226 | Ga0495638_0008841 | 3300046460 | Bacteria | 7110 |
| 227 | Ga0495580_0138344 | 3300046472 | Bacteria | 1688 |
| 228 | Ga0495606_0003759 | 3300046507 | Bacteria | 15784 |
| 229 | Ga0495610_0020734 | 3300046512 | Bacteria | 3641 |
| 230 | Ga0495616_0026432 | 3300046513 | Bacteria | 3090 |
| 231 | Ga0495643_0052052 | 3300046522 | Bacteria | 2200 |
| 232 | Ga0495648_0172820 | 3300046524 | Bacteria | 1106 |
| 233 | Ga0495666_0000016 | 3300046526 | Bacteria | 68631 |
| 234 | Ga0495621_0094622 | 3300046539 | Bacteria | 1130 |
| 235 | Ga0495622_0000045 | 3300046557 | Bacteria | 114324 |
| 236 | Ga0495622_0018702 | 3300046557 | Bacteria | 3227 |
| 237 | Ga0495625_0068896 | 3300046660 | Bacteria | 2486 |
| 238 | Ga0495661_0030247 | 3300046665 | Bacteria | 3450 |
| 239 | Ga0495588_0074893 | 3300046674 | Bacteria | 1763 |
| 240 | Ga0495669_0033014 | 3300046684 | Bacteria | 2277 |
| 241 | Ga0495649_0000396 | 3300046694 | Bacteria | 37744 |
| 242 | Ga0495589_0011393 | 3300046794 | Bacteria | 4618 |
| 243 | Ga0495604_0400801 | 3300047317 | Bacteria | 904 |
| 244 | Ga0495674_0010710 | 3300047319 | Bacteria | 8674 |
| 245 | Ga0495686_0011260 | 3300047472 | Bacteria | 6306 |
| 246 | Ga0495686_0016769 | 3300047472 | Bacteria | 4955 |
| 247 | Ga0495686_0446525 | 3300047472 | Bacteria | 688 |
| 248 | Ga0495626_0140571 | 3300048091 | Bacteria | 1024 |
| 249 | Ga0496101_0067225 | 3300048904 | Bacteria | 2616 |
| 250 | Ga0496106_0057143 | 3300048909 | Bacteria | 2950 |
| 251 | Ga0496106_0099104 | 3300048909 | Bacteria | 2259 |
| 252 | Ga0496108_0421362 | 3300048911 | Bacteria | 1166 |
| 253 | Ga0496114_0035986 | 3300048917 | Bacteria | 4091 |
| 254 | Ga0496114_0792732 | 3300048917 | Bacteria | 826 |
| 255 | Ga0496116_0042143 | 3300048919 | Bacteria | 3124 |
| 256 | Ga0496117_0062861 | 3300048920 | Bacteria | 2541 |
| 257 | Ga0496117_0063559 | 3300048920 | Bacteria | 2522 |
| 258 | Ga0496117_0067523 | 3300048920 | Bacteria | 2419 |
| 259 | Ga0496118_0110798 | 3300048921 | Bacteria | 1822 |
| 260 | Ga0496120_0071650 | 3300048923 | Bacteria | 1902 |
| 261 | Ga0496121_0005159 | 3300048924 | Bacteria | 16967 |
| 262 | Ga0496121_0458149 | 3300048924 | Bacteria | 820 |
| 263 | Ga0496122_0069322 | 3300048925 | Bacteria | 2526 |
| 264 | Ga0496122_0186045 | 3300048925 | Bacteria | 1232 |
| 265 | Ga0496123_0079188 | 3300048926 | Bacteria | 2009 |
| 266 | Ga0496125_0008234 | 3300048928 | Bacteria | 10959 |
| 267 | Ga0496125_0225155 | 3300048928 | Bacteria | 1204 |
| 268 | Ga0496126_0206966 | 3300048929 | Bacteria | 1653 |
| 269 | Ga0496126_0338925 | 3300048929 | Bacteria | 1232 |
| 270 | Ga0496126_0546894 | 3300048929 | Bacteria | 919 |
| 271 | Ga0501033_0161294 | 3300049570 | Bacteria | 1614 |
| 272 | Ga0501033_0296231 | 3300049570 | Bacteria | 1140 |
| 273 | Ga0501038_0200637 | 3300049574 | Bacteria | 1601 |
| 274 | Ga0501038_0532981 | 3300049574 | Bacteria | 895 |
| 275 | Ga0501042_0202534 | 3300049578 | Bacteria | 1431 |
| 276 | Ga0501071_0214673 | 3300049587 | Bacteria | 1447 |
| 277 | Ga0501072_0490569 | 3300049588 | Bacteria | 972 |
| 278 | Ga0501073_0090915 | 3300049589 | Bacteria | 2121 |
| 279 | Ga0501080_0142256 | 3300049742 | Bacteria | 2218 |
| 280 | Ga0501083_0059432 | 3300049744 | Bacteria | 2557 |
| 281 | Ga0501044_0125382 | 3300049823 | Bacteria | 2566 |
| 282 | nmdc:mga03n38_10272_c1 | 3300050490 | Bacteria | 3435 |
| 283 | nmdc:mga03n38_31494_c1 | 3300050490 | Bacteria | 2238 |
| 284 | nmdc:mga00v17_12825_c1 | 3300050491 | Bacteria | 4634 |
| 285 | nmdc:mga0yw44_342847_c1 | 3300050492 | Bacteria | 1005 |
| 286 | nmdc:mga06z11_126961_c1 | 3300050494 | Bacteria | 1428 |
| 287 | nmdc:mga06z11_46749_c1 | 3300050494 | Bacteria | 2195 |
| 288 | nmdc:mga04h51_10452_c1 | 3300050495 | Bacteria | 2549 |
| 289 | nmdc:mga07m45_18985_c1 | 3300050496 | Bacteria | 3720 |
| 290 | nmdc:mga05p37_37524_c1 | 3300050507 | Bacteria | 5942 |
| 291 | nmdc:mga0n895_12644_c1 | 3300050512 | Bacteria | 7577 |
| 292 | Ga0500635_0011870 | 3300053080 | Bacteria | 2487 |
| 293 | Ga0500643_027379 | 3300053087 | Bacteria | 1773 |
| 294 | Ga0500644_0054269 | 3300053088 | Bacteria | 1386 |
| 295 | Ga0500581_083549 | 3300053089 | Bacteria | 1591 |
| 296 | Ga0500651_0215295 | 3300053093 | Bacteria | 1128 |
| 297 | Ga0500566_0000370 | 3300053094 | Bacteria | 24642 |
| 298 | Ga0500650_0000365 | 3300053098 | Bacteria | 10988 |
| 299 | Ga0500556_0000468 | 3300053104 | Bacteria | 28502 |
| 300 | Ga0500562_017886 | 3300053108 | Bacteria | 1829 |
| 301 | Ga0500562_103495 | 3300053108 | Bacteria | 775 |
| 302 | Ga0500592_005556 | 3300053116 | Bacteria | 2008 |
| 303 | Ga0500595_017788 | 3300053119 | Bacteria | 2615 |
| 304 | Ga0500595_028661 | 3300053119 | Bacteria | 1897 |
| 305 | Ga0500608_055243 | 3300053122 | Bacteria | 1904 |
| 306 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 307 | Ga0500658_0320360 | 3300053134 | Bacteria | 712 |
| 308 | Ga0500559_0001011 | 3300053136 | Bacteria | 17309 |
| 309 | Ga0500568_0031207 | 3300053139 | Bacteria | 2200 |
| 310 | Ga0500590_087912 | 3300053148 | Bacteria | 1514 |
| 311 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 312 | Ga0500622_0004419 | 3300053156 | Bacteria | 8842 |
| 313 | Ga0500633_0052974 | 3300053160 | Bacteria | 1406 |
| 314 | Ga0500636_0075535 | 3300053177 | Bacteria | 1949 |
| 315 | Ga0500636_0130468 | 3300053177 | Bacteria | 1400 |
| 316 | Ga0500637_0086448 | 3300053178 | Bacteria | 1813 |
| 317 | Ga0500570_145243 | 3300053724 | Bacteria | 860 |
| 318 | Ga0500596_009332 | 3300053735 | Bacteria | 1534 |
| 319 | Ga0501082_0131831 | 3300060353 | Bacteria | 2169 |
| 320 | Ga0466962_0006644 | 3300061719 | Bacteria | 5550 |
| 321 | Ga0466962_0033810 | 3300061719 | Bacteria | 2447 |
| 322 | 2548497194 | 2547132374 | Bacteria | 5530232 |
| 323 | 2603860910 | 2602042107 | Bacteria | 6226103 |
| 324 | 2644060535 | 2643221609 | Bacteria | 6756331 |
| 325 | 2644106340 | 2643221618 | Bacteria | 7717186 |
| 326 | 2644308417 | 2643221655 | Bacteria | 7722067 |
| 327 | 2644331782 | 2643221659 | Bacteria | 7890716 |
| 328 | 2644542162 | 2643221698 | Bacteria | 7756764 |
| 329 | 2644615610 | 2643221712 | Bacteria | 7729434 |
| 330 | 2844166818 | 2844163670 | Bacteria | 7266046 |
| 331 | 2855732075 | 2855730933 | Bacteria | 7047938 |
| 332 | 2855768782 | 2855767633 | Bacteria | 7049357 |
| 333 | 2881415266 | 2881412998 | Bacteria | 6492157 |
| 334 | 2893069159 | 2893066018 | Bacteria | 6158120 |
| 335 | 2895395719 | 2895395659 | Bacteria | 3983269 |
| 336 | 2906627331 | 2906626472 | Bacteria | 8826946 |
| 337 | 2919078520 | 2919073203 | Bacteria | 6531949 |
| 338 | 8016594320 | 8016583857 | Bacteria | 10421953 |
| 339 | Ga0157374_10047410 | |||
| 340 | JGI25156J39149_1000212 | |||
| 341 | JGI25154J39366_1001959 | |||
| 342 | JGI25157J39369_1000075 | |||
| 343 | JGI25151J46595_10000190 | |||
| 344 | rootH1_10009260 | |||
| 345 | rootH1_10053130 | |||
| 346 | rootH2_10222366 | |||
| 347 | rootH1_10031052 | |||
| 348 | Ga0055529_1001167 | |||
| 349 | Ga0055540_1002816 | |||
| 350 | Ga0070676_10460481 | |||
| 351 | Ga0070680_100049153 | |||
| 352 | Ga0070680_100673579 | |||
| 353 | Ga0070660_100022011 | |||
| 354 | Ga0070660_100058223 | |||
| 355 | Ga0070689_100315857 | |||
| 356 | Ga0070692_10017873 | |||
| 357 | Ga0070688_100317937 | |||
| 358 | Ga0070659_100014508 | |||
| 359 | Ga0070709_10042323 | |||
| 360 | Ga0070701_10010032 | |||
| 361 | Ga0070700_100041671 | |||
| 362 | Ga0070663_100017625 | |||
| 363 | Ga0070678_100044222 | |||
| 364 | Ga0070662_100133133 | |||
| 365 | Ga0070681_10018314 | |||
| 366 | Ga0070681_10625685 | |||
| 367 | Ga0070706_100213045 | |||
| 368 | Ga0070684_100166983 | |||
| 369 | Ga0068853_100037059 | |||
| 370 | Ga0070695_100156900 | |||
| 371 | Ga0070665_100091930 | |||
| 372 | Ga0070704_100165446 | |||
| 373 | Ga0068855_100003502 | |||
| 374 | Ga0068855_100004310 | |||
| 375 | Ga0068855_100082686 | |||
| 376 | Ga0068855_100110208 | |||
| 377 | Ga0068855_100214447 | |||
| 378 | Ga0068855_100459968 | |||
| 379 | Ga0068857_100002629 | |||
| 380 | Ga0068857_100272111 | |||
| 381 | Ga0068854_100002212 | |||
| 382 | Ga0068854_100036051 | |||
| 383 | Ga0068856_100000871 | |||
| 384 | Ga0068852_100039527 | |||
| 385 | Ga0068852_100204822 | |||
| 386 | Ga0068852_100552978 | |||
| 387 | Ga0068866_10003204 | |||
| 388 | Ga0068851_10002001 | |||
| 389 | Ga0068851_10005246 | |||
| 390 | Ga0068851_10298973 | |||
| 391 | Ga0068863_100366435 | |||
| 392 | Ga0068858_100240714 | |||
| 393 | Ga0068862_100308630 | |||
| 394 | Ga0075365_10003306 | |||
| 395 | Ga0075363_100051172 | |||
| 396 | Ga0075364_10006610 | |||
| 397 | Ga0075364_10444675 | |||
| 398 | Ga0070716_100241464 | |||
| 399 | Ga0070712_100000982 | |||
| 400 | Ga0075367_10051743 | |||
| 401 | Ga0075367_10132026 | |||
| 402 | Ga0075366_10031342 | |||
| 403 | Ga0097621_100154441 | |||
| 404 | Ga0068871_100183479 | |||
| 405 | Ga0105240_10017256 | |||
| 406 | Ga0105240_10021697 | |||
| 407 | Ga0105240_10048021 | |||
| 408 | Ga0111539_10022111 | |||
| 409 | Ga0114129_10792718 | |||
| 410 | Ga0105241_10026612 | |||
| 411 | Ga0105242_10044092 | |||
| 412 | Ga0105248_10197764 | |||
| 413 | Ga0105237_10064124 | |||
| 414 | Ga0105238_10002530 | |||
| 415 | Ga0105238_10274644 | |||
| 416 | Ga0105239_10375509 | |||
| 417 | Ga0105246_10033754 | |||
| 418 | Ga0157370_10506101 | |||
| 419 | Ga0157369_10016991 | |||
| 420 | Ga0157378_10106390 | |||
| 421 | Ga0163162_10236550 | |||
| 422 | Ga0157372_10004754 | |||
| 423 | Ga0157380_10046086 | |||
| 424 | Ga0157379_10015135 | |||
| 425 | Ga0157376_10281386 | |||
| 426 | Ga0206356_10172038 | |||
| 427 | Ga0209258_100162 | |||
| 428 | Ga0209646_1000066 | |||
| 429 | Ga0209026_1000027 | |||
| 430 | Ga0209677_100128 | |||
| 431 | Ga0209759_1000387 | |||
| 432 | Ga0209759_1000634 | |||
| 433 | Ga0209759_1008305 | |||
| 434 | Ga0207666_1002957 | |||
| 435 | Ga0209455_1000128 | |||
| 436 | Ga0209025_1000026 | |||
| 437 | Ga0209564_1000385 | |||
| 438 | Ga0209051_1000354 | |||
| 439 | Ga0209051_1031762 | |||
| 440 | Ga0207697_10001936 | |||
| 441 | Ga0207656_10026678 | |||
| 442 | Ga0207682_10000740 | |||
| 443 | Ga0207692_10055970 | |||
| 444 | Ga0207642_10056877 | |||
| 445 | Ga0207688_10000602 | |||
| 446 | Ga0207647_10093788 | |||
| 447 | Ga0207643_10000480 | |||
| 448 | Ga0207705_10468168 | |||
| 449 | Ga0207684_10407945 | |||
| 450 | Ga0207654_10000757 | |||
| 451 | Ga0207707_10267086 | |||
| 452 | Ga0207695_10000424 | |||
| 453 | Ga0207695_10077313 | |||
| 454 | Ga0207671_10098128 | |||
| 455 | Ga0207693_10000649 | |||
| 456 | Ga0207660_10223068 | |||
| 457 | Ga0207662_10003173 | |||
| 458 | Ga0207657_10008136 | |||
| 459 | Ga0207657_10008364 | |||
| 460 | Ga0207657_10030873 | |||
| 461 | Ga0207694_10000119 | |||
| 462 | Ga0207694_10050607 | |||
| 463 | Ga0207694_10232266 | |||
| 464 | Ga0207694_10455293 | |||
| 465 | Ga0207650_10034864 | |||
| 466 | Ga0207700_10639245 | |||
| 467 | Ga0207664_10308198 | |||
| 468 | Ga0207644_10040337 | |||
| 469 | Ga0207690_10021060 | |||
| 470 | Ga0207706_10006029 | |||
| 471 | Ga0207669_10464558 | |||
| 472 | Ga0207704_10191419 | |||
| 473 | Ga0207665_10000407 | |||
| 474 | Ga0207665_10112100 | |||
| 475 | Ga0207691_10067244 | |||
| 476 | Ga0207661_10116226 | |||
| 477 | Ga0207667_10001159 | |||
| 478 | Ga0207667_10011792 | |||
| 479 | Ga0207667_10014365 | |||
| 480 | Ga0207667_10104515 | |||
| 481 | Ga0207667_10123972 | |||
| 482 | Ga0207667_10223197 | |||
| 483 | Ga0207667_10254931 | |||
| 484 | Ga0207668_10165862 | |||
| 485 | Ga0207640_10009833 | |||
| 486 | Ga0207640_10048633 | |||
| 487 | Ga0207658_10092751 | |||
| 488 | Ga0207703_10129365 | |||
| 489 | Ga0207703_10385564 | |||
| 490 | Ga0207639_10274024 | |||
| 491 | Ga0207639_10574899 | |||
| 492 | Ga0207678_10004746 | |||
| 493 | Ga0207708_10062938 | |||
| 494 | Ga0207702_10000002 | |||
| 495 | Ga0207702_10000128 | |||
| 496 | Ga0207702_10000244 | |||
| 497 | Ga0207702_10000432 | |||
| 498 | Ga0207648_10084202 | |||
| 499 | Ga0207676_10043823 | |||
| 500 | Ga0207674_10001403 | |||
| 501 | Ga0207674_10014341 | |||
| 502 | Ga0207675_100022204 | |||
| 503 | Ga0207683_10077383 | |||
| 504 | Ga0207698_10041407 | |||
| 505 | Ga0207698_10146731 | |||
| 506 | Ga0209813_10015355 | |||
| 507 | Ga0268266_10465302 | |||
| 508 | Ga0268264_10144795 | |||
| 509 | Ga0265326_10008052 | |||
| 510 | Ga0265319_1027058 | |||
| 511 | Ga0265334_10001696 | |||
| 512 | Ga0265322_10001590 | |||
| 513 | Ga0265336_10000008 | |||
| 514 | Ga0265336_10000135 | |||
| 515 | Ga0307515_10197034 | |||
| 516 | Ga0265338_10000034 | |||
| 517 | Ga0265338_10164700 | |||
| 518 | Ga0265324_10004339 | |||
| 519 | Ga0265327_10000225 | |||
| 520 | Ga0307513_10159773 | |||
| 521 | Ga0307508_10022377 | |||
| 522 | Ga0307516_10000060 | |||
| 523 | Ga0307516_10027386 | |||
| 524 | Ga0307413_10172782 | |||
| 525 | Ga0307410_10183066 | |||
| 526 | Ga0307412_10150727 | |||
| 527 | Ga0307409_100155556 | |||
| 528 | Ga0307414_10108530 | |||
| 529 | Ga0307415_100160608 | |||
| 530 | Ga0307510_10047128 | |||
| 531 | Ga0373931_0008073 | |||
| 532 | Ga0373931_0086197 | |||
| 533 | Ga0395900_0130125 | |||
| 534 | Ga0395898_0021688 | |||
| 535 | Ga0395898_0363548 | |||
| 536 | Ga0395905_0484108 | |||
| 537 | Ga0395905_0957580 | |||
| 538 | Ga0395901_0001198 | |||
| 539 | Ga0436361_0687601 | |||
| 540 | Ga0436363_1095038 | |||
| 541 | Ga0451853_0483640 | |||
| 542 | Ga0466969_0024761 | |||
| 543 | Ga0466972_0060016 | |||
| 544 | Ga0466965_0061408 | |||
| 545 | Ga0466961_0246869 | |||
| 546 | Ga0466963_0058819 | |||
| 547 | Ga0466963_0179887 | |||
| 548 | Ga0466963_0245040 | |||
| 549 | Ga0466963_0346702 | |||
| 550 | Ga0466971_0037921 | |||
| 551 | Ga0466970_0009106 | |||
| 552 | Ga0466957_0025379 | |||
| 553 | Ga0466957_0443819 | |||
| 554 | Ga0466960_0009499 | |||
| 555 | Ga0466959_0059550 | |||
| 556 | Ga0466959_0145460 | |||
| 557 | Ga0466958_0006865 | |||
| 558 | Ga0466967_0091246 | |||
| 559 | Ga0466967_0807606 | |||
| 560 | Ga0495629_0056500 | |||
| 561 | Ga0495638_0005277 | |||
| 562 | Ga0495638_0008841 | |||
| 563 | Ga0495580_0138344 | |||
| 564 | Ga0495606_0003759 | |||
| 565 | Ga0495610_0020734 | |||
| 566 | Ga0495616_0026432 | |||
| 567 | Ga0495643_0052052 | |||
| 568 | Ga0495648_0172820 | |||
| 569 | Ga0495666_0000016 | |||
| 570 | Ga0495621_0094622 | |||
| 571 | Ga0495622_0000045 | |||
| 572 | Ga0495622_0018702 | |||
| 573 | Ga0495625_0068896 | |||
| 574 | Ga0495661_0030247 | |||
| 575 | Ga0495588_0074893 | |||
| 576 | Ga0495669_0033014 | |||
| 577 | Ga0495649_0000396 | |||
| 578 | Ga0495589_0011393 | |||
| 579 | Ga0495604_0400801 | |||
| 580 | Ga0495674_0010710 | |||
| 581 | Ga0495686_0011260 | |||
| 582 | Ga0495686_0016769 | |||
| 583 | Ga0495686_0446525 | |||
| 584 | Ga0495626_0140571 | |||
| 585 | Ga0496101_0067225 | |||
| 586 | Ga0496106_0057143 | |||
| 587 | Ga0496106_0099104 | |||
| 588 | Ga0496108_0421362 | |||
| 589 | Ga0496114_0035986 | |||
| 590 | Ga0496114_0792732 | |||
| 591 | Ga0496116_0042143 | |||
| 592 | Ga0496117_0062861 | |||
| 593 | Ga0496117_0063559 | |||
| 594 | Ga0496117_0067523 | |||
| 595 | Ga0496118_0110798 | |||
| 596 | Ga0496120_0071650 | |||
| 597 | Ga0496121_0005159 | |||
| 598 | Ga0496121_0458149 | |||
| 599 | Ga0496122_0069322 | |||
| 600 | Ga0496122_0186045 | |||
| 601 | Ga0496123_0079188 | |||
| 602 | Ga0496125_0008234 | |||
| 603 | Ga0496125_0225155 | |||
| 604 | Ga0496126_0206966 | |||
| 605 | Ga0496126_0338925 | |||
| 606 | Ga0496126_0546894 | |||
| 607 | Ga0501033_0161294 | |||
| 608 | Ga0501033_0296231 | |||
| 609 | Ga0501038_0200637 | |||
| 610 | Ga0501038_0532981 | |||
| 611 | Ga0501042_0202534 | |||
| 612 | Ga0501071_0214673 | |||
| 613 | Ga0501072_0490569 | |||
| 614 | Ga0501073_0090915 | |||
| 615 | Ga0501080_0142256 | |||
| 616 | Ga0501083_0059432 | |||
| 617 | Ga0501044_0125382 | |||
| 618 | nmdc:mga03n38_10272_c1 | |||
| 619 | nmdc:mga03n38_31494_c1 | |||
| 620 | nmdc:mga00v17_12825_c1 | |||
| 621 | nmdc:mga0yw44_342847_c1 | |||
| 622 | nmdc:mga06z11_126961_c1 | |||
| 623 | nmdc:mga06z11_46749_c1 | |||
| 624 | nmdc:mga04h51_10452_c1 | |||
| 625 | nmdc:mga07m45_18985_c1 | |||
| 626 | nmdc:mga05p37_37524_c1 | |||
| 627 | nmdc:mga0n895_12644_c1 | |||
| 628 | Ga0500635_0011870 | |||
| 629 | Ga0500643_027379 | |||
| 630 | Ga0500644_0054269 | |||
| 631 | Ga0500581_083549 | |||
| 632 | Ga0500651_0215295 | |||
| 633 | Ga0500566_0000370 | |||
| 634 | Ga0500650_0000365 | |||
| 635 | Ga0500556_0000468 | |||
| 636 | Ga0500562_017886 | |||
| 637 | Ga0500562_103495 | |||
| 638 | Ga0500592_005556 | |||
| 639 | Ga0500595_017788 | |||
| 640 | Ga0500595_028661 | |||
| 641 | Ga0500608_055243 | |||
| 642 | Ga0500642_0000019 | |||
| 643 | Ga0500658_0320360 | |||
| 644 | Ga0500559_0001011 | |||
| 645 | Ga0500568_0031207 | |||
| 646 | Ga0500590_087912 | |||
| 647 | Ga0500616_0000041 | |||
| 648 | Ga0500622_0004419 | |||
| 649 | Ga0500633_0052974 | |||
| 650 | Ga0500636_0075535 | |||
| 651 | Ga0500636_0130468 | |||
| 652 | Ga0500637_0086448 | |||
| 653 | Ga0500570_145243 | |||
| 654 | Ga0500596_009332 | |||
| 655 | Ga0501082_0131831 | |||
| 656 | Ga0466962_0006644 | |||
| 657 | Ga0466962_0033810 | |||
| 658 | 2548497194 | |||
| 659 | 2603860910 | |||
| 660 | 2644060535 | |||
| 661 | 2644106340 | |||
| 662 | 2644308417 | |||
| 663 | 2644331782 | |||
| 664 | 2644542162 | |||
| 665 | 2644615610 | |||
| 666 | 2844166818 | |||
| 667 | 2855732075 | |||
| 668 | 2855768782 | |||
| 669 | 2881415266 | |||
| 670 | 2893069159 | |||
| 671 | 2895395719 | |||
| 672 | 2906627331 | |||
| 673 | 2919078520 | |||
| 674 | 8016594320 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bkz-assembly1.cif.gz_A | x-ray structure of e coli alkb crosslinked to dsdna in the active site | 0.9892 | 18 | 215 |
| 2fdf-assembly1.cif.gz_A | crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t | 0.9876 | 18 | 216 |
| 3khc-assembly1.cif.gz_B | crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion | 0.9873 | 14 | 215 |
| 2fdf-assembly1.cif.gz_A | crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t | 0.9827 | 18 | 216 |
| 4zhn-assembly1.cif.gz_A | crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t | 0.9756 | 18 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4niiA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9682 | 18 | 217 | 2.60.120.590 |
| 4niiA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9493 | 18 | 217 | 2.60.120.590 |
| af_Q13686_178_346_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9043 | 91 | 215 | 2.60.120.590 |
| af_C6TKW1_99_311_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8871 | 18 | 214 | 2.60.120.590 |
| af_A0A1Q0YC58_8_168_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8723 | 82 | 215 | 2.60.120.590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534BW94-F1-model_v4 | DNA oxidative demethylase AlkB (EC 1.14.11.33) | 0.9992 | 60 | 216 |
GO:0005737
GO:0006281 GO:0008168 GO:0008198 GO:0032259 GO:0035513 GO:0035515 GO:0035516 |
| AF-A0A6I1W1U9-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.9991 | 49 | 141 |
GO:0051213
|
| AF-A0A2W0BF37-F1-model_v4 | DNA oxidative demethylase AlkB | 0.9974 | 63 | 216 |
GO:0005737
GO:0006281 GO:0008168 GO:0008198 GO:0032259 GO:0035513 GO:0035515 GO:0035516 |
| AF-A0A537DLG2-F1-model_v4 | DNA oxidative demethylase AlkB (EC 1.14.11.33) | 0.9971 | 14 | 216 |
GO:0005737
GO:0006281 GO:0008168 GO:0008198 GO:0032259 GO:0035513 GO:0035515 GO:0035516 |
| AF-A0A645H2Q6-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB (EC 1.14.11.33) | 0.9969 | 95 | 216 |
GO:0005737
GO:0006281 GO:0008198 GO:0016020 GO:0035513 GO:0035515 GO:0035516 |