F412604

General Info

Members Datasets Scaffolds Average Seq Length
336 240 672 109

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10087146|Ga0081538_100871462
Length 121
Sequence VAGYLTTHVLDTARGRPAAGMRVELFRLDRDDGGRNLLAATRTNAEGRTDTPLVEEGELSRGVYELVFEVGEYFAGQPETGSADPPFLDQVPVRFGVHDPAAHHHVPLLTSPWSYTTYRGS

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 1.79
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10087146 3300005981 Bacteria 1631
2 MBSR1b_contig_10157191 2162886012 Bacteria 1238
3 MBSR1b_contig_10191939 2162886012 Bacteria 2216
4 rootL2_10265604 3300003322 Bacteria 1045
5 Ga0065714_10378902 3300005288 Bacteria 608
6 Ga0065712_10086860 3300005290 Bacteria 2611
7 Ga0065712_10110919 3300005290 Bacteria 1827
8 Ga0065715_10184635 3300005293 Bacteria 1453
9 Ga0065715_10202055 3300005293 Bacteria 1356
10 Ga0065707_10103522 3300005295 Bacteria 2744
11 Ga0070658_11068325 3300005327 Bacteria 702
12 Ga0070676_10332969 3300005328 Bacteria 1039
13 Ga0070683_100005171 3300005329 Bacteria 10858
14 Ga0070683_100222497 3300005329 Bacteria 1794
15 Ga0070690_100391322 3300005330 Unclassified 1018
16 Ga0070670_100024053 3300005331 Bacteria 5240
17 Ga0070670_100356457 3300005331 Bacteria 1286
18 Ga0070670_100720987 3300005331 Bacteria 897
19 Ga0070670_100896453 3300005331 Bacteria 804
20 Ga0070670_101312469 3300005331 Bacteria 662
21 Ga0070677_10143662 3300005333 Bacteria 1103
22 Ga0070682_100310794 3300005337 Bacteria 1160
23 Ga0068868_100047179 3300005338 Bacteria 3374
24 Ga0070689_101782331 3300005340 Bacteria 561
25 Ga0070661_100210568 3300005344 Bacteria 1488
26 Ga0070661_100992053 3300005344 Bacteria 696
27 Ga0070668_100113658 3300005347 Bacteria 2157
28 Ga0070675_100000007 3300005354 Bacteria 263394
29 Ga0070675_100053524 3300005354 Bacteria 3320
30 Ga0070675_100227817 3300005354 Bacteria 1625
31 Ga0070674_100076277 3300005356 Bacteria 2383
32 Ga0070674_100217012 3300005356 Bacteria 1486
33 Ga0070673_100212000 3300005364 Bacteria 1673
34 Ga0070688_100180754 3300005365 Bacteria 1463
35 Ga0070688_100279793 3300005365 Bacteria 1198
36 Ga0070667_100979840 3300005367 Bacteria 788
37 Ga0070713_101315974 3300005436 Bacteria 700
38 Ga0070710_10112327 3300005437 Bacteria 1638
39 Ga0070710_10215210 3300005437 Bacteria 1220
40 Ga0070711_100242321 3300005439 Bacteria 1410
41 Ga0070700_100000024 3300005441 Bacteria 128154
42 Ga0070708_100534444 3300005445 Bacteria 1106
43 Ga0070678_100651728 3300005456 Bacteria 945
44 Ga0070678_100869025 3300005456 Bacteria 823
45 Ga0070678_101596705 3300005456 Bacteria 612
46 Ga0068867_101187306 3300005459 Unclassified 700
47 Ga0068867_102030584 3300005459 Unclassified 544
48 Ga0070685_10002474 3300005466 Bacteria 9489
49 Ga0070685_11000579 3300005466 Unclassified 627
50 Ga0070706_100030053 3300005467 Bacteria 5004
51 Ga0070707_100001347 3300005468 Bacteria 24122
52 Ga0070698_100006398 3300005471 Bacteria 12784
53 Ga0070699_100000017 3300005518 Bacteria 201366
54 Ga0070699_100121301 3300005518 Bacteria 2299
55 Ga0070699_100265320 3300005518 Unclassified 1536
56 Ga0070684_100124267 3300005535 Bacteria 2323
57 Ga0070697_100002282 3300005536 Bacteria 14715
58 Ga0070672_100423903 3300005543 Bacteria 1143
59 Ga0070686_100169082 3300005544 Unclassified 1545
60 Ga0070704_100215158 3300005549 Unclassified 1559
61 Ga0070664_100097719 3300005564 Bacteria 2550
62 Ga0070664_100132066 3300005564 Bacteria 2194
63 Ga0068857_101831099 3300005577 Unclassified 594
64 Ga0070702_100720796 3300005615 Bacteria 762
65 Ga0068859_101077013 3300005617 Bacteria 884
66 Ga0068859_101727883 3300005617 Bacteria 691
67 Ga0068861_101030168 3300005719 Bacteria 787
68 Ga0081538_10011012 3300005981 Bacteria 7358
69 Ga0081540_1027566 3300005983 Bacteria 3214
70 Ga0081539_10104483 3300005985 Bacteria 1437
71 Ga0070717_10033244 3300006028 Bacteria 4160
72 Ga0070717_10210677 3300006028 Bacteria 1705
73 Ga0070717_10693737 3300006028 Bacteria 925
74 Ga0075363_101023280 3300006048 Unclassified 510
75 Ga0075364_10010288 3300006051 Bacteria 5645
76 Ga0070716_100245093 3300006173 Unclassified 1217
77 Ga0070712_100062881 3300006175 Unclassified 2626
78 Ga0075366_10212793 3300006195 Bacteria 1177
79 Ga0075428_100009885 3300006844 Bacteria 10598
80 Ga0075430_100267575 3300006846 Bacteria 1415
81 Ga0075431_100857031 3300006847 Unclassified 880
82 Ga0075433_10162733 3300006852 Bacteria 1986
83 Ga0075434_100080144 3300006871 Bacteria 3261
84 Ga0075429_100005814 3300006880 Bacteria 10640
85 Ga0075436_100072349 3300006914 Bacteria 2385
86 Ga0097620_101076953 3300006931 Bacteria 884
87 Ga0097620_101727677 3300006931 Bacteria 691
88 Ga0075435_100138489 3300007076 Bacteria 2040
89 Ga0099794_10040041 3300007265 Bacteria 2226
90 Ga0099794_10156860 3300007265 Bacteria 1156
91 Ga0099794_10631682 3300007265 Unclassified 568
92 Ga0105244_10490882 3300009036 Bacteria 565
93 Ga0105240_10025803 3300009093 Bacteria 7717
94 Ga0114129_10033643 3300009147 Bacteria 7242
95 Ga0114129_12244628 3300009147 Bacteria 656
96 Ga0105243_11281236 3300009148 Bacteria 749
97 Ga0105237_10043915 3300009545 Bacteria 4501
98 Ga0105249_10081023 3300009553 Bacteria 3016
99 Ga0105249_10454815 3300009553 Bacteria 1319
100 Ga0105239_11070485 3300010375 Bacteria 928
101 Ga0105246_11131269 3300011119 Unclassified 717
102 Ga0157378_10004689 3300013297 Bacteria 11992
103 Ga0157372_10287802 3300013307 Bacteria 1911
104 Ga0157372_10322014 3300013307 Bacteria 1800
105 Ga0163163_10158427 3300014325 Bacteria 2309
106 Ga0163163_10173373 3300014325 Bacteria 2204
107 Ga0163163_10583688 3300014325 Bacteria 1181
108 Ga0163163_13340450 3300014325 Unclassified 500
109 Ga0157380_10513695 3300014326 Bacteria 1167
110 Ga0157380_11274134 3300014326 Bacteria 781
111 Ga0157380_11360171 3300014326 Bacteria 759
112 Ga0157377_11059861 3300014745 Bacteria 618
113 Ga0157377_11188572 3300014745 Unclassified 590
114 Ga0163161_10253840 3300017792 Bacteria 1371
115 Ga0213874_10030715 3300021377 Bacteria 1550
116 Ga0213875_10004901 3300021388 Bacteria 7267
117 Ga0213875_10105943 3300021388 Bacteria 1313
118 Ga0207666_1023267 3300025271 Bacteria 921
119 Ga0207697_10000087 3300025315 Bacteria 41336
120 Ga0207655_1213903 3300025728 Bacteria 566
121 Ga0207682_10128999 3300025893 Bacteria 1128
122 Ga0207692_10226943 3300025898 Bacteria 1110
123 Ga0207692_10988278 3300025898 Unclassified 555
124 Ga0207688_10002523 3300025901 Bacteria 9871
125 Ga0207680_10544417 3300025903 Bacteria 828
126 Ga0207645_10188335 3300025907 Bacteria 1355
127 Ga0207684_10019684 3300025910 Bacteria 5773
128 Ga0207671_10377836 3300025914 Bacteria 1125
129 Ga0207693_10004825 3300025915 Bacteria 11340
130 Ga0207693_10102823 3300025915 Bacteria 2241
131 Ga0207649_10215622 3300025920 Bacteria 1364
132 Ga0207649_10585138 3300025920 Bacteria 857
133 Ga0207646_10006769 3300025922 Bacteria 11795
134 Ga0207650_10021476 3300025925 Bacteria 4562
135 Ga0207650_10027058 3300025925 Bacteria 4100
136 Ga0207650_10215455 3300025925 Bacteria 1543
137 Ga0207650_11130476 3300025925 Bacteria 667
138 Ga0207659_10080897 3300025926 Bacteria 2401
139 Ga0207700_11266224 3300025928 Bacteria 657
140 Ga0207664_10419944 3300025929 Bacteria 1191
141 Ga0207706_10808188 3300025933 Bacteria 796
142 Ga0207669_10392120 3300025937 Unclassified 1085
143 Ga0207669_10541723 3300025937 Bacteria 938
144 Ga0207665_10292637 3300025939 Unclassified 1215
145 Ga0207661_10008835 3300025944 Bacteria 7210
146 Ga0207661_10041707 3300025944 Bacteria 3614
147 Ga0207661_10281777 3300025944 Bacteria 1486
148 Ga0207679_10074056 3300025945 Bacteria 2579
149 Ga0207679_10133194 3300025945 Bacteria 1997
150 Ga0207651_10334163 3300025960 Bacteria 1271
151 Ga0207712_10050527 3300025961 Bacteria 2903
152 Ga0207712_10215240 3300025961 Bacteria 1533
153 Ga0207668_10095956 3300025972 Bacteria 2190
154 Ga0207658_10735466 3300025986 Bacteria 893
155 Ga0207677_10030614 3300026023 Bacteria 3438
156 Ga0207708_10000068 3300026075 Bacteria 83320
157 Ga0207708_10037147 3300026075 Bacteria 3710
158 Ga0207648_11136225 3300026089 Unclassified 733
159 Ga0207674_11245976 3300026116 Bacteria 713
160 Ga0207675_101868528 3300026118 Bacteria 619
161 Ga0207683_10333697 3300026121 Bacteria 1390
162 Ga0207683_10894571 3300026121 Bacteria 824
163 Ga0207683_11245270 3300026121 Bacteria 689
164 Ga0268266_10000653 3300028379 Bacteria 46973
165 Ga0265338_10912177 3300028800 Unclassified 598
166 Ga0265330_10106475 3300031235 Unclassified 1199
167 Ga0265339_10300263 3300031249 Unclassified 766
168 Ga0265331_10027178 3300031250 Bacteria 2871
169 Ga0307408_100102025 3300031548 Bacteria 2187
170 Ga0307408_100607600 3300031548 Bacteria 973
171 Ga0265313_10002143 3300031595 Bacteria 17555
172 Ga0265314_10084252 3300031711 Bacteria 2087
173 Ga0307405_10084119 3300031731 Bacteria 2088
174 Ga0307413_12170314 3300031824 Bacteria 503
175 Ga0307410_11982630 3300031852 Bacteria 519
176 Ga0307406_10315471 3300031901 Bacteria 1207
177 Ga0307406_10613318 3300031901 Bacteria 899
178 Ga0307406_10991410 3300031901 Bacteria 720
179 Ga0307407_10168372 3300031903 Bacteria 1441
180 Ga0307407_10466016 3300031903 Unclassified 920
181 Ga0307407_11257684 3300031903 Bacteria 580
182 Ga0307409_100356690 3300031995 Bacteria 1382
183 Ga0307409_100664869 3300031995 Bacteria 1037
184 Ga0307409_102514534 3300031995 Bacteria 544
185 Ga0307416_100009379 3300032002 Bacteria 6402
186 Ga0307416_100060106 3300032002 Bacteria 3093
187 Ga0307416_100231849 3300032002 Bacteria 1781
188 Ga0307416_100806231 3300032002 Unclassified 1035
189 Ga0307416_101152005 3300032002 Bacteria 881
190 Ga0307416_101825466 3300032002 Bacteria 712
191 Ga0307416_102326777 3300032002 Bacteria 636
192 Ga0307416_103560505 3300032002 Bacteria 521
193 Ga0307414_11045465 3300032004 Bacteria 753
194 Ga0307411_10906813 3300032005 Bacteria 783
195 Ga0307411_12363160 3300032005 Bacteria 500
196 Ga0307415_100334396 3300032126 Bacteria 1269
197 Ga0373954_0052741 3300035118 Bacteria 1911
198 Ga0373955_0701781 3300035172 Unclassified 621
199 Ga0373927_0257032 3300035695 Bacteria 1148
200 Ga0373947_0196694 3300035725 Bacteria 1318
201 Ga0373937_0293927 3300036401 Bacteria 1535
202 Ga0373937_0302030 3300036401 Bacteria 1513
203 Ga0395900_1849868 3300037418 Bacteria 514
204 Ga0395898_0279104 3300037466 Bacteria 1594
205 Ga0395905_0858287 3300037471 Bacteria 811
206 Ga0436364_0851590 3300037853 Unclassified 551
207 Ga0436364_1070065 3300037853 Bacteria 32747
208 Ga0436364_1441921 3300037853 Bacteria 1472
209 Ga0395901_0709861 3300038443 Bacteria 1002
210 Ga0242420_001460 3300038996 Bacteria 3154
211 Ga0436365_1472578 3300039437 Bacteria 1095
212 Ga0436365_1783133 3300039437 Bacteria 4125
213 Ga0436363_0593499 3300039450 Bacteria 24834
214 Ga0436363_0796773 3300039450 Bacteria 2290
215 Ga0436363_0929380 3300039450 Bacteria 617
216 Ga0436362_1046818 3300039453 Bacteria 1090
217 Ga0451797_0080834 3300041453 Bacteria 1136
218 Ga0439449_0099662 3300042007 Bacteria 1074
219 Ga0439457_017389 3300042014 Bacteria 1597
220 Ga0451577_0001051 3300042876 Bacteria 39819
221 Ga0451577_0169983 3300042876 Bacteria 1964
222 Ga0451577_0247638 3300042876 Bacteria 1613
223 Ga0451577_0511874 3300042876 Bacteria 1090
224 Ga0453683_0001553 3300044673 Bacteria 19469
225 Ga0453683_0346480 3300044673 Bacteria 954
226 Ga0466966_0581310 3300044684 Bacteria 674
227 Ga0466963_0437117 3300044694 Bacteria 923
228 Ga0453684_0001615 3300044712 Bacteria 61811
229 Ga0453684_0584694 3300044712 Bacteria 1226
230 Ga0466960_0001079 3300044901 Bacteria 9788
231 Ga0466960_0226469 3300044901 Bacteria 1030
232 Ga0466960_0409684 3300044901 Bacteria 782
233 Ga0451576_0013623 3300045051 Bacteria 9089
234 Ga0466967_0276705 3300045976 Bacteria 1610
235 Ga0466967_0326576 3300045976 Bacteria 1481
236 Ga0466967_1475916 3300045976 Bacteria 677
237 Ga0466967_1515296 3300045976 Bacteria 668
238 Ga0466967_1695604 3300045976 Bacteria 629
239 Ga0495592_0161962 3300046454 Bacteria 1538
240 Ga0495638_0344161 3300046460 Bacteria 789
241 Ga0495651_0147920 3300046462 Bacteria 1696
242 Ga0495580_0005462 3300046472 Bacteria 10506
243 Ga0495580_0714958 3300046472 Bacteria 655
244 Ga0495582_0684023 3300046473 Unclassified 594
245 Ga0495639_0677579 3300046475 Bacteria 532
246 Ga0495662_0082997 3300046476 Bacteria 1559
247 Ga0495664_0002347 3300046477 Bacteria 10140
248 Ga0495608_0109832 3300046511 Bacteria 1773
249 Ga0495618_0651326 3300046514 Unclassified 623
250 Ga0495630_0377625 3300046517 Bacteria 1085
251 Ga0495630_1133051 3300046517 Bacteria 592
252 Ga0495637_0015152 3300046520 Bacteria 3621
253 Ga0495643_0023110 3300046522 Bacteria 3538
254 Ga0495652_0013606 3300046529 Bacteria 7323
255 Ga0495640_0091222 3300046533 Bacteria 2010
256 Ga0495587_0006244 3300046536 Bacteria 7780
257 Ga0495609_0132060 3300046538 Bacteria 1069
258 Ga0495597_0157608 3300046542 Bacteria 928
259 Ga0495667_0037069 3300046559 Bacteria 3251
260 Ga0495668_0249353 3300046616 Bacteria 972
261 Ga0495634_0020215 3300046642 Bacteria 4723
262 Ga0495635_0100444 3300046663 Bacteria 1977
263 Ga0495599_0018516 3300046678 Bacteria 4338
264 Ga0495623_0230990 3300046679 Bacteria 1049
265 Ga0495646_0095532 3300046680 Bacteria 1710
266 Ga0495669_0143917 3300046684 Bacteria 1126
267 Ga0495613_0995960 3300046689 Bacteria 538
268 Ga0495624_0209118 3300046690 Bacteria 1184
269 Ga0495600_0069039 3300046809 Bacteria 2310
270 Ga0495581_0146159 3300047315 Bacteria 1380
271 Ga0495604_0271305 3300047317 Bacteria 1149
272 Ga0495674_0035106 3300047319 Bacteria 4526
273 Ga0495674_1062813 3300047319 Bacteria 618
274 Ga0495680_0044864 3300047322 Bacteria 3493
275 Ga0495675_0191459 3300047444 Bacteria 1248
276 Ga0495673_0343642 3300047469 Unclassified 528
277 Ga0495686_0000064 3300047472 Bacteria 226284
278 Ga0495686_0177459 3300047472 Bacteria 1236
279 Ga0495686_0192480 3300047472 Bacteria 1175
280 Ga0495686_0197893 3300047472 Bacteria 1155
281 Ga0495602_0700445 3300048088 Bacteria 687
282 Ga0496100_1318181 3300048903 Bacteria 570
283 Ga0496104_0000027 3300048907 Bacteria 203475
284 Ga0496108_0020168 3300048911 Bacteria 5479
285 Ga0496109_0199309 3300048912 Bacteria 1882
286 Ga0496113_0464049 3300048916 Bacteria 1017
287 Ga0501299_219439 3300049522 Bacteria 513
288 Ga0501031_0101858 3300049568 Bacteria 1874
289 Ga0501037_0229340 3300049573 Bacteria 1304
290 Ga0501039_0240332 3300049575 Bacteria 1424
291 Ga0501040_0662841 3300049576 Bacteria 754
292 Ga0501041_0228056 3300049577 Bacteria 1169
293 Ga0501042_0495928 3300049578 Bacteria 887
294 Ga0501046_0074420 3300049580 Bacteria 2635
295 Ga0501046_0304706 3300049580 Bacteria 1163
296 Ga0501047_0270585 3300049581 Bacteria 1545
297 Ga0501067_0478249 3300049583 Bacteria 696
298 Ga0501067_0585123 3300049583 Bacteria 626
299 Ga0501067_0809777 3300049583 Bacteria 528
300 Ga0501069_0327368 3300049585 Bacteria 901
301 Ga0501072_0539908 3300049588 Bacteria 921
302 Ga0501073_0789956 3300049589 Bacteria 654
303 Ga0501075_0368686 3300049591 Bacteria 1094
304 Ga0501076_0820128 3300049592 Bacteria 767
305 Ga0501076_0918736 3300049592 Bacteria 721
306 Ga0501079_1036733 3300049741 Bacteria 646
307 Ga0501045_0235712 3300049824 Bacteria 1362
308 nmdc:mga03n38_697979_c1 3300050490 Bacteria 585
309 nmdc:mga0k408_32609_c2 3300050493 Unclassified 2025
310 nmdc:mga05p37_2046551_c1 3300050507 Bacteria 539
311 nmdc:mga05p37_78835_c1 3300050507 Bacteria 4056
312 nmdc:mga09592_1726_c1 3300050508 Bacteria 17597
313 nmdc:mga0qj67_366138_c1 3300050509 Unclassified 1164
314 nmdc:mga0n895_635169_c1 3300050512 Bacteria 1068
315 nmdc:mga08x19_99296_c1 3300050514 Bacteria 1930
316 nmdc:mga0a205_181247_c2 3300050515 Bacteria 1214
317 Ga0495619_0990484 3300053085 Bacteria 563
318 Ga0500647_0067100 3300053091 Bacteria 1725
319 Ga0500651_0051422 3300053093 Bacteria 2584
320 Ga0500641_0021677 3300053096 Bacteria 2453
321 Ga0500614_006865 3300053123 Bacteria 2393
322 Ga0500618_007046 3300053125 Bacteria 3242
323 Ga0500642_0000674 3300053130 Bacteria 10094
324 Ga0500652_201635 3300053131 Bacteria 807
325 Ga0500655_000733 3300053133 Bacteria 6494
326 Ga0500577_0428139 3300053142 Bacteria 579
327 Ga0500590_003456 3300053148 Bacteria 7287
328 Ga0500622_0003910 3300053156 Bacteria 9643
329 Ga0500639_129774 3300053163 Bacteria 1196
330 Ga0500636_0054783 3300053177 Bacteria 2338
331 Ga0500636_0189725 3300053177 Bacteria 1096
332 Ga0500570_004102 3300053724 Bacteria 7616
333 Ga0500645_027750 3300053730 Bacteria 1716
334 Ga0501084_0857467 3300054114 Bacteria 764
335 Ga0530510_0267137 3300061734 Bacteria 1277
336 2585260248 2582581305 Bacteria 4895574
337 Ga0081538_10087146
338 MBSR1b_contig_10157191
339 MBSR1b_contig_10191939
340 rootL2_10265604
341 Ga0065714_10378902
342 Ga0065712_10086860
343 Ga0065712_10110919
344 Ga0065715_10184635
345 Ga0065715_10202055
346 Ga0065707_10103522
347 Ga0070658_11068325
348 Ga0070676_10332969
349 Ga0070683_100005171
350 Ga0070683_100222497
351 Ga0070690_100391322
352 Ga0070670_100024053
353 Ga0070670_100356457
354 Ga0070670_100720987
355 Ga0070670_100896453
356 Ga0070670_101312469
357 Ga0070677_10143662
358 Ga0070682_100310794
359 Ga0068868_100047179
360 Ga0070689_101782331
361 Ga0070661_100210568
362 Ga0070661_100992053
363 Ga0070668_100113658
364 Ga0070675_100000007
365 Ga0070675_100053524
366 Ga0070675_100227817
367 Ga0070674_100076277
368 Ga0070674_100217012
369 Ga0070673_100212000
370 Ga0070688_100180754
371 Ga0070688_100279793
372 Ga0070667_100979840
373 Ga0070713_101315974
374 Ga0070710_10112327
375 Ga0070710_10215210
376 Ga0070711_100242321
377 Ga0070700_100000024
378 Ga0070708_100534444
379 Ga0070678_100651728
380 Ga0070678_100869025
381 Ga0070678_101596705
382 Ga0068867_101187306
383 Ga0068867_102030584
384 Ga0070685_10002474
385 Ga0070685_11000579
386 Ga0070706_100030053
387 Ga0070707_100001347
388 Ga0070698_100006398
389 Ga0070699_100000017
390 Ga0070699_100121301
391 Ga0070699_100265320
392 Ga0070684_100124267
393 Ga0070697_100002282
394 Ga0070672_100423903
395 Ga0070686_100169082
396 Ga0070704_100215158
397 Ga0070664_100097719
398 Ga0070664_100132066
399 Ga0068857_101831099
400 Ga0070702_100720796
401 Ga0068859_101077013
402 Ga0068859_101727883
403 Ga0068861_101030168
404 Ga0081538_10011012
405 Ga0081540_1027566
406 Ga0081539_10104483
407 Ga0070717_10033244
408 Ga0070717_10210677
409 Ga0070717_10693737
410 Ga0075363_101023280
411 Ga0075364_10010288
412 Ga0070716_100245093
413 Ga0070712_100062881
414 Ga0075366_10212793
415 Ga0075428_100009885
416 Ga0075430_100267575
417 Ga0075431_100857031
418 Ga0075433_10162733
419 Ga0075434_100080144
420 Ga0075429_100005814
421 Ga0075436_100072349
422 Ga0097620_101076953
423 Ga0097620_101727677
424 Ga0075435_100138489
425 Ga0099794_10040041
426 Ga0099794_10156860
427 Ga0099794_10631682
428 Ga0105244_10490882
429 Ga0105240_10025803
430 Ga0114129_10033643
431 Ga0114129_12244628
432 Ga0105243_11281236
433 Ga0105237_10043915
434 Ga0105249_10081023
435 Ga0105249_10454815
436 Ga0105239_11070485
437 Ga0105246_11131269
438 Ga0157378_10004689
439 Ga0157372_10287802
440 Ga0157372_10322014
441 Ga0163163_10158427
442 Ga0163163_10173373
443 Ga0163163_10583688
444 Ga0163163_13340450
445 Ga0157380_10513695
446 Ga0157380_11274134
447 Ga0157380_11360171
448 Ga0157377_11059861
449 Ga0157377_11188572
450 Ga0163161_10253840
451 Ga0213874_10030715
452 Ga0213875_10004901
453 Ga0213875_10105943
454 Ga0207666_1023267
455 Ga0207697_10000087
456 Ga0207655_1213903
457 Ga0207682_10128999
458 Ga0207692_10226943
459 Ga0207692_10988278
460 Ga0207688_10002523
461 Ga0207680_10544417
462 Ga0207645_10188335
463 Ga0207684_10019684
464 Ga0207671_10377836
465 Ga0207693_10004825
466 Ga0207693_10102823
467 Ga0207649_10215622
468 Ga0207649_10585138
469 Ga0207646_10006769
470 Ga0207650_10021476
471 Ga0207650_10027058
472 Ga0207650_10215455
473 Ga0207650_11130476
474 Ga0207659_10080897
475 Ga0207700_11266224
476 Ga0207664_10419944
477 Ga0207706_10808188
478 Ga0207669_10392120
479 Ga0207669_10541723
480 Ga0207665_10292637
481 Ga0207661_10008835
482 Ga0207661_10041707
483 Ga0207661_10281777
484 Ga0207679_10074056
485 Ga0207679_10133194
486 Ga0207651_10334163
487 Ga0207712_10050527
488 Ga0207712_10215240
489 Ga0207668_10095956
490 Ga0207658_10735466
491 Ga0207677_10030614
492 Ga0207708_10000068
493 Ga0207708_10037147
494 Ga0207648_11136225
495 Ga0207674_11245976
496 Ga0207675_101868528
497 Ga0207683_10333697
498 Ga0207683_10894571
499 Ga0207683_11245270
500 Ga0268266_10000653
501 Ga0265338_10912177
502 Ga0265330_10106475
503 Ga0265339_10300263
504 Ga0265331_10027178
505 Ga0307408_100102025
506 Ga0307408_100607600
507 Ga0265313_10002143
508 Ga0265314_10084252
509 Ga0307405_10084119
510 Ga0307413_12170314
511 Ga0307410_11982630
512 Ga0307406_10315471
513 Ga0307406_10613318
514 Ga0307406_10991410
515 Ga0307407_10168372
516 Ga0307407_10466016
517 Ga0307407_11257684
518 Ga0307409_100356690
519 Ga0307409_100664869
520 Ga0307409_102514534
521 Ga0307416_100009379
522 Ga0307416_100060106
523 Ga0307416_100231849
524 Ga0307416_100806231
525 Ga0307416_101152005
526 Ga0307416_101825466
527 Ga0307416_102326777
528 Ga0307416_103560505
529 Ga0307414_11045465
530 Ga0307411_10906813
531 Ga0307411_12363160
532 Ga0307415_100334396
533 Ga0373954_0052741
534 Ga0373955_0701781
535 Ga0373927_0257032
536 Ga0373947_0196694
537 Ga0373937_0293927
538 Ga0373937_0302030
539 Ga0395900_1849868
540 Ga0395898_0279104
541 Ga0395905_0858287
542 Ga0436364_0851590
543 Ga0436364_1070065
544 Ga0436364_1441921
545 Ga0395901_0709861
546 Ga0242420_001460
547 Ga0436365_1472578
548 Ga0436365_1783133
549 Ga0436363_0593499
550 Ga0436363_0796773
551 Ga0436363_0929380
552 Ga0436362_1046818
553 Ga0451797_0080834
554 Ga0439449_0099662
555 Ga0439457_017389
556 Ga0451577_0001051
557 Ga0451577_0169983
558 Ga0451577_0247638
559 Ga0451577_0511874
560 Ga0453683_0001553
561 Ga0453683_0346480
562 Ga0466966_0581310
563 Ga0466963_0437117
564 Ga0453684_0001615
565 Ga0453684_0584694
566 Ga0466960_0001079
567 Ga0466960_0226469
568 Ga0466960_0409684
569 Ga0451576_0013623
570 Ga0466967_0276705
571 Ga0466967_0326576
572 Ga0466967_1475916
573 Ga0466967_1515296
574 Ga0466967_1695604
575 Ga0495592_0161962
576 Ga0495638_0344161
577 Ga0495651_0147920
578 Ga0495580_0005462
579 Ga0495580_0714958
580 Ga0495582_0684023
581 Ga0495639_0677579
582 Ga0495662_0082997
583 Ga0495664_0002347
584 Ga0495608_0109832
585 Ga0495618_0651326
586 Ga0495630_0377625
587 Ga0495630_1133051
588 Ga0495637_0015152
589 Ga0495643_0023110
590 Ga0495652_0013606
591 Ga0495640_0091222
592 Ga0495587_0006244
593 Ga0495609_0132060
594 Ga0495597_0157608
595 Ga0495667_0037069
596 Ga0495668_0249353
597 Ga0495634_0020215
598 Ga0495635_0100444
599 Ga0495599_0018516
600 Ga0495623_0230990
601 Ga0495646_0095532
602 Ga0495669_0143917
603 Ga0495613_0995960
604 Ga0495624_0209118
605 Ga0495600_0069039
606 Ga0495581_0146159
607 Ga0495604_0271305
608 Ga0495674_0035106
609 Ga0495674_1062813
610 Ga0495680_0044864
611 Ga0495675_0191459
612 Ga0495673_0343642
613 Ga0495686_0000064
614 Ga0495686_0177459
615 Ga0495686_0192480
616 Ga0495686_0197893
617 Ga0495602_0700445
618 Ga0496100_1318181
619 Ga0496104_0000027
620 Ga0496108_0020168
621 Ga0496109_0199309
622 Ga0496113_0464049
623 Ga0501299_219439
624 Ga0501031_0101858
625 Ga0501037_0229340
626 Ga0501039_0240332
627 Ga0501040_0662841
628 Ga0501041_0228056
629 Ga0501042_0495928
630 Ga0501046_0074420
631 Ga0501046_0304706
632 Ga0501047_0270585
633 Ga0501067_0478249
634 Ga0501067_0585123
635 Ga0501067_0809777
636 Ga0501069_0327368
637 Ga0501072_0539908
638 Ga0501073_0789956
639 Ga0501075_0368686
640 Ga0501076_0820128
641 Ga0501076_0918736
642 Ga0501079_1036733
643 Ga0501045_0235712
644 nmdc:mga03n38_697979_c1
645 nmdc:mga0k408_32609_c2
646 nmdc:mga05p37_2046551_c1
647 nmdc:mga05p37_78835_c1
648 nmdc:mga09592_1726_c1
649 nmdc:mga0qj67_366138_c1
650 nmdc:mga0n895_635169_c1
651 nmdc:mga08x19_99296_c1
652 nmdc:mga0a205_181247_c2
653 Ga0495619_0990484
654 Ga0500647_0067100
655 Ga0500651_0051422
656 Ga0500641_0021677
657 Ga0500614_006865
658 Ga0500618_007046
659 Ga0500642_0000674
660 Ga0500652_201635
661 Ga0500655_000733
662 Ga0500577_0428139
663 Ga0500590_003456
664 Ga0500622_0003910
665 Ga0500639_129774
666 Ga0500636_0054783
667 Ga0500636_0189725
668 Ga0500570_004102
669 Ga0500645_027750
670 Ga0501084_0857467
671 Ga0530510_0267137
672 2585260248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

5

120

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mrb-assembly1.cif.gz_B-2 wild type human transthyretin ph 7.5 0.9523 3 109
3glz-assembly1.cif.gz_B human transthyretin (ttr) complexed with(e)-3-(2-(trifluoromethyl)benzylideneaminooxy)propanoic acid (inhibitor 11) 0.9435 3 109
3gs4-assembly1.cif.gz_B human transthyretin (ttr) complexed with 3-(9h-fluoren-9-ylideneaminooxy)propanoic acid (inhibitor 15) 0.9408 3 109
4qrf-assembly1.cif.gz_B-2 crystal structure of v30m mutant human transthyretin complexed with caffeic acid phenethyl ester 0.9399 3 109
4hiq-assembly1.cif.gz_B-2 the structure of v122i mutant transthyretin in complex with ag10 0.9385 3 109
ID Description Score Start End Superfamily
af_O44578_18_134_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9486 4 110 2.60.40.180
af_Q54LD6_18_133_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9384 2 110 2.60.40.180
af_O74492_5_124_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9295 2 112 2.60.40.180
3iwvA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.926 2 112 2.60.40.180
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9233 4 112 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A261XYE8-F1-model_v4 hydroxyisourate hydrolase (EC 3.5.2.17) 0.9799 2 112 GO:0006144
GO:0033971
AF-A0A418QX45-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9793 1 112 GO:0006144
GO:0033971
AF-A0A2Z3GQZ1-F1-model_v4 Transthyretin/hydroxyisourate hydrolase domain-containing protein 0.9784 9 75 GO:0006144
AF-A0A849Z0I3-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.978 1 94 GO:0006144
GO:0033971
AF-A0A126P6H5-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9775 1 112 GO:0006144
GO:0033971

Map