F412428
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 191 | 333 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0170545|Ga0501034_0170545_658_1101 |
| Length | 147 |
| Sequence | MSASPTPATGMSFDPAFLMERLRTYGHGGALGITYVDHGADWCALALPYDEHLVAGPNGILASGPIVSLMDMATSMSLWIRLGRFRPQATLDLRVDYLRPARPGQTITGRGECYGATRSVGFVRGTAHDGDPADPVAHVSGTFMFTD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 2 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 78 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 137 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 138 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 139 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 140 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 141 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 142 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 143 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 144 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 145 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 146 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 166 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 167 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 168 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 169 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 170 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 171 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 172 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 185 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 186 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 187 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 188 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 190 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 191 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.97 |
| Nodule | 0 |
| Rhizoplane | 1.79 |
| Rhizosphere | 79.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006858 | 3300000549 | Bacteria | 1409 |
| 2 | JGI24739J22299_10011761 | 3300001989 | Bacteria | 3225 |
| 3 | JGI24739J22299_10019562 | 3300001989 | Bacteria | 2422 |
| 4 | JGI24739J22299_10027687 | 3300001989 | Bacteria | 1980 |
| 5 | JGI24737J22298_10002759 | 3300001990 | Bacteria | 6211 |
| 6 | JGI24737J22298_10016968 | 3300001990 | Bacteria | 2348 |
| 7 | JGI24737J22298_10146657 | 3300001990 | Bacteria | 697 |
| 8 | JGI24735J21928_10012987 | 3300002067 | Bacteria | 2625 |
| 9 | JGI24735J21928_10016142 | 3300002067 | Bacteria | 2322 |
| 10 | JGI24735J21928_10019954 | 3300002067 | Bacteria | 2056 |
| 11 | JGI24738J21930_10000648 | 3300002075 | Bacteria | 10051 |
| 12 | JGI24744J21845_10001869 | 3300002077 | Bacteria | 4226 |
| 13 | JGI25164J39214_1010745 | 3300002772 | Bacteria | 883 |
| 14 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 15 | rootH1_10107509 | 3300003316 | Bacteria | 2016 |
| 16 | rootH2_10068880 | 3300003320 | Bacteria | 1676 |
| 17 | rootH2_10194905 | 3300003320 | Bacteria | 1149 |
| 18 | rootL2_10273647 | 3300003322 | Bacteria | 1182 |
| 19 | rootH1_10040023 | 3300003323 | Bacteria | 1254 |
| 20 | rootH1_10295821 | 3300003323 | Bacteria | 1113 |
| 21 | Ga0055542_1008441 | 3300003762 | Bacteria | 2019 |
| 22 | Ga0065707_10554733 | 3300005295 | Bacteria | 718 |
| 23 | Ga0070658_10000029 | 3300005327 | Bacteria | 156910 |
| 24 | Ga0070658_10000536 | 3300005327 | Bacteria | 32936 |
| 25 | Ga0070658_10000851 | 3300005327 | Bacteria | 26060 |
| 26 | Ga0070658_10011762 | 3300005327 | Bacteria | 7024 |
| 27 | Ga0070658_10145909 | 3300005327 | Bacteria | 1979 |
| 28 | Ga0070658_10404738 | 3300005327 | Unclassified | 1172 |
| 29 | Ga0070658_10781842 | 3300005327 | Bacteria | 829 |
| 30 | Ga0070676_10000031 | 3300005328 | Bacteria | 42113 |
| 31 | Ga0070677_10000460 | 3300005333 | Bacteria | 13951 |
| 32 | Ga0070666_10166751 | 3300005335 | Bacteria | 1541 |
| 33 | Ga0070680_100006474 | 3300005336 | Bacteria | 8906 |
| 34 | Ga0068868_100000007 | 3300005338 | Bacteria | 123028 |
| 35 | Ga0070660_100000700 | 3300005339 | Bacteria | 22233 |
| 36 | Ga0070660_100000715 | 3300005339 | Bacteria | 21980 |
| 37 | Ga0070660_100005309 | 3300005339 | Bacteria | 8914 |
| 38 | Ga0070660_100006043 | 3300005339 | Bacteria | 8371 |
| 39 | Ga0070660_100015926 | 3300005339 | Bacteria | 5444 |
| 40 | Ga0070660_100376421 | 3300005339 | Bacteria | 1172 |
| 41 | Ga0070661_100000055 | 3300005344 | Bacteria | 88266 |
| 42 | Ga0070661_100528276 | 3300005344 | Bacteria | 947 |
| 43 | Ga0070692_10015367 | 3300005345 | Bacteria | 3621 |
| 44 | Ga0070675_100014811 | 3300005354 | Bacteria | 6154 |
| 45 | Ga0070675_100034822 | 3300005354 | Bacteria | 4088 |
| 46 | Ga0070673_100000022 | 3300005364 | Bacteria | 92156 |
| 47 | Ga0070673_100589708 | 3300005364 | Bacteria | 1013 |
| 48 | Ga0070659_100000004 | 3300005366 | Bacteria | 267958 |
| 49 | Ga0070659_100006080 | 3300005366 | Bacteria | 8707 |
| 50 | Ga0070659_101151587 | 3300005366 | Bacteria | 685 |
| 51 | Ga0070663_100001359 | 3300005455 | Bacteria | 13373 |
| 52 | Ga0070678_100044311 | 3300005456 | Bacteria | 3176 |
| 53 | Ga0070662_100014545 | 3300005457 | Bacteria | 5261 |
| 54 | Ga0070681_10122957 | 3300005458 | Bacteria | 2528 |
| 55 | Ga0068867_100000023 | 3300005459 | Bacteria | 92322 |
| 56 | Ga0070679_100000017 | 3300005530 | Bacteria | 129377 |
| 57 | Ga0070679_100727806 | 3300005530 | Bacteria | 935 |
| 58 | Ga0068853_100146360 | 3300005539 | Bacteria | 2123 |
| 59 | Ga0068853_100936439 | 3300005539 | Bacteria | 833 |
| 60 | Ga0070672_100077795 | 3300005543 | Bacteria | 2654 |
| 61 | Ga0070686_100000218 | 3300005544 | Bacteria | 39821 |
| 62 | Ga0070696_100171724 | 3300005546 | Bacteria | 1603 |
| 63 | Ga0070693_100044595 | 3300005547 | Bacteria | 2509 |
| 64 | Ga0070665_100000054 | 3300005548 | Bacteria | 244426 |
| 65 | Ga0070665_100914005 | 3300005548 | Bacteria | 890 |
| 66 | Ga0070665_101376850 | 3300005548 | Bacteria | 715 |
| 67 | Ga0068855_100000031 | 3300005563 | Bacteria | 170268 |
| 68 | Ga0068855_100073516 | 3300005563 | Bacteria | 3972 |
| 69 | Ga0070664_100450047 | 3300005564 | Bacteria | 1182 |
| 70 | Ga0068857_100129981 | 3300005577 | Bacteria | 2271 |
| 71 | Ga0068854_100043461 | 3300005578 | Bacteria | 3185 |
| 72 | Ga0068854_100056189 | 3300005578 | Bacteria | 2836 |
| 73 | Ga0068854_100126342 | 3300005578 | Bacteria | 1948 |
| 74 | Ga0068856_100024524 | 3300005614 | Bacteria | 5872 |
| 75 | Ga0068856_100139144 | 3300005614 | Bacteria | 2434 |
| 76 | Ga0068852_100000627 | 3300005616 | Bacteria | 23092 |
| 77 | Ga0068852_100859444 | 3300005616 | Bacteria | 923 |
| 78 | Ga0068866_10133491 | 3300005718 | Bacteria | 1415 |
| 79 | Ga0068863_100011069 | 3300005841 | Bacteria | 8748 |
| 80 | Ga0068860_100001425 | 3300005843 | Bacteria | 25889 |
| 81 | Ga0097621_100010552 | 3300006237 | Bacteria | 6767 |
| 82 | Ga0075370_10478931 | 3300006353 | Bacteria | 750 |
| 83 | Ga0068871_100010769 | 3300006358 | Bacteria | 6690 |
| 84 | Ga0068865_100000031 | 3300006881 | Bacteria | 88580 |
| 85 | Ga0105240_10003725 | 3300009093 | Bacteria | 23553 |
| 86 | Ga0105240_10094922 | 3300009093 | Bacteria | 3637 |
| 87 | Ga0105240_10318037 | 3300009093 | Bacteria | 1775 |
| 88 | Ga0105240_11314132 | 3300009093 | Bacteria | 762 |
| 89 | Ga0105245_10013418 | 3300009098 | Bacteria | 7137 |
| 90 | Ga0105245_10346468 | 3300009098 | Bacteria | 1471 |
| 91 | Ga0105247_10003119 | 3300009101 | Bacteria | 10945 |
| 92 | Ga0105243_10000156 | 3300009148 | Bacteria | 78467 |
| 93 | Ga0105243_11275822 | 3300009148 | Bacteria | 751 |
| 94 | Ga0105243_12312116 | 3300009148 | Bacteria | 575 |
| 95 | Ga0105241_10426340 | 3300009174 | Bacteria | 1168 |
| 96 | Ga0105242_10004742 | 3300009176 | Bacteria | 10529 |
| 97 | Ga0105248_10017071 | 3300009177 | Bacteria | 7994 |
| 98 | Ga0105237_10028430 | 3300009545 | Bacteria | 5695 |
| 99 | Ga0105237_10314783 | 3300009545 | Bacteria | 1568 |
| 100 | Ga0105238_10273674 | 3300009551 | Bacteria | 1669 |
| 101 | Ga0105238_12062408 | 3300009551 | Bacteria | 604 |
| 102 | Ga0105249_10031092 | 3300009553 | Bacteria | 4827 |
| 103 | Ga0105239_10001121 | 3300010375 | Bacteria | 36892 |
| 104 | Ga0105239_10076889 | 3300010375 | Bacteria | 3672 |
| 105 | Ga0105239_10752168 | 3300010375 | Bacteria | 1116 |
| 106 | Ga0105239_11073479 | 3300010375 | Bacteria | 927 |
| 107 | Ga0105239_13100509 | 3300010375 | Bacteria | 541 |
| 108 | Ga0105246_10055066 | 3300011119 | Bacteria | 2744 |
| 109 | Ga0105246_11524679 | 3300011119 | Bacteria | 629 |
| 110 | Ga0157373_10110090 | 3300013100 | Bacteria | 1936 |
| 111 | Ga0157373_10582932 | 3300013100 | Bacteria | 813 |
| 112 | Ga0157371_10123433 | 3300013102 | Bacteria | 1842 |
| 113 | Ga0157370_10000017 | 3300013104 | Bacteria | 169971 |
| 114 | Ga0157369_10010900 | 3300013105 | Bacteria | 10354 |
| 115 | Ga0157369_10014895 | 3300013105 | Bacteria | 8776 |
| 116 | Ga0157374_10000656 | 3300013296 | Bacteria | 30436 |
| 117 | Ga0157378_10000504 | 3300013297 | Bacteria | 37070 |
| 118 | Ga0157378_10659032 | 3300013297 | Bacteria | 1063 |
| 119 | Ga0163162_10047022 | 3300013306 | Bacteria | 4325 |
| 120 | Ga0157372_10185041 | 3300013307 | Bacteria | 2412 |
| 121 | Ga0157372_10204927 | 3300013307 | Bacteria | 2285 |
| 122 | Ga0157372_10280767 | 3300013307 | Bacteria | 1936 |
| 123 | Ga0157380_10672288 | 3300014326 | Bacteria | 1036 |
| 124 | Ga0157380_11655808 | 3300014326 | Bacteria | 696 |
| 125 | Ga0157376_10000124 | 3300014969 | Bacteria | 53299 |
| 126 | Ga0163161_10331454 | 3300017792 | Bacteria | 1205 |
| 127 | Ga0213873_10000027 | 3300021358 | Bacteria | 73909 |
| 128 | Ga0213874_10142843 | 3300021377 | Bacteria | 830 |
| 129 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 130 | Ga0213876_10000395 | 3300021384 | Bacteria | 36646 |
| 131 | Ga0213876_10002246 | 3300021384 | Bacteria | 11402 |
| 132 | Ga0213876_10027171 | 3300021384 | Bacteria | 3020 |
| 133 | Ga0207427_100774 | 3300025231 | Bacteria | 14552 |
| 134 | Ga0209026_1002932 | 3300025250 | Bacteria | 5962 |
| 135 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 136 | Ga0209148_1001344 | 3300025254 | Bacteria | 12962 |
| 137 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 138 | Ga0209455_1001597 | 3300025272 | Bacteria | 9959 |
| 139 | Ga0209455_1032626 | 3300025272 | Bacteria | 863 |
| 140 | Ga0207642_10107273 | 3300025899 | Bacteria | 1415 |
| 141 | Ga0207710_10003845 | 3300025900 | Bacteria | 6638 |
| 142 | Ga0207688_10200726 | 3300025901 | Bacteria | 1195 |
| 143 | Ga0207680_10283324 | 3300025903 | Bacteria | 1152 |
| 144 | Ga0207647_10000710 | 3300025904 | Bacteria | 26130 |
| 145 | Ga0207647_10218224 | 3300025904 | Bacteria | 1100 |
| 146 | Ga0207647_10248178 | 3300025904 | Bacteria | 1021 |
| 147 | Ga0207647_10394452 | 3300025904 | Bacteria | 780 |
| 148 | Ga0207645_10016352 | 3300025907 | Bacteria | 4912 |
| 149 | Ga0207645_10198261 | 3300025907 | Bacteria | 1320 |
| 150 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 151 | Ga0207705_10000178 | 3300025909 | Bacteria | 67084 |
| 152 | Ga0207705_10000243 | 3300025909 | Bacteria | 53479 |
| 153 | Ga0207705_10023638 | 3300025909 | Bacteria | 4384 |
| 154 | Ga0207705_10114196 | 3300025909 | Bacteria | 1998 |
| 155 | Ga0207705_10596530 | 3300025909 | Bacteria | 859 |
| 156 | Ga0207707_10012541 | 3300025912 | Bacteria | 7368 |
| 157 | Ga0207695_10024973 | 3300025913 | Bacteria | 6705 |
| 158 | Ga0207695_10063772 | 3300025913 | Bacteria | 3797 |
| 159 | Ga0207695_10262964 | 3300025913 | Bacteria | 1622 |
| 160 | Ga0207695_11068708 | 3300025913 | Bacteria | 687 |
| 161 | Ga0207671_10001063 | 3300025914 | Bacteria | 33331 |
| 162 | Ga0207660_10030106 | 3300025917 | Bacteria | 3729 |
| 163 | Ga0207657_10000519 | 3300025919 | Bacteria | 40709 |
| 164 | Ga0207657_10001372 | 3300025919 | Bacteria | 25957 |
| 165 | Ga0207657_10019103 | 3300025919 | Bacteria | 6519 |
| 166 | Ga0207657_10019782 | 3300025919 | Bacteria | 6382 |
| 167 | Ga0207657_10030954 | 3300025919 | Bacteria | 4851 |
| 168 | Ga0207657_10401041 | 3300025919 | Bacteria | 1079 |
| 169 | Ga0207657_10581269 | 3300025919 | Bacteria | 875 |
| 170 | Ga0207649_10000018 | 3300025920 | Bacteria | 225137 |
| 171 | Ga0207649_10356520 | 3300025920 | Bacteria | 1084 |
| 172 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 173 | Ga0207659_10008425 | 3300025926 | Bacteria | 6399 |
| 174 | Ga0207687_10114803 | 3300025927 | Bacteria | 2005 |
| 175 | Ga0207687_10213353 | 3300025927 | Bacteria | 1516 |
| 176 | Ga0207687_10217322 | 3300025927 | Bacteria | 1503 |
| 177 | Ga0207687_10291207 | 3300025927 | Bacteria | 1312 |
| 178 | Ga0207687_10403780 | 3300025927 | Bacteria | 1124 |
| 179 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 180 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 181 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 182 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 183 | Ga0207690_10004468 | 3300025932 | Bacteria | 8258 |
| 184 | Ga0207706_10024963 | 3300025933 | Bacteria | 5358 |
| 185 | Ga0207686_10001385 | 3300025934 | Bacteria | 13769 |
| 186 | Ga0207709_10000447 | 3300025935 | Bacteria | 38701 |
| 187 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 188 | Ga0207691_10070922 | 3300025940 | Bacteria | 3146 |
| 189 | Ga0207691_10784776 | 3300025940 | Bacteria | 801 |
| 190 | Ga0207711_10038379 | 3300025941 | Bacteria | 4073 |
| 191 | Ga0207667_10000029 | 3300025949 | Bacteria | 329192 |
| 192 | Ga0207667_10034843 | 3300025949 | Bacteria | 5403 |
| 193 | Ga0207667_10233946 | 3300025949 | Bacteria | 1881 |
| 194 | Ga0207667_10536301 | 3300025949 | Bacteria | 1184 |
| 195 | Ga0207667_10618220 | 3300025949 | Bacteria | 1091 |
| 196 | Ga0207667_10702175 | 3300025949 | Bacteria | 1014 |
| 197 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 198 | Ga0207651_10353460 | 3300025960 | Bacteria | 1238 |
| 199 | Ga0207712_10033435 | 3300025961 | Bacteria | 3476 |
| 200 | Ga0207640_10000357 | 3300025981 | Bacteria | 29919 |
| 201 | Ga0207640_10023046 | 3300025981 | Bacteria | 3738 |
| 202 | Ga0207677_10000014 | 3300026023 | Bacteria | 181712 |
| 203 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 204 | Ga0207639_10007455 | 3300026041 | Bacteria | 7463 |
| 205 | Ga0207639_10508655 | 3300026041 | Bacteria | 1101 |
| 206 | Ga0207678_10002781 | 3300026067 | Bacteria | 15861 |
| 207 | Ga0207708_11051023 | 3300026075 | Bacteria | 709 |
| 208 | Ga0207702_10013616 | 3300026078 | Bacteria | 6755 |
| 209 | Ga0207702_10030512 | 3300026078 | Bacteria | 4493 |
| 210 | Ga0207702_10145466 | 3300026078 | Bacteria | 2150 |
| 211 | Ga0207641_10003047 | 3300026088 | Bacteria | 15101 |
| 212 | Ga0207641_10013366 | 3300026088 | Bacteria | 6732 |
| 213 | Ga0207641_10745482 | 3300026088 | Bacteria | 967 |
| 214 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 215 | Ga0207674_10155072 | 3300026116 | Bacteria | 2245 |
| 216 | Ga0207683_10019752 | 3300026121 | Bacteria | 5755 |
| 217 | Ga0207698_10001899 | 3300026142 | Bacteria | 12241 |
| 218 | Ga0207698_10227208 | 3300026142 | Bacteria | 1691 |
| 219 | Ga0207698_10526381 | 3300026142 | Bacteria | 1155 |
| 220 | Ga0268266_10000414 | 3300028379 | Bacteria | 65028 |
| 221 | Ga0268266_10082572 | 3300028379 | Bacteria | 2804 |
| 222 | Ga0268266_10486337 | 3300028379 | Bacteria | 1177 |
| 223 | Ga0268266_11308947 | 3300028379 | Bacteria | 700 |
| 224 | Ga0268264_10000974 | 3300028381 | Bacteria | 29321 |
| 225 | Ga0268264_10014027 | 3300028381 | Bacteria | 6588 |
| 226 | Ga0307513_10048836 | 3300031456 | Bacteria | 4589 |
| 227 | Ga0307408_100275844 | 3300031548 | Bacteria | 1398 |
| 228 | Ga0307416_101958002 | 3300032002 | Bacteria | 689 |
| 229 | Ga0307414_11783467 | 3300032004 | Unclassified | 574 |
| 230 | Ga0307510_10139957 | 3300033180 | Bacteria | 2066 |
| 231 | Ga0395899_0000406 | 3300037312 | Bacteria | 50248 |
| 232 | Ga0395900_0193125 | 3300037418 | Bacteria | 2064 |
| 233 | Ga0395900_0287725 | 3300037418 | Bacteria | 1633 |
| 234 | Ga0395900_0502243 | 3300037418 | Bacteria | 1163 |
| 235 | Ga0395898_0583135 | 3300037466 | Bacteria | 1061 |
| 236 | Ga0395898_1856408 | 3300037466 | Bacteria | 523 |
| 237 | Ga0395905_0020721 | 3300037471 | Bacteria | 6225 |
| 238 | Ga0395905_0125058 | 3300037471 | Bacteria | 2418 |
| 239 | Ga0395905_0144034 | 3300037471 | Bacteria | 2242 |
| 240 | Ga0395905_0221539 | 3300037471 | Bacteria | 1770 |
| 241 | Ga0395905_0557232 | 3300037471 | Bacteria | 1047 |
| 242 | Ga0395901_0044040 | 3300038443 | Bacteria | 4629 |
| 243 | Ga0395901_0466651 | 3300038443 | Bacteria | 1289 |
| 244 | Ga0395901_0740739 | 3300038443 | Bacteria | 977 |
| 245 | Ga0436365_0102423 | 3300039437 | Bacteria | 73123 |
| 246 | Ga0436365_0487522 | 3300039437 | Bacteria | 55925 |
| 247 | Ga0436365_1487768 | 3300039437 | Bacteria | 7074 |
| 248 | Ga0436365_1792312 | 3300039437 | Bacteria | 3586 |
| 249 | Ga0436363_1063151 | 3300039450 | Bacteria | 780 |
| 250 | Ga0436362_0740394 | 3300039453 | Bacteria | 73123 |
| 251 | Ga0451793_0460554 | 3300041452 | Bacteria | 778 |
| 252 | Ga0451577_0538260 | 3300042876 | Bacteria | 1061 |
| 253 | Ga0451577_1258480 | 3300042876 | Unclassified | 659 |
| 254 | Ga0466972_0008358 | 3300044658 | Bacteria | 5188 |
| 255 | Ga0466965_0105853 | 3300044683 | Bacteria | 1442 |
| 256 | Ga0466966_0058153 | 3300044684 | Bacteria | 2444 |
| 257 | Ga0466961_0009726 | 3300044693 | Bacteria | 6120 |
| 258 | Ga0466963_0028893 | 3300044694 | Bacteria | 3564 |
| 259 | Ga0466964_0044688 | 3300044706 | Bacteria | 1800 |
| 260 | Ga0466964_0057123 | 3300044706 | Bacteria | 1615 |
| 261 | Ga0466971_0020171 | 3300044719 | Bacteria | 2963 |
| 262 | Ga0466971_0531365 | 3300044719 | Unclassified | 582 |
| 263 | Ga0466968_0006722 | 3300044735 | Bacteria | 4346 |
| 264 | Ga0466968_0079968 | 3300044735 | Bacteria | 1434 |
| 265 | Ga0466968_0249347 | 3300044735 | Bacteria | 843 |
| 266 | Ga0466968_0279620 | 3300044735 | Unclassified | 798 |
| 267 | Ga0466957_0064047 | 3300044842 | Bacteria | 2261 |
| 268 | Ga0466957_0071019 | 3300044842 | Bacteria | 2152 |
| 269 | Ga0466960_0001025 | 3300044901 | Bacteria | 9987 |
| 270 | Ga0466959_0038923 | 3300045049 | Bacteria | 3513 |
| 271 | Ga0451576_0643722 | 3300045051 | Bacteria | 1114 |
| 272 | Ga0466958_0011710 | 3300045836 | Bacteria | 4948 |
| 273 | Ga0466958_0163972 | 3300045836 | Bacteria | 1405 |
| 274 | Ga0466967_0066889 | 3300045976 | Bacteria | 3203 |
| 275 | Ga0495638_0029330 | 3300046460 | Bacteria | 3547 |
| 276 | Ga0495583_0000286 | 3300046506 | Bacteria | 80417 |
| 277 | Ga0495606_0001833 | 3300046507 | Bacteria | 26898 |
| 278 | Ga0495642_0067472 | 3300046528 | Bacteria | 1492 |
| 279 | Ga0495654_0021389 | 3300046530 | Bacteria | 3365 |
| 280 | Ga0495661_0017039 | 3300046665 | Bacteria | 4800 |
| 281 | Ga0495670_0198804 | 3300046691 | Bacteria | 1061 |
| 282 | Ga0495673_0009463 | 3300047469 | Bacteria | 5394 |
| 283 | Ga0495673_0176781 | 3300047469 | Bacteria | 810 |
| 284 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 285 | Ga0495686_0229089 | 3300047472 | Bacteria | 1053 |
| 286 | Ga0496102_0256501 | 3300048905 | Bacteria | 1649 |
| 287 | Ga0496102_1109822 | 3300048905 | Bacteria | 711 |
| 288 | Ga0496109_1067034 | 3300048912 | Bacteria | 745 |
| 289 | Ga0496115_0216090 | 3300048918 | Bacteria | 1583 |
| 290 | Ga0496115_0556642 | 3300048918 | Bacteria | 916 |
| 291 | Ga0496117_0041777 | 3300048920 | Bacteria | 3354 |
| 292 | Ga0496117_0057975 | 3300048920 | Bacteria | 2685 |
| 293 | Ga0496117_0068570 | 3300048920 | Bacteria | 2393 |
| 294 | Ga0496118_0086805 | 3300048921 | Bacteria | 2173 |
| 295 | Ga0496118_0089979 | 3300048921 | Bacteria | 2117 |
| 296 | Ga0496118_0134093 | 3300048921 | Bacteria | 1583 |
| 297 | Ga0496118_0170172 | 3300048921 | Bacteria | 1332 |
| 298 | Ga0496119_0153595 | 3300048922 | Bacteria | 1231 |
| 299 | Ga0496119_0166534 | 3300048922 | Bacteria | 1167 |
| 300 | Ga0496120_0038278 | 3300048923 | Bacteria | 2839 |
| 301 | Ga0496121_0008708 | 3300048924 | Bacteria | 11847 |
| 302 | Ga0496121_0017421 | 3300048924 | Bacteria | 7342 |
| 303 | Ga0496121_0019788 | 3300048924 | Bacteria | 6708 |
| 304 | Ga0496121_0033641 | 3300048924 | Bacteria | 4634 |
| 305 | Ga0496122_0009442 | 3300048925 | Bacteria | 10277 |
| 306 | Ga0496123_0016119 | 3300048926 | Bacteria | 6088 |
| 307 | Ga0496123_0030231 | 3300048926 | Bacteria | 3968 |
| 308 | Ga0496124_0164781 | 3300048927 | Bacteria | 1724 |
| 309 | Ga0496125_0029710 | 3300048928 | Bacteria | 4906 |
| 310 | Ga0496126_0012159 | 3300048929 | Bacteria | 8836 |
| 311 | Ga0496126_0639519 | 3300048929 | Unclassified | 834 |
| 312 | Ga0501033_0098051 | 3300049570 | Bacteria | 2141 |
| 313 | Ga0501034_0170545 | 3300049571 | Bacteria | 2143 |
| 314 | Ga0501034_1099370 | 3300049571 | Bacteria | 676 |
| 315 | Ga0501036_0529422 | 3300049572 | Bacteria | 980 |
| 316 | Ga0501047_1098399 | 3300049581 | Bacteria | 609 |
| 317 | Ga0501069_0003685 | 3300049585 | Bacteria | 7884 |
| 318 | Ga0501070_0096165 | 3300049586 | Bacteria | 2450 |
| 319 | Ga0501035_0199127 | 3300049822 | Bacteria | 1719 |
| 320 | Ga0501044_0144009 | 3300049823 | Bacteria | 2370 |
| 321 | nmdc:mga0sz30_27297_c1 | 3300050516 | Bacteria | 2344 |
| 322 | Ga0500643_000590 | 3300053087 | Bacteria | 25096 |
| 323 | Ga0500643_056755 | 3300053087 | Bacteria | 1106 |
| 324 | Ga0500555_000197 | 3300053103 | Bacteria | 27950 |
| 325 | Ga0500556_0148207 | 3300053104 | Unclassified | 924 |
| 326 | Ga0500592_001082 | 3300053116 | Bacteria | 4437 |
| 327 | Ga0500559_0398632 | 3300053136 | Bacteria | 640 |
| 328 | Ga0500616_0007276 | 3300053153 | Bacteria | 7064 |
| 329 | Ga0500616_0029597 | 3300053153 | Bacteria | 3012 |
| 330 | Ga0500627_0006961 | 3300053158 | Bacteria | 3897 |
| 331 | Ga0466962_0004869 | 3300061719 | Bacteria | 6457 |
| 332 | Ga0466962_0062570 | 3300061719 | Bacteria | 1777 |
| 333 | Ga0466962_0103801 | 3300061719 | Bacteria | 1366 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_1258480 | Ga0451577_1258480_125_565 | 134 |
| 2 | 3300045051 | Ga0451576_0643722 | Ga0451576_0643722_253_705 | 134 |
| 3 | 3300001989 | JGI24739J22299_10011761 | JGI24739J22299_100117614 | 136 |
| 4 | 3300001989 | JGI24739J22299_10019562 | JGI24739J22299_100195625 | 136 |
| 5 | 3300001989 | JGI24739J22299_10027687 | JGI24739J22299_100276872 | 136 |
| 6 | 3300001990 | JGI24737J22298_10002759 | JGI24737J22298_100027593 | 136 |
| 7 | 3300001990 | JGI24737J22298_10016968 | JGI24737J22298_100169682 | 136 |
| 8 | 3300001990 | JGI24737J22298_10146657 | JGI24737J22298_101466571 | 136 |
| 9 | 3300002067 | JGI24735J21928_10012987 | JGI24735J21928_100129873 | 136 |
| 10 | 3300002067 | JGI24735J21928_10016142 | JGI24735J21928_100161422 | 136 |
| 11 | 3300002067 | JGI24735J21928_10019954 | JGI24735J21928_100199544 | 136 |
| 12 | 3300002075 | JGI24738J21930_10000648 | JGI24738J21930_1000064810 | 136 |
| 13 | 3300002077 | JGI24744J21845_10001869 | JGI24744J21845_100018694 | 136 |
| 14 | 3300002772 | JGI25164J39214_1010745 | JGI25164J39214_10107452 | 136 |
| 15 | 3300003214 | JGI25165J46597_1000023 | JGI25165J46597_100002374 | 136 |
| 16 | 3300003316 | rootH1_10107509 | rootH1_101075092 | 136 |
| 17 | 3300003320 | rootH2_10068880 | rootH2_100688802 | 136 |
| 18 | 3300003320 | rootH2_10194905 | rootH2_101949052 | 136 |
| 19 | 3300003322 | rootL2_10273647 | rootL2_102736472 | 136 |
| 20 | 3300003323 | rootH1_10040023 | rootH1_100400232 | 136 |
| 21 | 3300003323 | rootH1_10295821 | rootH1_102958211 | 136 |
| 22 | 3300003762 | Ga0055542_1008441 | Ga0055542_10084412 | 136 |
| 23 | 3300005327 | Ga0070658_10000536 | Ga0070658_1000053612 | 136 |
| 24 | 3300005327 | Ga0070658_10000851 | Ga0070658_1000085119 | 136 |
| 25 | 3300005327 | Ga0070658_10011762 | Ga0070658_100117627 | 136 |
| 26 | 3300005327 | Ga0070658_10145909 | Ga0070658_101459092 | 136 |
| 27 | 3300005327 | Ga0070658_10404738 | Ga0070658_104047381 | 136 |
| 28 | 3300005328 | Ga0070676_10000031 | Ga0070676_1000003141 | 136 |
| 29 | 3300005335 | Ga0070666_10166751 | Ga0070666_101667513 | 136 |
| 30 | 3300005339 | Ga0070660_100000700 | Ga0070660_10000070018 | 136 |
| 31 | 3300005339 | Ga0070660_100015926 | Ga0070660_1000159266 | 136 |
| 32 | 3300005339 | Ga0070660_100376421 | Ga0070660_1003764213 | 136 |
| 33 | 3300005344 | Ga0070661_100528276 | Ga0070661_1005282762 | 136 |
| 34 | 3300005354 | Ga0070675_100034822 | Ga0070675_1000348223 | 136 |
| 35 | 3300005364 | Ga0070673_100000022 | Ga0070673_10000002268 | 136 |
| 36 | 3300005366 | Ga0070659_101151587 | Ga0070659_1011515872 | 136 |
| 37 | 3300005455 | Ga0070663_100001359 | Ga0070663_1000013599 | 136 |
| 38 | 3300005456 | Ga0070678_100044311 | Ga0070678_1000443114 | 136 |
| 39 | 3300005457 | Ga0070662_100014545 | Ga0070662_1000145454 | 136 |
| 40 | 3300005459 | Ga0068867_100000023 | Ga0068867_10000002330 | 136 |
| 41 | 3300005539 | Ga0068853_100146360 | Ga0068853_1001463601 | 136 |
| 42 | 3300005539 | Ga0068853_100936439 | Ga0068853_1009364391 | 136 |
| 43 | 3300005543 | Ga0070672_100077795 | Ga0070672_1000777953 | 136 |
| 44 | 3300005547 | Ga0070693_100044595 | Ga0070693_1000445953 | 136 |
| 45 | 3300005548 | Ga0070665_101376850 | Ga0070665_1013768502 | 136 |
| 46 | 3300005563 | Ga0068855_100000031 | Ga0068855_100000031171 | 136 |
| 47 | 3300005563 | Ga0068855_100073516 | Ga0068855_1000735165 | 136 |
| 48 | 3300005564 | Ga0070664_100450047 | Ga0070664_1004500471 | 136 |
| 49 | 3300005577 | Ga0068857_100129981 | Ga0068857_1001299814 | 136 |
| 50 | 3300005578 | Ga0068854_100043461 | Ga0068854_1000434612 | 136 |
| 51 | 3300005578 | Ga0068854_100056189 | Ga0068854_1000561894 | 136 |
| 52 | 3300005614 | Ga0068856_100024524 | Ga0068856_10002452410 | 136 |
| 53 | 3300005614 | Ga0068856_100139144 | Ga0068856_1001391445 | 136 |
| 54 | 3300005616 | Ga0068852_100000627 | Ga0068852_10000062727 | 136 |
| 55 | 3300005616 | Ga0068852_100859444 | Ga0068852_1008594442 | 136 |
| 56 | 3300005718 | Ga0068866_10133491 | Ga0068866_101334912 | 136 |
| 57 | 3300006237 | Ga0097621_100010552 | Ga0097621_10001055211 | 136 |
| 58 | 3300006358 | Ga0068871_100010769 | Ga0068871_1000107694 | 136 |
| 59 | 3300006881 | Ga0068865_100000031 | Ga0068865_10000003168 | 136 |
| 60 | 3300009093 | Ga0105240_10094922 | Ga0105240_100949222 | 136 |
| 61 | 3300009098 | Ga0105245_10013418 | Ga0105245_100134183 | 136 |
| 62 | 3300009148 | Ga0105243_10000156 | Ga0105243_1000015633 | 136 |
| 63 | 3300009174 | Ga0105241_10426340 | Ga0105241_104263402 | 136 |
| 64 | 3300009176 | Ga0105242_10004742 | Ga0105242_1000474214 | 136 |
| 65 | 3300009551 | Ga0105238_10273674 | Ga0105238_102736743 | 136 |
| 66 | 3300009553 | Ga0105249_10031092 | Ga0105249_100310924 | 136 |
| 67 | 3300010375 | Ga0105239_10076889 | Ga0105239_100768893 | 136 |
| 68 | 3300010375 | Ga0105239_11073479 | Ga0105239_110734792 | 136 |
| 69 | 3300011119 | Ga0105246_10055066 | Ga0105246_100550665 | 136 |
| 70 | 3300013100 | Ga0157373_10110090 | Ga0157373_101100903 | 136 |
| 71 | 3300013100 | Ga0157373_10582932 | Ga0157373_105829321 | 136 |
| 72 | 3300013102 | Ga0157371_10123433 | Ga0157371_101234333 | 136 |
| 73 | 3300013104 | Ga0157370_10000017 | Ga0157370_1000001720 | 136 |
| 74 | 3300013105 | Ga0157369_10014895 | Ga0157369_100148953 | 136 |
| 75 | 3300013296 | Ga0157374_10000656 | Ga0157374_1000065614 | 136 |
| 76 | 3300013297 | Ga0157378_10000504 | Ga0157378_100005042 | 136 |
| 77 | 3300013306 | Ga0163162_10047022 | Ga0163162_100470226 | 136 |
| 78 | 3300013307 | Ga0157372_10185041 | Ga0157372_101850412 | 136 |
| 79 | 3300013307 | Ga0157372_10204927 | Ga0157372_102049273 | 136 |
| 80 | 3300013307 | Ga0157372_10280767 | Ga0157372_102807673 | 136 |
| 81 | 3300014969 | Ga0157376_10000124 | Ga0157376_100001246 | 136 |
| 82 | 3300017792 | Ga0163161_10331454 | Ga0163161_103314542 | 136 |
| 83 | 3300025231 | Ga0207427_100774 | Ga0207427_1007743 | 136 |
| 84 | 3300025250 | Ga0209026_1002932 | Ga0209026_10029324 | 136 |
| 85 | 3300025254 | Ga0209148_1000059 | Ga0209148_1000059321 | 136 |
| 86 | 3300025254 | Ga0209148_1001344 | Ga0209148_10013446 | 136 |
| 87 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003913 | 136 |
| 88 | 3300025272 | Ga0209455_1001597 | Ga0209455_10015976 | 136 |
| 89 | 3300025272 | Ga0209455_1032626 | Ga0209455_10326262 | 136 |
| 90 | 3300025899 | Ga0207642_10107273 | Ga0207642_101072733 | 136 |
| 91 | 3300025901 | Ga0207688_10200726 | Ga0207688_102007262 | 136 |
| 92 | 3300025903 | Ga0207680_10283324 | Ga0207680_102833242 | 136 |
| 93 | 3300025904 | Ga0207647_10000710 | Ga0207647_1000071029 | 136 |
| 94 | 3300025904 | Ga0207647_10218224 | Ga0207647_102182243 | 136 |
| 95 | 3300025904 | Ga0207647_10248178 | Ga0207647_102481782 | 136 |
| 96 | 3300025904 | Ga0207647_10394452 | Ga0207647_103944522 | 136 |
| 97 | 3300025907 | Ga0207645_10016352 | Ga0207645_100163523 | 136 |
| 98 | 3300025909 | Ga0207705_10000178 | Ga0207705_1000017818 | 136 |
| 99 | 3300025909 | Ga0207705_10000243 | Ga0207705_1000024357 | 136 |
| 100 | 3300025909 | Ga0207705_10023638 | Ga0207705_100236384 | 136 |
| 101 | 3300025909 | Ga0207705_10114196 | Ga0207705_101141963 | 136 |
| 102 | 3300025913 | Ga0207695_10024973 | Ga0207695_1002497311 | 136 |
| 103 | 3300025913 | Ga0207695_11068708 | Ga0207695_110687081 | 136 |
| 104 | 3300025919 | Ga0207657_10030954 | Ga0207657_100309546 | 136 |
| 105 | 3300025919 | Ga0207657_10401041 | Ga0207657_104010412 | 136 |
| 106 | 3300025919 | Ga0207657_10581269 | Ga0207657_105812692 | 136 |
| 107 | 3300025920 | Ga0207649_10356520 | Ga0207649_103565202 | 136 |
| 108 | 3300025927 | Ga0207687_10213353 | Ga0207687_102133533 | 136 |
| 109 | 3300025933 | Ga0207706_10024963 | Ga0207706_100249636 | 136 |
| 110 | 3300025934 | Ga0207686_10001385 | Ga0207686_100013857 | 136 |
| 111 | 3300025935 | Ga0207709_10000447 | Ga0207709_1000044730 | 136 |
| 112 | 3300025938 | Ga0207704_10000008 | Ga0207704_10000008156 | 136 |
| 113 | 3300025940 | Ga0207691_10070922 | Ga0207691_100709223 | 136 |
| 114 | 3300025949 | Ga0207667_10000029 | Ga0207667_10000029306 | 136 |
| 115 | 3300025949 | Ga0207667_10034843 | Ga0207667_100348434 | 136 |
| 116 | 3300025949 | Ga0207667_10618220 | Ga0207667_106182202 | 136 |
| 117 | 3300025960 | Ga0207651_10000008 | Ga0207651_1000000868 | 136 |
| 118 | 3300025961 | Ga0207712_10033435 | Ga0207712_100334354 | 136 |
| 119 | 3300025981 | Ga0207640_10000357 | Ga0207640_1000035722 | 136 |
| 120 | 3300025981 | Ga0207640_10023046 | Ga0207640_100230462 | 136 |
| 121 | 3300026023 | Ga0207677_10000091 | Ga0207677_1000009149 | 136 |
| 122 | 3300026041 | Ga0207639_10007455 | Ga0207639_100074552 | 136 |
| 123 | 3300026067 | Ga0207678_10002781 | Ga0207678_1000278115 | 136 |
| 124 | 3300026078 | Ga0207702_10013616 | Ga0207702_100136169 | 136 |
| 125 | 3300026078 | Ga0207702_10030512 | Ga0207702_100305123 | 136 |
| 126 | 3300026078 | Ga0207702_10145466 | Ga0207702_101454662 | 136 |
| 127 | 3300026089 | Ga0207648_10000009 | Ga0207648_1000000968 | 136 |
| 128 | 3300026116 | Ga0207674_10155072 | Ga0207674_101550724 | 136 |
| 129 | 3300026121 | Ga0207683_10019752 | Ga0207683_100197524 | 136 |
| 130 | 3300026142 | Ga0207698_10001899 | Ga0207698_100018996 | 136 |
| 131 | 3300026142 | Ga0207698_10526381 | Ga0207698_105263812 | 136 |
| 132 | 3300028379 | Ga0268266_10486337 | Ga0268266_104863372 | 136 |
| 133 | 3300028379 | Ga0268266_11308947 | Ga0268266_113089472 | 136 |
| 134 | 3300037312 | Ga0395899_0000406 | Ga0395899_0000406_15576_16004 | 136 |
| 135 | 3300037418 | Ga0395900_0193125 | Ga0395900_0193125_183_611 | 136 |
| 136 | 3300037418 | Ga0395900_0287725 | Ga0395900_0287725_457_885 | 136 |
| 137 | 3300037418 | Ga0395900_0502243 | Ga0395900_0502243_570_998 | 136 |
| 138 | 3300037466 | Ga0395898_0583135 | Ga0395898_0583135_455_883 | 136 |
| 139 | 3300037466 | Ga0395898_1856408 | Ga0395898_1856408_66_506 | 136 |
| 140 | 3300037471 | Ga0395905_0020721 | Ga0395905_0020721_2968_3396 | 136 |
| 141 | 3300037471 | Ga0395905_0125058 | Ga0395905_0125058_786_1217 | 136 |
| 142 | 3300037471 | Ga0395905_0221539 | Ga0395905_0221539_660_1091 | 136 |
| 143 | 3300037471 | Ga0395905_0557232 | Ga0395905_0557232_293_721 | 136 |
| 144 | 3300038443 | Ga0395901_0044040 | Ga0395901_0044040_2160_2588 | 136 |
| 145 | 3300038443 | Ga0395901_0740739 | Ga0395901_0740739_314_742 | 136 |
| 146 | 3300041452 | Ga0451793_0460554 | Ga0451793_0460554_124_552 | 136 |
| 147 | 3300044658 | Ga0466972_0008358 | Ga0466972_0008358_444_875 | 136 |
| 148 | 3300044683 | Ga0466965_0105853 | Ga0466965_0105853_956_1387 | 136 |
| 149 | 3300044684 | Ga0466966_0058153 | Ga0466966_0058153_1026_1457 | 136 |
| 150 | 3300044693 | Ga0466961_0009726 | Ga0466961_0009726_2802_3233 | 136 |
| 151 | 3300044694 | Ga0466963_0028893 | Ga0466963_0028893_2032_2475 | 136 |
| 152 | 3300044706 | Ga0466964_0044688 | Ga0466964_0044688_1270_1701 | 136 |
| 153 | 3300044706 | Ga0466964_0057123 | Ga0466964_0057123_578_1021 | 136 |
| 154 | 3300044719 | Ga0466971_0020171 | Ga0466971_0020171_1854_2297 | 136 |
| 155 | 3300044719 | Ga0466971_0531365 | Ga0466971_0531365_88_519 | 136 |
| 156 | 3300044735 | Ga0466968_0006722 | Ga0466968_0006722_3337_3768 | 136 |
| 157 | 3300044735 | Ga0466968_0279620 | Ga0466968_0279620_132_563 | 136 |
| 158 | 3300044842 | Ga0466957_0064047 | Ga0466957_0064047_1224_1652 | 136 |
| 159 | 3300044842 | Ga0466957_0071019 | Ga0466957_0071019_1256_1684 | 136 |
| 160 | 3300044901 | Ga0466960_0001025 | Ga0466960_0001025_5687_6118 | 136 |
| 161 | 3300045049 | Ga0466959_0038923 | Ga0466959_0038923_589_1020 | 136 |
| 162 | 3300045836 | Ga0466958_0011710 | Ga0466958_0011710_695_1138 | 136 |
| 163 | 3300045836 | Ga0466958_0163972 | Ga0466958_0163972_656_1087 | 136 |
| 164 | 3300045976 | Ga0466967_0066889 | Ga0466967_0066889_2035_2478 | 136 |
| 165 | 3300048905 | Ga0496102_0256501 | Ga0496102_0256501_23_451 | 136 |
| 166 | 3300048905 | Ga0496102_1109822 | Ga0496102_1109822_151_579 | 136 |
| 167 | 3300048912 | Ga0496109_1067034 | Ga0496109_1067034_193_624 | 136 |
| 168 | 3300048918 | Ga0496115_0556642 | Ga0496115_0556642_230_658 | 136 |
| 169 | 3300048920 | Ga0496117_0041777 | Ga0496117_0041777_28_456 | 136 |
| 170 | 3300048921 | Ga0496118_0086805 | Ga0496118_0086805_875_1303 | 136 |
| 171 | 3300048921 | Ga0496118_0089979 | Ga0496118_0089979_1179_1607 | 136 |
| 172 | 3300048922 | Ga0496119_0166534 | Ga0496119_0166534_76_504 | 136 |
| 173 | 3300048923 | Ga0496120_0038278 | Ga0496120_0038278_1054_1482 | 136 |
| 174 | 3300048924 | Ga0496121_0017421 | Ga0496121_0017421_4449_4877 | 136 |
| 175 | 3300048924 | Ga0496121_0033641 | Ga0496121_0033641_651_1079 | 136 |
| 176 | 3300048925 | Ga0496122_0009442 | Ga0496122_0009442_6849_7277 | 136 |
| 177 | 3300048926 | Ga0496123_0016119 | Ga0496123_0016119_4144_4572 | 136 |
| 178 | 3300048927 | Ga0496124_0164781 | Ga0496124_0164781_942_1370 | 136 |
| 179 | 3300048928 | Ga0496125_0029710 | Ga0496125_0029710_1508_1936 | 136 |
| 180 | 3300048929 | Ga0496126_0639519 | Ga0496126_0639519_190_618 | 136 |
| 181 | 3300049822 | Ga0501035_0199127 | Ga0501035_0199127_676_1137 | 136 |
| 182 | 3300053136 | Ga0500559_0398632 | Ga0500559_0398632_194_622 | 136 |
| 183 | 3300061719 | Ga0466962_0004869 | Ga0466962_0004869_3232_3675 | 136 |
| 184 | 3300061719 | Ga0466962_0062570 | Ga0466962_0062570_906_1337 | 136 |
| 185 | 3300061719 | Ga0466962_0103801 | Ga0466962_0103801_708_1136 | 136 |
| 186 | 3300009093 | Ga0105240_11314132 | Ga0105240_113141322 | 137 |
| 187 | 3300009545 | Ga0105237_10314783 | Ga0105237_103147832 | 137 |
| 188 | 3300010375 | Ga0105239_10752168 | Ga0105239_107521682 | 137 |
| 189 | 3300025919 | Ga0207657_10001372 | Ga0207657_1000137210 | 137 |
| 190 | 3300026041 | Ga0207639_10508655 | Ga0207639_105086552 | 137 |
| 191 | 3300014326 | Ga0157380_11655808 | Ga0157380_116558081 | 139 |
| 192 | 3300025940 | Ga0207691_10784776 | Ga0207691_107847762 | 139 |
| 193 | 3300028381 | Ga0268264_10014027 | Ga0268264_1001402712 | 139 |
| 194 | 3300053087 | Ga0500643_000590 | Ga0500643_000590_20162_20596 | 139 |
| 195 | 3300033180 | Ga0307510_10139957 | Ga0307510_101399572 | 141 |
| 196 | 3300037471 | Ga0395905_0144034 | Ga0395905_0144034_1068_1499 | 141 |
| 197 | 3300038443 | Ga0395901_0466651 | Ga0395901_0466651_80_511 | 141 |
| 198 | 3300044735 | Ga0466968_0079968 | Ga0466968_0079968_663_1103 | 141 |
| 199 | 3300005333 | Ga0070677_10000460 | Ga0070677_100004602 | 142 |
| 200 | 3300031548 | Ga0307408_100275844 | Ga0307408_1002758441 | 142 |
| 201 | 3300032002 | Ga0307416_101958002 | Ga0307416_1019580022 | 142 |
| 202 | 3300049571 | Ga0501034_1099370 | Ga0501034_1099370_78_506 | 142 |
| 203 | 3300009093 | Ga0105240_10318037 | Ga0105240_103180372 | 143 |
| 204 | 3300010375 | Ga0105239_13100509 | Ga0105239_131005091 | 143 |
| 205 | 3300025913 | Ga0207695_10262964 | Ga0207695_102629642 | 143 |
| 206 | 3300025949 | Ga0207667_10233946 | Ga0207667_102339465 | 143 |
| 207 | 3300025949 | Ga0207667_10536301 | Ga0207667_105363013 | 143 |
| 208 | 3300026142 | Ga0207698_10227208 | Ga0207698_102272081 | 143 |
| 209 | 3300044735 | Ga0466968_0249347 | Ga0466968_0249347_13_453 | 143 |
| 210 | 3300046460 | Ga0495638_0029330 | Ga0495638_0029330_1654_2097 | 143 |
| 211 | 3300046506 | Ga0495583_0000286 | Ga0495583_0000286_60431_60874 | 143 |
| 212 | 3300046507 | Ga0495606_0001833 | Ga0495606_0001833_23134_23577 | 143 |
| 213 | 3300046530 | Ga0495654_0021389 | Ga0495654_0021389_74_514 | 143 |
| 214 | 3300046665 | Ga0495661_0017039 | Ga0495661_0017039_1177_1620 | 143 |
| 215 | 3300046691 | Ga0495670_0198804 | Ga0495670_0198804_211_654 | 143 |
| 216 | 3300047469 | Ga0495673_0009463 | Ga0495673_0009463_4803_5258 | 143 |
| 217 | 3300047469 | Ga0495673_0176781 | Ga0495673_0176781_108_557 | 143 |
| 218 | 3300047472 | Ga0495686_0000147 | Ga0495686_0000147_100568_101017 | 143 |
| 219 | 3300047472 | Ga0495686_0229089 | Ga0495686_0229089_245_688 | 143 |
| 220 | 3300048920 | Ga0496117_0057975 | Ga0496117_0057975_1206_1649 | 143 |
| 221 | 3300048926 | Ga0496123_0030231 | Ga0496123_0030231_680_1135 | 143 |
| 222 | 3300049570 | Ga0501033_0098051 | Ga0501033_0098051_55_504 | 143 |
| 223 | 3300049571 | Ga0501034_0170545 | Ga0501034_0170545_658_1101 | 143 |
| 224 | 3300049572 | Ga0501036_0529422 | Ga0501036_0529422_312_755 | 143 |
| 225 | 3300049581 | Ga0501047_1098399 | Ga0501047_1098399_74_523 | 143 |
| 226 | 3300049585 | Ga0501069_0003685 | Ga0501069_0003685_6051_6494 | 143 |
| 227 | 3300049586 | Ga0501070_0096165 | Ga0501070_0096165_252_695 | 143 |
| 228 | 3300049823 | Ga0501044_0144009 | Ga0501044_0144009_1283_1732 | 143 |
| 229 | 3300053103 | Ga0500555_000197 | Ga0500555_000197_4731_5174 | 143 |
| 230 | 3300053104 | Ga0500556_0148207 | Ga0500556_0148207_206_652 | 143 |
| 231 | 3300053116 | Ga0500592_001082 | Ga0500592_001082_3152_3592 | 143 |
| 232 | 3300053153 | Ga0500616_0007276 | Ga0500616_0007276_2142_2588 | 143 |
| 233 | 3300053153 | Ga0500616_0029597 | Ga0500616_0029597_1260_1703 | 143 |
| 234 | 3300053158 | Ga0500627_0006961 | Ga0500627_0006961_36_476 | 143 |
| 235 | iso_pu_bacteria | 2739367664 | 2739649189 | 143 |
| 236 | iso_pu_bacteria | 2739367865 | 2740027662 | 143 |
| 237 | 3300005327 | Ga0070658_10000029 | Ga0070658_10000029142 | 144 |
| 238 | 3300005327 | Ga0070658_10781842 | Ga0070658_107818422 | 144 |
| 239 | 3300005336 | Ga0070680_100006474 | Ga0070680_1000064744 | 144 |
| 240 | 3300005338 | Ga0068868_100000007 | Ga0068868_10000000727 | 144 |
| 241 | 3300005339 | Ga0070660_100000715 | Ga0070660_10000071521 | 144 |
| 242 | 3300005339 | Ga0070660_100005309 | Ga0070660_1000053098 | 144 |
| 243 | 3300005339 | Ga0070660_100006043 | Ga0070660_1000060436 | 144 |
| 244 | 3300005344 | Ga0070661_100000055 | Ga0070661_10000005563 | 144 |
| 245 | 3300005345 | Ga0070692_10015367 | Ga0070692_1001536710 | 144 |
| 246 | 3300005354 | Ga0070675_100014811 | Ga0070675_10001481111 | 144 |
| 247 | 3300005364 | Ga0070673_100589708 | Ga0070673_1005897082 | 144 |
| 248 | 3300005366 | Ga0070659_100000004 | Ga0070659_100000004214 | 144 |
| 249 | 3300005366 | Ga0070659_100006080 | Ga0070659_10000608012 | 144 |
| 250 | 3300005458 | Ga0070681_10122957 | Ga0070681_101229576 | 144 |
| 251 | 3300005530 | Ga0070679_100000017 | Ga0070679_1000000179 | 144 |
| 252 | 3300005530 | Ga0070679_100727806 | Ga0070679_1007278062 | 144 |
| 253 | 3300005544 | Ga0070686_100000218 | Ga0070686_10000021834 | 144 |
| 254 | 3300005546 | Ga0070696_100171724 | Ga0070696_1001717242 | 144 |
| 255 | 3300005548 | Ga0070665_100000054 | Ga0070665_100000054209 | 144 |
| 256 | 3300005548 | Ga0070665_100914005 | Ga0070665_1009140052 | 144 |
| 257 | 3300005578 | Ga0068854_100126342 | Ga0068854_1001263424 | 144 |
| 258 | 3300005841 | Ga0068863_100011069 | Ga0068863_1000110694 | 144 |
| 259 | 3300009093 | Ga0105240_10003725 | Ga0105240_1000372515 | 144 |
| 260 | 3300009098 | Ga0105245_10346468 | Ga0105245_103464682 | 144 |
| 261 | 3300009148 | Ga0105243_11275822 | Ga0105243_112758222 | 144 |
| 262 | 3300009545 | Ga0105237_10028430 | Ga0105237_100284304 | 144 |
| 263 | 3300009551 | Ga0105238_12062408 | Ga0105238_120624082 | 144 |
| 264 | 3300010375 | Ga0105239_10001121 | Ga0105239_1000112125 | 144 |
| 265 | 3300011119 | Ga0105246_11524679 | Ga0105246_115246792 | 144 |
| 266 | 3300013105 | Ga0157369_10010900 | Ga0157369_100109002 | 144 |
| 267 | 3300013297 | Ga0157378_10659032 | Ga0157378_106590323 | 144 |
| 268 | 3300021358 | Ga0213873_10000027 | Ga0213873_1000002726 | 144 |
| 269 | 3300021377 | Ga0213874_10142843 | Ga0213874_101428431 | 144 |
| 270 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004341 | 144 |
| 271 | 3300021384 | Ga0213876_10000395 | Ga0213876_1000039525 | 144 |
| 272 | 3300021384 | Ga0213876_10002246 | Ga0213876_100022469 | 144 |
| 273 | 3300021384 | Ga0213876_10027171 | Ga0213876_100271718 | 144 |
| 274 | 3300025907 | Ga0207645_10198261 | Ga0207645_101982612 | 144 |
| 275 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002876 | 144 |
| 276 | 3300025909 | Ga0207705_10596530 | Ga0207705_105965302 | 144 |
| 277 | 3300025912 | Ga0207707_10012541 | Ga0207707_100125418 | 144 |
| 278 | 3300025913 | Ga0207695_10063772 | Ga0207695_100637722 | 144 |
| 279 | 3300025914 | Ga0207671_10001063 | Ga0207671_1000106327 | 144 |
| 280 | 3300025917 | Ga0207660_10030106 | Ga0207660_100301065 | 144 |
| 281 | 3300025919 | Ga0207657_10000519 | Ga0207657_1000051932 | 144 |
| 282 | 3300025919 | Ga0207657_10019103 | Ga0207657_100191038 | 144 |
| 283 | 3300025919 | Ga0207657_10019782 | Ga0207657_100197826 | 144 |
| 284 | 3300025920 | Ga0207649_10000018 | Ga0207649_100000189 | 144 |
| 285 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001860 | 144 |
| 286 | 3300025926 | Ga0207659_10008425 | Ga0207659_100084253 | 144 |
| 287 | 3300025927 | Ga0207687_10114803 | Ga0207687_101148033 | 144 |
| 288 | 3300025927 | Ga0207687_10217322 | Ga0207687_102173222 | 144 |
| 289 | 3300025927 | Ga0207687_10291207 | Ga0207687_102912072 | 144 |
| 290 | 3300025927 | Ga0207687_10403780 | Ga0207687_104037802 | 144 |
| 291 | 3300025932 | Ga0207690_10000001 | Ga0207690_10000001371 | 144 |
| 292 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002371 | 144 |
| 293 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003371 | 144 |
| 294 | 3300025932 | Ga0207690_10000004 | Ga0207690_10000004371 | 144 |
| 295 | 3300025932 | Ga0207690_10004468 | Ga0207690_100044686 | 144 |
| 296 | 3300025949 | Ga0207667_10702175 | Ga0207667_107021751 | 144 |
| 297 | 3300025960 | Ga0207651_10353460 | Ga0207651_103534602 | 144 |
| 298 | 3300026023 | Ga0207677_10000014 | Ga0207677_10000014205 | 144 |
| 299 | 3300026075 | Ga0207708_11051023 | Ga0207708_110510232 | 144 |
| 300 | 3300026088 | Ga0207641_10013366 | Ga0207641_100133663 | 144 |
| 301 | 3300028379 | Ga0268266_10000414 | Ga0268266_1000041433 | 144 |
| 302 | 3300028379 | Ga0268266_10082572 | Ga0268266_100825722 | 144 |
| 303 | 3300032004 | Ga0307414_11783467 | Ga0307414_117834671 | 144 |
| 304 | 3300039437 | Ga0436365_0102423 | Ga0436365_0102423_22698_23135 | 144 |
| 305 | 3300039437 | Ga0436365_0487522 | Ga0436365_0487522_12454_12891 | 144 |
| 306 | 3300039437 | Ga0436365_1487768 | Ga0436365_1487768_1218_1661 | 144 |
| 307 | 3300039437 | Ga0436365_1792312 | Ga0436365_1792312_1999_2442 | 144 |
| 308 | 3300039453 | Ga0436362_0740394 | Ga0436362_0740394_22698_23135 | 144 |
| 309 | 3300046528 | Ga0495642_0067472 | Ga0495642_0067472_822_1265 | 144 |
| 310 | 3300048918 | Ga0496115_0216090 | Ga0496115_0216090_653_1105 | 144 |
| 311 | 3300048921 | Ga0496118_0170172 | Ga0496118_0170172_352_804 | 144 |
| 312 | 3300048922 | Ga0496119_0153595 | Ga0496119_0153595_340_792 | 144 |
| 313 | 3300048924 | Ga0496121_0008708 | Ga0496121_0008708_3160_3612 | 144 |
| 314 | 3300048924 | Ga0496121_0019788 | Ga0496121_0019788_3397_3849 | 144 |
| 315 | 3300048929 | Ga0496126_0012159 | Ga0496126_0012159_5539_5991 | 144 |
| 316 | 3300053087 | Ga0500643_056755 | Ga0500643_056755_403_843 | 144 |
| 317 | 3300009177 | Ga0105248_10017071 | Ga0105248_100170712 | 145 |
| 318 | 3300025941 | Ga0207711_10038379 | Ga0207711_100383792 | 145 |
| 319 | 3300000549 | LJQas_1006858 | LJQas_10068582 | 146 |
| 320 | 3300005295 | Ga0065707_10554733 | Ga0065707_105547331 | 146 |
| 321 | 3300005843 | Ga0068860_100001425 | Ga0068860_1000014255 | 146 |
| 322 | 3300006353 | Ga0075370_10478931 | Ga0075370_104789312 | 146 |
| 323 | 3300009101 | Ga0105247_10003119 | Ga0105247_100031193 | 146 |
| 324 | 3300009148 | Ga0105243_12312116 | Ga0105243_123121161 | 146 |
| 325 | 3300014326 | Ga0157380_10672288 | Ga0157380_106722881 | 146 |
| 326 | 3300025900 | Ga0207710_10003845 | Ga0207710_100038453 | 146 |
| 327 | 3300026088 | Ga0207641_10003047 | Ga0207641_1000304713 | 146 |
| 328 | 3300026088 | Ga0207641_10745482 | Ga0207641_107454822 | 146 |
| 329 | 3300028381 | Ga0268264_10000974 | Ga0268264_1000097415 | 146 |
| 330 | 3300031456 | Ga0307513_10048836 | Ga0307513_100488363 | 146 |
| 331 | 3300039450 | Ga0436363_1063151 | Ga0436363_1063151_235_687 | 146 |
| 332 | 3300042876 | Ga0451577_0538260 | Ga0451577_0538260_37_528 | 146 |
| 333 | 3300048920 | Ga0496117_0068570 | Ga0496117_0068570_1177_1713 | 146 |
| 334 | 3300048921 | Ga0496118_0134093 | Ga0496118_0134093_391_927 | 146 |
| 335 | 3300050516 | nmdc:mga0sz30_27297_c1 | nmdc:mga0sz30_27297_c1_1271_1753 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dsl-assembly1.cif.gz_A | mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 | 0.909 | 26 | 145 |
| 3dkz-assembly1.cif.gz_A | crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. | 0.9062 | 23 | 146 |
| 1ixl-assembly1.cif.gz_A | crystal structure of uncharacterized protein ph1136 from pyrococcus horikoshii | 0.9061 | 32 | 146 |
| 1wlu-assembly1.cif.gz_A | crystal structure of tt0310 protein from thermus thermophilus hb8 | 0.9049 | 26 | 145 |
| 3lbe-assembly1.cif.gz_B | the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa | 0.9046 | 31 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wluA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9049 | 26 | 145 | 3.10.129.10 |
| 1zkiB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9012 | 20 | 145 | 3.10.129.10 |
| af_Q54GL4_70_197_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8905 | 19 | 144 | 3.10.129.10 |
| af_A0A1D6F200_19_155_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8897 | 30 | 146 | 3.10.129.10 |
| 3s4kB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8886 | 23 | 146 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q8XKJ1-F1-model_v4 | Phenylacetic acid degradation protein | 0.9909 | 24 | 145 |
GO:0005829
GO:0061522 |
| AF-A0A7Y0BLM3-F1-model_v4 | PaaI family thioesterase | 0.9889 | 10 | 146 |
GO:0016289
|
| AF-A0A4U1L686-F1-model_v4 | PaaI family thioesterase | 0.9887 | 29 | 146 |
GO:0005829
GO:0061522 |
| AF-A0A259HG76-F1-model_v4 | Phenylacetic acid degradation protein | 0.9886 | 22 | 129 |
GO:0016289
|
| AF-A0A245ZJ21-F1-model_v4 | Thioesterase domain-containing protein | 0.9878 | 23 | 146 |
GO:0016289
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar