F412428

General Info

Members Datasets Scaffolds Average Seq Length
335 191 333 147

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0170545|Ga0501034_0170545_658_1101
Length 147
Sequence MSASPTPATGMSFDPAFLMERLRTYGHGGALGITYVDHGADWCALALPYDEHLVAGPNGILASGPIVSLMDMATSMSLWIRLGRFRPQATLDLRVDYLRPARPGQTITGRGECYGATRSVGFVRGTAHDGDPADPVAHVSGTFMFTD

Samples

Sample ID Description Type Environment
1 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
2 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 0
Rhizoplane 1.79
Rhizosphere 79.7
Stem 0
Stem Tuber 0
Unclassified 12.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006858 3300000549 Bacteria 1409
2 JGI24739J22299_10011761 3300001989 Bacteria 3225
3 JGI24739J22299_10019562 3300001989 Bacteria 2422
4 JGI24739J22299_10027687 3300001989 Bacteria 1980
5 JGI24737J22298_10002759 3300001990 Bacteria 6211
6 JGI24737J22298_10016968 3300001990 Bacteria 2348
7 JGI24737J22298_10146657 3300001990 Bacteria 697
8 JGI24735J21928_10012987 3300002067 Bacteria 2625
9 JGI24735J21928_10016142 3300002067 Bacteria 2322
10 JGI24735J21928_10019954 3300002067 Bacteria 2056
11 JGI24738J21930_10000648 3300002075 Bacteria 10051
12 JGI24744J21845_10001869 3300002077 Bacteria 4226
13 JGI25164J39214_1010745 3300002772 Bacteria 883
14 JGI25165J46597_1000023 3300003214 Bacteria 338873
15 rootH1_10107509 3300003316 Bacteria 2016
16 rootH2_10068880 3300003320 Bacteria 1676
17 rootH2_10194905 3300003320 Bacteria 1149
18 rootL2_10273647 3300003322 Bacteria 1182
19 rootH1_10040023 3300003323 Bacteria 1254
20 rootH1_10295821 3300003323 Bacteria 1113
21 Ga0055542_1008441 3300003762 Bacteria 2019
22 Ga0065707_10554733 3300005295 Bacteria 718
23 Ga0070658_10000029 3300005327 Bacteria 156910
24 Ga0070658_10000536 3300005327 Bacteria 32936
25 Ga0070658_10000851 3300005327 Bacteria 26060
26 Ga0070658_10011762 3300005327 Bacteria 7024
27 Ga0070658_10145909 3300005327 Bacteria 1979
28 Ga0070658_10404738 3300005327 Unclassified 1172
29 Ga0070658_10781842 3300005327 Bacteria 829
30 Ga0070676_10000031 3300005328 Bacteria 42113
31 Ga0070677_10000460 3300005333 Bacteria 13951
32 Ga0070666_10166751 3300005335 Bacteria 1541
33 Ga0070680_100006474 3300005336 Bacteria 8906
34 Ga0068868_100000007 3300005338 Bacteria 123028
35 Ga0070660_100000700 3300005339 Bacteria 22233
36 Ga0070660_100000715 3300005339 Bacteria 21980
37 Ga0070660_100005309 3300005339 Bacteria 8914
38 Ga0070660_100006043 3300005339 Bacteria 8371
39 Ga0070660_100015926 3300005339 Bacteria 5444
40 Ga0070660_100376421 3300005339 Bacteria 1172
41 Ga0070661_100000055 3300005344 Bacteria 88266
42 Ga0070661_100528276 3300005344 Bacteria 947
43 Ga0070692_10015367 3300005345 Bacteria 3621
44 Ga0070675_100014811 3300005354 Bacteria 6154
45 Ga0070675_100034822 3300005354 Bacteria 4088
46 Ga0070673_100000022 3300005364 Bacteria 92156
47 Ga0070673_100589708 3300005364 Bacteria 1013
48 Ga0070659_100000004 3300005366 Bacteria 267958
49 Ga0070659_100006080 3300005366 Bacteria 8707
50 Ga0070659_101151587 3300005366 Bacteria 685
51 Ga0070663_100001359 3300005455 Bacteria 13373
52 Ga0070678_100044311 3300005456 Bacteria 3176
53 Ga0070662_100014545 3300005457 Bacteria 5261
54 Ga0070681_10122957 3300005458 Bacteria 2528
55 Ga0068867_100000023 3300005459 Bacteria 92322
56 Ga0070679_100000017 3300005530 Bacteria 129377
57 Ga0070679_100727806 3300005530 Bacteria 935
58 Ga0068853_100146360 3300005539 Bacteria 2123
59 Ga0068853_100936439 3300005539 Bacteria 833
60 Ga0070672_100077795 3300005543 Bacteria 2654
61 Ga0070686_100000218 3300005544 Bacteria 39821
62 Ga0070696_100171724 3300005546 Bacteria 1603
63 Ga0070693_100044595 3300005547 Bacteria 2509
64 Ga0070665_100000054 3300005548 Bacteria 244426
65 Ga0070665_100914005 3300005548 Bacteria 890
66 Ga0070665_101376850 3300005548 Bacteria 715
67 Ga0068855_100000031 3300005563 Bacteria 170268
68 Ga0068855_100073516 3300005563 Bacteria 3972
69 Ga0070664_100450047 3300005564 Bacteria 1182
70 Ga0068857_100129981 3300005577 Bacteria 2271
71 Ga0068854_100043461 3300005578 Bacteria 3185
72 Ga0068854_100056189 3300005578 Bacteria 2836
73 Ga0068854_100126342 3300005578 Bacteria 1948
74 Ga0068856_100024524 3300005614 Bacteria 5872
75 Ga0068856_100139144 3300005614 Bacteria 2434
76 Ga0068852_100000627 3300005616 Bacteria 23092
77 Ga0068852_100859444 3300005616 Bacteria 923
78 Ga0068866_10133491 3300005718 Bacteria 1415
79 Ga0068863_100011069 3300005841 Bacteria 8748
80 Ga0068860_100001425 3300005843 Bacteria 25889
81 Ga0097621_100010552 3300006237 Bacteria 6767
82 Ga0075370_10478931 3300006353 Bacteria 750
83 Ga0068871_100010769 3300006358 Bacteria 6690
84 Ga0068865_100000031 3300006881 Bacteria 88580
85 Ga0105240_10003725 3300009093 Bacteria 23553
86 Ga0105240_10094922 3300009093 Bacteria 3637
87 Ga0105240_10318037 3300009093 Bacteria 1775
88 Ga0105240_11314132 3300009093 Bacteria 762
89 Ga0105245_10013418 3300009098 Bacteria 7137
90 Ga0105245_10346468 3300009098 Bacteria 1471
91 Ga0105247_10003119 3300009101 Bacteria 10945
92 Ga0105243_10000156 3300009148 Bacteria 78467
93 Ga0105243_11275822 3300009148 Bacteria 751
94 Ga0105243_12312116 3300009148 Bacteria 575
95 Ga0105241_10426340 3300009174 Bacteria 1168
96 Ga0105242_10004742 3300009176 Bacteria 10529
97 Ga0105248_10017071 3300009177 Bacteria 7994
98 Ga0105237_10028430 3300009545 Bacteria 5695
99 Ga0105237_10314783 3300009545 Bacteria 1568
100 Ga0105238_10273674 3300009551 Bacteria 1669
101 Ga0105238_12062408 3300009551 Bacteria 604
102 Ga0105249_10031092 3300009553 Bacteria 4827
103 Ga0105239_10001121 3300010375 Bacteria 36892
104 Ga0105239_10076889 3300010375 Bacteria 3672
105 Ga0105239_10752168 3300010375 Bacteria 1116
106 Ga0105239_11073479 3300010375 Bacteria 927
107 Ga0105239_13100509 3300010375 Bacteria 541
108 Ga0105246_10055066 3300011119 Bacteria 2744
109 Ga0105246_11524679 3300011119 Bacteria 629
110 Ga0157373_10110090 3300013100 Bacteria 1936
111 Ga0157373_10582932 3300013100 Bacteria 813
112 Ga0157371_10123433 3300013102 Bacteria 1842
113 Ga0157370_10000017 3300013104 Bacteria 169971
114 Ga0157369_10010900 3300013105 Bacteria 10354
115 Ga0157369_10014895 3300013105 Bacteria 8776
116 Ga0157374_10000656 3300013296 Bacteria 30436
117 Ga0157378_10000504 3300013297 Bacteria 37070
118 Ga0157378_10659032 3300013297 Bacteria 1063
119 Ga0163162_10047022 3300013306 Bacteria 4325
120 Ga0157372_10185041 3300013307 Bacteria 2412
121 Ga0157372_10204927 3300013307 Bacteria 2285
122 Ga0157372_10280767 3300013307 Bacteria 1936
123 Ga0157380_10672288 3300014326 Bacteria 1036
124 Ga0157380_11655808 3300014326 Bacteria 696
125 Ga0157376_10000124 3300014969 Bacteria 53299
126 Ga0163161_10331454 3300017792 Bacteria 1205
127 Ga0213873_10000027 3300021358 Bacteria 73909
128 Ga0213874_10142843 3300021377 Bacteria 830
129 Ga0213876_10000004 3300021384 Bacteria 943822
130 Ga0213876_10000395 3300021384 Bacteria 36646
131 Ga0213876_10002246 3300021384 Bacteria 11402
132 Ga0213876_10027171 3300021384 Bacteria 3020
133 Ga0207427_100774 3300025231 Bacteria 14552
134 Ga0209026_1002932 3300025250 Bacteria 5962
135 Ga0209148_1000059 3300025254 Bacteria 350224
136 Ga0209148_1001344 3300025254 Bacteria 12962
137 Ga0209233_1000003 3300025261 Bacteria 1607366
138 Ga0209455_1001597 3300025272 Bacteria 9959
139 Ga0209455_1032626 3300025272 Bacteria 863
140 Ga0207642_10107273 3300025899 Bacteria 1415
141 Ga0207710_10003845 3300025900 Bacteria 6638
142 Ga0207688_10200726 3300025901 Bacteria 1195
143 Ga0207680_10283324 3300025903 Bacteria 1152
144 Ga0207647_10000710 3300025904 Bacteria 26130
145 Ga0207647_10218224 3300025904 Bacteria 1100
146 Ga0207647_10248178 3300025904 Bacteria 1021
147 Ga0207647_10394452 3300025904 Bacteria 780
148 Ga0207645_10016352 3300025907 Bacteria 4912
149 Ga0207645_10198261 3300025907 Bacteria 1320
150 Ga0207705_10000002 3300025909 Bacteria 2046852
151 Ga0207705_10000178 3300025909 Bacteria 67084
152 Ga0207705_10000243 3300025909 Bacteria 53479
153 Ga0207705_10023638 3300025909 Bacteria 4384
154 Ga0207705_10114196 3300025909 Bacteria 1998
155 Ga0207705_10596530 3300025909 Bacteria 859
156 Ga0207707_10012541 3300025912 Bacteria 7368
157 Ga0207695_10024973 3300025913 Bacteria 6705
158 Ga0207695_10063772 3300025913 Bacteria 3797
159 Ga0207695_10262964 3300025913 Bacteria 1622
160 Ga0207695_11068708 3300025913 Bacteria 687
161 Ga0207671_10001063 3300025914 Bacteria 33331
162 Ga0207660_10030106 3300025917 Bacteria 3729
163 Ga0207657_10000519 3300025919 Bacteria 40709
164 Ga0207657_10001372 3300025919 Bacteria 25957
165 Ga0207657_10019103 3300025919 Bacteria 6519
166 Ga0207657_10019782 3300025919 Bacteria 6382
167 Ga0207657_10030954 3300025919 Bacteria 4851
168 Ga0207657_10401041 3300025919 Bacteria 1079
169 Ga0207657_10581269 3300025919 Bacteria 875
170 Ga0207649_10000018 3300025920 Bacteria 225137
171 Ga0207649_10356520 3300025920 Bacteria 1084
172 Ga0207652_10000001 3300025921 Bacteria 1006643
173 Ga0207659_10008425 3300025926 Bacteria 6399
174 Ga0207687_10114803 3300025927 Bacteria 2005
175 Ga0207687_10213353 3300025927 Bacteria 1516
176 Ga0207687_10217322 3300025927 Bacteria 1503
177 Ga0207687_10291207 3300025927 Bacteria 1312
178 Ga0207687_10403780 3300025927 Bacteria 1124
179 Ga0207690_10000001 3300025932 Bacteria 807539
180 Ga0207690_10000002 3300025932 Bacteria 807473
181 Ga0207690_10000003 3300025932 Bacteria 783011
182 Ga0207690_10000004 3300025932 Bacteria 746138
183 Ga0207690_10004468 3300025932 Bacteria 8258
184 Ga0207706_10024963 3300025933 Bacteria 5358
185 Ga0207686_10001385 3300025934 Bacteria 13769
186 Ga0207709_10000447 3300025935 Bacteria 38701
187 Ga0207704_10000008 3300025938 Bacteria 204682
188 Ga0207691_10070922 3300025940 Bacteria 3146
189 Ga0207691_10784776 3300025940 Bacteria 801
190 Ga0207711_10038379 3300025941 Bacteria 4073
191 Ga0207667_10000029 3300025949 Bacteria 329192
192 Ga0207667_10034843 3300025949 Bacteria 5403
193 Ga0207667_10233946 3300025949 Bacteria 1881
194 Ga0207667_10536301 3300025949 Bacteria 1184
195 Ga0207667_10618220 3300025949 Bacteria 1091
196 Ga0207667_10702175 3300025949 Bacteria 1014
197 Ga0207651_10000008 3300025960 Bacteria 204538
198 Ga0207651_10353460 3300025960 Bacteria 1238
199 Ga0207712_10033435 3300025961 Bacteria 3476
200 Ga0207640_10000357 3300025981 Bacteria 29919
201 Ga0207640_10023046 3300025981 Bacteria 3738
202 Ga0207677_10000014 3300026023 Bacteria 181712
203 Ga0207677_10000091 3300026023 Bacteria 74163
204 Ga0207639_10007455 3300026041 Bacteria 7463
205 Ga0207639_10508655 3300026041 Bacteria 1101
206 Ga0207678_10002781 3300026067 Bacteria 15861
207 Ga0207708_11051023 3300026075 Bacteria 709
208 Ga0207702_10013616 3300026078 Bacteria 6755
209 Ga0207702_10030512 3300026078 Bacteria 4493
210 Ga0207702_10145466 3300026078 Bacteria 2150
211 Ga0207641_10003047 3300026088 Bacteria 15101
212 Ga0207641_10013366 3300026088 Bacteria 6732
213 Ga0207641_10745482 3300026088 Bacteria 967
214 Ga0207648_10000009 3300026089 Bacteria 204229
215 Ga0207674_10155072 3300026116 Bacteria 2245
216 Ga0207683_10019752 3300026121 Bacteria 5755
217 Ga0207698_10001899 3300026142 Bacteria 12241
218 Ga0207698_10227208 3300026142 Bacteria 1691
219 Ga0207698_10526381 3300026142 Bacteria 1155
220 Ga0268266_10000414 3300028379 Bacteria 65028
221 Ga0268266_10082572 3300028379 Bacteria 2804
222 Ga0268266_10486337 3300028379 Bacteria 1177
223 Ga0268266_11308947 3300028379 Bacteria 700
224 Ga0268264_10000974 3300028381 Bacteria 29321
225 Ga0268264_10014027 3300028381 Bacteria 6588
226 Ga0307513_10048836 3300031456 Bacteria 4589
227 Ga0307408_100275844 3300031548 Bacteria 1398
228 Ga0307416_101958002 3300032002 Bacteria 689
229 Ga0307414_11783467 3300032004 Unclassified 574
230 Ga0307510_10139957 3300033180 Bacteria 2066
231 Ga0395899_0000406 3300037312 Bacteria 50248
232 Ga0395900_0193125 3300037418 Bacteria 2064
233 Ga0395900_0287725 3300037418 Bacteria 1633
234 Ga0395900_0502243 3300037418 Bacteria 1163
235 Ga0395898_0583135 3300037466 Bacteria 1061
236 Ga0395898_1856408 3300037466 Bacteria 523
237 Ga0395905_0020721 3300037471 Bacteria 6225
238 Ga0395905_0125058 3300037471 Bacteria 2418
239 Ga0395905_0144034 3300037471 Bacteria 2242
240 Ga0395905_0221539 3300037471 Bacteria 1770
241 Ga0395905_0557232 3300037471 Bacteria 1047
242 Ga0395901_0044040 3300038443 Bacteria 4629
243 Ga0395901_0466651 3300038443 Bacteria 1289
244 Ga0395901_0740739 3300038443 Bacteria 977
245 Ga0436365_0102423 3300039437 Bacteria 73123
246 Ga0436365_0487522 3300039437 Bacteria 55925
247 Ga0436365_1487768 3300039437 Bacteria 7074
248 Ga0436365_1792312 3300039437 Bacteria 3586
249 Ga0436363_1063151 3300039450 Bacteria 780
250 Ga0436362_0740394 3300039453 Bacteria 73123
251 Ga0451793_0460554 3300041452 Bacteria 778
252 Ga0451577_0538260 3300042876 Bacteria 1061
253 Ga0451577_1258480 3300042876 Unclassified 659
254 Ga0466972_0008358 3300044658 Bacteria 5188
255 Ga0466965_0105853 3300044683 Bacteria 1442
256 Ga0466966_0058153 3300044684 Bacteria 2444
257 Ga0466961_0009726 3300044693 Bacteria 6120
258 Ga0466963_0028893 3300044694 Bacteria 3564
259 Ga0466964_0044688 3300044706 Bacteria 1800
260 Ga0466964_0057123 3300044706 Bacteria 1615
261 Ga0466971_0020171 3300044719 Bacteria 2963
262 Ga0466971_0531365 3300044719 Unclassified 582
263 Ga0466968_0006722 3300044735 Bacteria 4346
264 Ga0466968_0079968 3300044735 Bacteria 1434
265 Ga0466968_0249347 3300044735 Bacteria 843
266 Ga0466968_0279620 3300044735 Unclassified 798
267 Ga0466957_0064047 3300044842 Bacteria 2261
268 Ga0466957_0071019 3300044842 Bacteria 2152
269 Ga0466960_0001025 3300044901 Bacteria 9987
270 Ga0466959_0038923 3300045049 Bacteria 3513
271 Ga0451576_0643722 3300045051 Bacteria 1114
272 Ga0466958_0011710 3300045836 Bacteria 4948
273 Ga0466958_0163972 3300045836 Bacteria 1405
274 Ga0466967_0066889 3300045976 Bacteria 3203
275 Ga0495638_0029330 3300046460 Bacteria 3547
276 Ga0495583_0000286 3300046506 Bacteria 80417
277 Ga0495606_0001833 3300046507 Bacteria 26898
278 Ga0495642_0067472 3300046528 Bacteria 1492
279 Ga0495654_0021389 3300046530 Bacteria 3365
280 Ga0495661_0017039 3300046665 Bacteria 4800
281 Ga0495670_0198804 3300046691 Bacteria 1061
282 Ga0495673_0009463 3300047469 Bacteria 5394
283 Ga0495673_0176781 3300047469 Bacteria 810
284 Ga0495686_0000147 3300047472 Bacteria 139008
285 Ga0495686_0229089 3300047472 Bacteria 1053
286 Ga0496102_0256501 3300048905 Bacteria 1649
287 Ga0496102_1109822 3300048905 Bacteria 711
288 Ga0496109_1067034 3300048912 Bacteria 745
289 Ga0496115_0216090 3300048918 Bacteria 1583
290 Ga0496115_0556642 3300048918 Bacteria 916
291 Ga0496117_0041777 3300048920 Bacteria 3354
292 Ga0496117_0057975 3300048920 Bacteria 2685
293 Ga0496117_0068570 3300048920 Bacteria 2393
294 Ga0496118_0086805 3300048921 Bacteria 2173
295 Ga0496118_0089979 3300048921 Bacteria 2117
296 Ga0496118_0134093 3300048921 Bacteria 1583
297 Ga0496118_0170172 3300048921 Bacteria 1332
298 Ga0496119_0153595 3300048922 Bacteria 1231
299 Ga0496119_0166534 3300048922 Bacteria 1167
300 Ga0496120_0038278 3300048923 Bacteria 2839
301 Ga0496121_0008708 3300048924 Bacteria 11847
302 Ga0496121_0017421 3300048924 Bacteria 7342
303 Ga0496121_0019788 3300048924 Bacteria 6708
304 Ga0496121_0033641 3300048924 Bacteria 4634
305 Ga0496122_0009442 3300048925 Bacteria 10277
306 Ga0496123_0016119 3300048926 Bacteria 6088
307 Ga0496123_0030231 3300048926 Bacteria 3968
308 Ga0496124_0164781 3300048927 Bacteria 1724
309 Ga0496125_0029710 3300048928 Bacteria 4906
310 Ga0496126_0012159 3300048929 Bacteria 8836
311 Ga0496126_0639519 3300048929 Unclassified 834
312 Ga0501033_0098051 3300049570 Bacteria 2141
313 Ga0501034_0170545 3300049571 Bacteria 2143
314 Ga0501034_1099370 3300049571 Bacteria 676
315 Ga0501036_0529422 3300049572 Bacteria 980
316 Ga0501047_1098399 3300049581 Bacteria 609
317 Ga0501069_0003685 3300049585 Bacteria 7884
318 Ga0501070_0096165 3300049586 Bacteria 2450
319 Ga0501035_0199127 3300049822 Bacteria 1719
320 Ga0501044_0144009 3300049823 Bacteria 2370
321 nmdc:mga0sz30_27297_c1 3300050516 Bacteria 2344
322 Ga0500643_000590 3300053087 Bacteria 25096
323 Ga0500643_056755 3300053087 Bacteria 1106
324 Ga0500555_000197 3300053103 Bacteria 27950
325 Ga0500556_0148207 3300053104 Unclassified 924
326 Ga0500592_001082 3300053116 Bacteria 4437
327 Ga0500559_0398632 3300053136 Bacteria 640
328 Ga0500616_0007276 3300053153 Bacteria 7064
329 Ga0500616_0029597 3300053153 Bacteria 3012
330 Ga0500627_0006961 3300053158 Bacteria 3897
331 Ga0466962_0004869 3300061719 Bacteria 6457
332 Ga0466962_0062570 3300061719 Bacteria 1777
333 Ga0466962_0103801 3300061719 Bacteria 1366

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1258480 Ga0451577_1258480_125_565 134
2 3300045051 Ga0451576_0643722 Ga0451576_0643722_253_705 134
3 3300001989 JGI24739J22299_10011761 JGI24739J22299_100117614 136
4 3300001989 JGI24739J22299_10019562 JGI24739J22299_100195625 136
5 3300001989 JGI24739J22299_10027687 JGI24739J22299_100276872 136
6 3300001990 JGI24737J22298_10002759 JGI24737J22298_100027593 136
7 3300001990 JGI24737J22298_10016968 JGI24737J22298_100169682 136
8 3300001990 JGI24737J22298_10146657 JGI24737J22298_101466571 136
9 3300002067 JGI24735J21928_10012987 JGI24735J21928_100129873 136
10 3300002067 JGI24735J21928_10016142 JGI24735J21928_100161422 136
11 3300002067 JGI24735J21928_10019954 JGI24735J21928_100199544 136
12 3300002075 JGI24738J21930_10000648 JGI24738J21930_1000064810 136
13 3300002077 JGI24744J21845_10001869 JGI24744J21845_100018694 136
14 3300002772 JGI25164J39214_1010745 JGI25164J39214_10107452 136
15 3300003214 JGI25165J46597_1000023 JGI25165J46597_100002374 136
16 3300003316 rootH1_10107509 rootH1_101075092 136
17 3300003320 rootH2_10068880 rootH2_100688802 136
18 3300003320 rootH2_10194905 rootH2_101949052 136
19 3300003322 rootL2_10273647 rootL2_102736472 136
20 3300003323 rootH1_10040023 rootH1_100400232 136
21 3300003323 rootH1_10295821 rootH1_102958211 136
22 3300003762 Ga0055542_1008441 Ga0055542_10084412 136
23 3300005327 Ga0070658_10000536 Ga0070658_1000053612 136
24 3300005327 Ga0070658_10000851 Ga0070658_1000085119 136
25 3300005327 Ga0070658_10011762 Ga0070658_100117627 136
26 3300005327 Ga0070658_10145909 Ga0070658_101459092 136
27 3300005327 Ga0070658_10404738 Ga0070658_104047381 136
28 3300005328 Ga0070676_10000031 Ga0070676_1000003141 136
29 3300005335 Ga0070666_10166751 Ga0070666_101667513 136
30 3300005339 Ga0070660_100000700 Ga0070660_10000070018 136
31 3300005339 Ga0070660_100015926 Ga0070660_1000159266 136
32 3300005339 Ga0070660_100376421 Ga0070660_1003764213 136
33 3300005344 Ga0070661_100528276 Ga0070661_1005282762 136
34 3300005354 Ga0070675_100034822 Ga0070675_1000348223 136
35 3300005364 Ga0070673_100000022 Ga0070673_10000002268 136
36 3300005366 Ga0070659_101151587 Ga0070659_1011515872 136
37 3300005455 Ga0070663_100001359 Ga0070663_1000013599 136
38 3300005456 Ga0070678_100044311 Ga0070678_1000443114 136
39 3300005457 Ga0070662_100014545 Ga0070662_1000145454 136
40 3300005459 Ga0068867_100000023 Ga0068867_10000002330 136
41 3300005539 Ga0068853_100146360 Ga0068853_1001463601 136
42 3300005539 Ga0068853_100936439 Ga0068853_1009364391 136
43 3300005543 Ga0070672_100077795 Ga0070672_1000777953 136
44 3300005547 Ga0070693_100044595 Ga0070693_1000445953 136
45 3300005548 Ga0070665_101376850 Ga0070665_1013768502 136
46 3300005563 Ga0068855_100000031 Ga0068855_100000031171 136
47 3300005563 Ga0068855_100073516 Ga0068855_1000735165 136
48 3300005564 Ga0070664_100450047 Ga0070664_1004500471 136
49 3300005577 Ga0068857_100129981 Ga0068857_1001299814 136
50 3300005578 Ga0068854_100043461 Ga0068854_1000434612 136
51 3300005578 Ga0068854_100056189 Ga0068854_1000561894 136
52 3300005614 Ga0068856_100024524 Ga0068856_10002452410 136
53 3300005614 Ga0068856_100139144 Ga0068856_1001391445 136
54 3300005616 Ga0068852_100000627 Ga0068852_10000062727 136
55 3300005616 Ga0068852_100859444 Ga0068852_1008594442 136
56 3300005718 Ga0068866_10133491 Ga0068866_101334912 136
57 3300006237 Ga0097621_100010552 Ga0097621_10001055211 136
58 3300006358 Ga0068871_100010769 Ga0068871_1000107694 136
59 3300006881 Ga0068865_100000031 Ga0068865_10000003168 136
60 3300009093 Ga0105240_10094922 Ga0105240_100949222 136
61 3300009098 Ga0105245_10013418 Ga0105245_100134183 136
62 3300009148 Ga0105243_10000156 Ga0105243_1000015633 136
63 3300009174 Ga0105241_10426340 Ga0105241_104263402 136
64 3300009176 Ga0105242_10004742 Ga0105242_1000474214 136
65 3300009551 Ga0105238_10273674 Ga0105238_102736743 136
66 3300009553 Ga0105249_10031092 Ga0105249_100310924 136
67 3300010375 Ga0105239_10076889 Ga0105239_100768893 136
68 3300010375 Ga0105239_11073479 Ga0105239_110734792 136
69 3300011119 Ga0105246_10055066 Ga0105246_100550665 136
70 3300013100 Ga0157373_10110090 Ga0157373_101100903 136
71 3300013100 Ga0157373_10582932 Ga0157373_105829321 136
72 3300013102 Ga0157371_10123433 Ga0157371_101234333 136
73 3300013104 Ga0157370_10000017 Ga0157370_1000001720 136
74 3300013105 Ga0157369_10014895 Ga0157369_100148953 136
75 3300013296 Ga0157374_10000656 Ga0157374_1000065614 136
76 3300013297 Ga0157378_10000504 Ga0157378_100005042 136
77 3300013306 Ga0163162_10047022 Ga0163162_100470226 136
78 3300013307 Ga0157372_10185041 Ga0157372_101850412 136
79 3300013307 Ga0157372_10204927 Ga0157372_102049273 136
80 3300013307 Ga0157372_10280767 Ga0157372_102807673 136
81 3300014969 Ga0157376_10000124 Ga0157376_100001246 136
82 3300017792 Ga0163161_10331454 Ga0163161_103314542 136
83 3300025231 Ga0207427_100774 Ga0207427_1007743 136
84 3300025250 Ga0209026_1002932 Ga0209026_10029324 136
85 3300025254 Ga0209148_1000059 Ga0209148_1000059321 136
86 3300025254 Ga0209148_1001344 Ga0209148_10013446 136
87 3300025261 Ga0209233_1000003 Ga0209233_1000003913 136
88 3300025272 Ga0209455_1001597 Ga0209455_10015976 136
89 3300025272 Ga0209455_1032626 Ga0209455_10326262 136
90 3300025899 Ga0207642_10107273 Ga0207642_101072733 136
91 3300025901 Ga0207688_10200726 Ga0207688_102007262 136
92 3300025903 Ga0207680_10283324 Ga0207680_102833242 136
93 3300025904 Ga0207647_10000710 Ga0207647_1000071029 136
94 3300025904 Ga0207647_10218224 Ga0207647_102182243 136
95 3300025904 Ga0207647_10248178 Ga0207647_102481782 136
96 3300025904 Ga0207647_10394452 Ga0207647_103944522 136
97 3300025907 Ga0207645_10016352 Ga0207645_100163523 136
98 3300025909 Ga0207705_10000178 Ga0207705_1000017818 136
99 3300025909 Ga0207705_10000243 Ga0207705_1000024357 136
100 3300025909 Ga0207705_10023638 Ga0207705_100236384 136
101 3300025909 Ga0207705_10114196 Ga0207705_101141963 136
102 3300025913 Ga0207695_10024973 Ga0207695_1002497311 136
103 3300025913 Ga0207695_11068708 Ga0207695_110687081 136
104 3300025919 Ga0207657_10030954 Ga0207657_100309546 136
105 3300025919 Ga0207657_10401041 Ga0207657_104010412 136
106 3300025919 Ga0207657_10581269 Ga0207657_105812692 136
107 3300025920 Ga0207649_10356520 Ga0207649_103565202 136
108 3300025927 Ga0207687_10213353 Ga0207687_102133533 136
109 3300025933 Ga0207706_10024963 Ga0207706_100249636 136
110 3300025934 Ga0207686_10001385 Ga0207686_100013857 136
111 3300025935 Ga0207709_10000447 Ga0207709_1000044730 136
112 3300025938 Ga0207704_10000008 Ga0207704_10000008156 136
113 3300025940 Ga0207691_10070922 Ga0207691_100709223 136
114 3300025949 Ga0207667_10000029 Ga0207667_10000029306 136
115 3300025949 Ga0207667_10034843 Ga0207667_100348434 136
116 3300025949 Ga0207667_10618220 Ga0207667_106182202 136
117 3300025960 Ga0207651_10000008 Ga0207651_1000000868 136
118 3300025961 Ga0207712_10033435 Ga0207712_100334354 136
119 3300025981 Ga0207640_10000357 Ga0207640_1000035722 136
120 3300025981 Ga0207640_10023046 Ga0207640_100230462 136
121 3300026023 Ga0207677_10000091 Ga0207677_1000009149 136
122 3300026041 Ga0207639_10007455 Ga0207639_100074552 136
123 3300026067 Ga0207678_10002781 Ga0207678_1000278115 136
124 3300026078 Ga0207702_10013616 Ga0207702_100136169 136
125 3300026078 Ga0207702_10030512 Ga0207702_100305123 136
126 3300026078 Ga0207702_10145466 Ga0207702_101454662 136
127 3300026089 Ga0207648_10000009 Ga0207648_1000000968 136
128 3300026116 Ga0207674_10155072 Ga0207674_101550724 136
129 3300026121 Ga0207683_10019752 Ga0207683_100197524 136
130 3300026142 Ga0207698_10001899 Ga0207698_100018996 136
131 3300026142 Ga0207698_10526381 Ga0207698_105263812 136
132 3300028379 Ga0268266_10486337 Ga0268266_104863372 136
133 3300028379 Ga0268266_11308947 Ga0268266_113089472 136
134 3300037312 Ga0395899_0000406 Ga0395899_0000406_15576_16004 136
135 3300037418 Ga0395900_0193125 Ga0395900_0193125_183_611 136
136 3300037418 Ga0395900_0287725 Ga0395900_0287725_457_885 136
137 3300037418 Ga0395900_0502243 Ga0395900_0502243_570_998 136
138 3300037466 Ga0395898_0583135 Ga0395898_0583135_455_883 136
139 3300037466 Ga0395898_1856408 Ga0395898_1856408_66_506 136
140 3300037471 Ga0395905_0020721 Ga0395905_0020721_2968_3396 136
141 3300037471 Ga0395905_0125058 Ga0395905_0125058_786_1217 136
142 3300037471 Ga0395905_0221539 Ga0395905_0221539_660_1091 136
143 3300037471 Ga0395905_0557232 Ga0395905_0557232_293_721 136
144 3300038443 Ga0395901_0044040 Ga0395901_0044040_2160_2588 136
145 3300038443 Ga0395901_0740739 Ga0395901_0740739_314_742 136
146 3300041452 Ga0451793_0460554 Ga0451793_0460554_124_552 136
147 3300044658 Ga0466972_0008358 Ga0466972_0008358_444_875 136
148 3300044683 Ga0466965_0105853 Ga0466965_0105853_956_1387 136
149 3300044684 Ga0466966_0058153 Ga0466966_0058153_1026_1457 136
150 3300044693 Ga0466961_0009726 Ga0466961_0009726_2802_3233 136
151 3300044694 Ga0466963_0028893 Ga0466963_0028893_2032_2475 136
152 3300044706 Ga0466964_0044688 Ga0466964_0044688_1270_1701 136
153 3300044706 Ga0466964_0057123 Ga0466964_0057123_578_1021 136
154 3300044719 Ga0466971_0020171 Ga0466971_0020171_1854_2297 136
155 3300044719 Ga0466971_0531365 Ga0466971_0531365_88_519 136
156 3300044735 Ga0466968_0006722 Ga0466968_0006722_3337_3768 136
157 3300044735 Ga0466968_0279620 Ga0466968_0279620_132_563 136
158 3300044842 Ga0466957_0064047 Ga0466957_0064047_1224_1652 136
159 3300044842 Ga0466957_0071019 Ga0466957_0071019_1256_1684 136
160 3300044901 Ga0466960_0001025 Ga0466960_0001025_5687_6118 136
161 3300045049 Ga0466959_0038923 Ga0466959_0038923_589_1020 136
162 3300045836 Ga0466958_0011710 Ga0466958_0011710_695_1138 136
163 3300045836 Ga0466958_0163972 Ga0466958_0163972_656_1087 136
164 3300045976 Ga0466967_0066889 Ga0466967_0066889_2035_2478 136
165 3300048905 Ga0496102_0256501 Ga0496102_0256501_23_451 136
166 3300048905 Ga0496102_1109822 Ga0496102_1109822_151_579 136
167 3300048912 Ga0496109_1067034 Ga0496109_1067034_193_624 136
168 3300048918 Ga0496115_0556642 Ga0496115_0556642_230_658 136
169 3300048920 Ga0496117_0041777 Ga0496117_0041777_28_456 136
170 3300048921 Ga0496118_0086805 Ga0496118_0086805_875_1303 136
171 3300048921 Ga0496118_0089979 Ga0496118_0089979_1179_1607 136
172 3300048922 Ga0496119_0166534 Ga0496119_0166534_76_504 136
173 3300048923 Ga0496120_0038278 Ga0496120_0038278_1054_1482 136
174 3300048924 Ga0496121_0017421 Ga0496121_0017421_4449_4877 136
175 3300048924 Ga0496121_0033641 Ga0496121_0033641_651_1079 136
176 3300048925 Ga0496122_0009442 Ga0496122_0009442_6849_7277 136
177 3300048926 Ga0496123_0016119 Ga0496123_0016119_4144_4572 136
178 3300048927 Ga0496124_0164781 Ga0496124_0164781_942_1370 136
179 3300048928 Ga0496125_0029710 Ga0496125_0029710_1508_1936 136
180 3300048929 Ga0496126_0639519 Ga0496126_0639519_190_618 136
181 3300049822 Ga0501035_0199127 Ga0501035_0199127_676_1137 136
182 3300053136 Ga0500559_0398632 Ga0500559_0398632_194_622 136
183 3300061719 Ga0466962_0004869 Ga0466962_0004869_3232_3675 136
184 3300061719 Ga0466962_0062570 Ga0466962_0062570_906_1337 136
185 3300061719 Ga0466962_0103801 Ga0466962_0103801_708_1136 136
186 3300009093 Ga0105240_11314132 Ga0105240_113141322 137
187 3300009545 Ga0105237_10314783 Ga0105237_103147832 137
188 3300010375 Ga0105239_10752168 Ga0105239_107521682 137
189 3300025919 Ga0207657_10001372 Ga0207657_1000137210 137
190 3300026041 Ga0207639_10508655 Ga0207639_105086552 137
191 3300014326 Ga0157380_11655808 Ga0157380_116558081 139
192 3300025940 Ga0207691_10784776 Ga0207691_107847762 139
193 3300028381 Ga0268264_10014027 Ga0268264_1001402712 139
194 3300053087 Ga0500643_000590 Ga0500643_000590_20162_20596 139
195 3300033180 Ga0307510_10139957 Ga0307510_101399572 141
196 3300037471 Ga0395905_0144034 Ga0395905_0144034_1068_1499 141
197 3300038443 Ga0395901_0466651 Ga0395901_0466651_80_511 141
198 3300044735 Ga0466968_0079968 Ga0466968_0079968_663_1103 141
199 3300005333 Ga0070677_10000460 Ga0070677_100004602 142
200 3300031548 Ga0307408_100275844 Ga0307408_1002758441 142
201 3300032002 Ga0307416_101958002 Ga0307416_1019580022 142
202 3300049571 Ga0501034_1099370 Ga0501034_1099370_78_506 142
203 3300009093 Ga0105240_10318037 Ga0105240_103180372 143
204 3300010375 Ga0105239_13100509 Ga0105239_131005091 143
205 3300025913 Ga0207695_10262964 Ga0207695_102629642 143
206 3300025949 Ga0207667_10233946 Ga0207667_102339465 143
207 3300025949 Ga0207667_10536301 Ga0207667_105363013 143
208 3300026142 Ga0207698_10227208 Ga0207698_102272081 143
209 3300044735 Ga0466968_0249347 Ga0466968_0249347_13_453 143
210 3300046460 Ga0495638_0029330 Ga0495638_0029330_1654_2097 143
211 3300046506 Ga0495583_0000286 Ga0495583_0000286_60431_60874 143
212 3300046507 Ga0495606_0001833 Ga0495606_0001833_23134_23577 143
213 3300046530 Ga0495654_0021389 Ga0495654_0021389_74_514 143
214 3300046665 Ga0495661_0017039 Ga0495661_0017039_1177_1620 143
215 3300046691 Ga0495670_0198804 Ga0495670_0198804_211_654 143
216 3300047469 Ga0495673_0009463 Ga0495673_0009463_4803_5258 143
217 3300047469 Ga0495673_0176781 Ga0495673_0176781_108_557 143
218 3300047472 Ga0495686_0000147 Ga0495686_0000147_100568_101017 143
219 3300047472 Ga0495686_0229089 Ga0495686_0229089_245_688 143
220 3300048920 Ga0496117_0057975 Ga0496117_0057975_1206_1649 143
221 3300048926 Ga0496123_0030231 Ga0496123_0030231_680_1135 143
222 3300049570 Ga0501033_0098051 Ga0501033_0098051_55_504 143
223 3300049571 Ga0501034_0170545 Ga0501034_0170545_658_1101 143
224 3300049572 Ga0501036_0529422 Ga0501036_0529422_312_755 143
225 3300049581 Ga0501047_1098399 Ga0501047_1098399_74_523 143
226 3300049585 Ga0501069_0003685 Ga0501069_0003685_6051_6494 143
227 3300049586 Ga0501070_0096165 Ga0501070_0096165_252_695 143
228 3300049823 Ga0501044_0144009 Ga0501044_0144009_1283_1732 143
229 3300053103 Ga0500555_000197 Ga0500555_000197_4731_5174 143
230 3300053104 Ga0500556_0148207 Ga0500556_0148207_206_652 143
231 3300053116 Ga0500592_001082 Ga0500592_001082_3152_3592 143
232 3300053153 Ga0500616_0007276 Ga0500616_0007276_2142_2588 143
233 3300053153 Ga0500616_0029597 Ga0500616_0029597_1260_1703 143
234 3300053158 Ga0500627_0006961 Ga0500627_0006961_36_476 143
235 iso_pu_bacteria 2739367664 2739649189 143
236 iso_pu_bacteria 2739367865 2740027662 143
237 3300005327 Ga0070658_10000029 Ga0070658_10000029142 144
238 3300005327 Ga0070658_10781842 Ga0070658_107818422 144
239 3300005336 Ga0070680_100006474 Ga0070680_1000064744 144
240 3300005338 Ga0068868_100000007 Ga0068868_10000000727 144
241 3300005339 Ga0070660_100000715 Ga0070660_10000071521 144
242 3300005339 Ga0070660_100005309 Ga0070660_1000053098 144
243 3300005339 Ga0070660_100006043 Ga0070660_1000060436 144
244 3300005344 Ga0070661_100000055 Ga0070661_10000005563 144
245 3300005345 Ga0070692_10015367 Ga0070692_1001536710 144
246 3300005354 Ga0070675_100014811 Ga0070675_10001481111 144
247 3300005364 Ga0070673_100589708 Ga0070673_1005897082 144
248 3300005366 Ga0070659_100000004 Ga0070659_100000004214 144
249 3300005366 Ga0070659_100006080 Ga0070659_10000608012 144
250 3300005458 Ga0070681_10122957 Ga0070681_101229576 144
251 3300005530 Ga0070679_100000017 Ga0070679_1000000179 144
252 3300005530 Ga0070679_100727806 Ga0070679_1007278062 144
253 3300005544 Ga0070686_100000218 Ga0070686_10000021834 144
254 3300005546 Ga0070696_100171724 Ga0070696_1001717242 144
255 3300005548 Ga0070665_100000054 Ga0070665_100000054209 144
256 3300005548 Ga0070665_100914005 Ga0070665_1009140052 144
257 3300005578 Ga0068854_100126342 Ga0068854_1001263424 144
258 3300005841 Ga0068863_100011069 Ga0068863_1000110694 144
259 3300009093 Ga0105240_10003725 Ga0105240_1000372515 144
260 3300009098 Ga0105245_10346468 Ga0105245_103464682 144
261 3300009148 Ga0105243_11275822 Ga0105243_112758222 144
262 3300009545 Ga0105237_10028430 Ga0105237_100284304 144
263 3300009551 Ga0105238_12062408 Ga0105238_120624082 144
264 3300010375 Ga0105239_10001121 Ga0105239_1000112125 144
265 3300011119 Ga0105246_11524679 Ga0105246_115246792 144
266 3300013105 Ga0157369_10010900 Ga0157369_100109002 144
267 3300013297 Ga0157378_10659032 Ga0157378_106590323 144
268 3300021358 Ga0213873_10000027 Ga0213873_1000002726 144
269 3300021377 Ga0213874_10142843 Ga0213874_101428431 144
270 3300021384 Ga0213876_10000004 Ga0213876_10000004341 144
271 3300021384 Ga0213876_10000395 Ga0213876_1000039525 144
272 3300021384 Ga0213876_10002246 Ga0213876_100022469 144
273 3300021384 Ga0213876_10027171 Ga0213876_100271718 144
274 3300025907 Ga0207645_10198261 Ga0207645_101982612 144
275 3300025909 Ga0207705_10000002 Ga0207705_10000002876 144
276 3300025909 Ga0207705_10596530 Ga0207705_105965302 144
277 3300025912 Ga0207707_10012541 Ga0207707_100125418 144
278 3300025913 Ga0207695_10063772 Ga0207695_100637722 144
279 3300025914 Ga0207671_10001063 Ga0207671_1000106327 144
280 3300025917 Ga0207660_10030106 Ga0207660_100301065 144
281 3300025919 Ga0207657_10000519 Ga0207657_1000051932 144
282 3300025919 Ga0207657_10019103 Ga0207657_100191038 144
283 3300025919 Ga0207657_10019782 Ga0207657_100197826 144
284 3300025920 Ga0207649_10000018 Ga0207649_100000189 144
285 3300025921 Ga0207652_10000001 Ga0207652_10000001860 144
286 3300025926 Ga0207659_10008425 Ga0207659_100084253 144
287 3300025927 Ga0207687_10114803 Ga0207687_101148033 144
288 3300025927 Ga0207687_10217322 Ga0207687_102173222 144
289 3300025927 Ga0207687_10291207 Ga0207687_102912072 144
290 3300025927 Ga0207687_10403780 Ga0207687_104037802 144
291 3300025932 Ga0207690_10000001 Ga0207690_10000001371 144
292 3300025932 Ga0207690_10000002 Ga0207690_10000002371 144
293 3300025932 Ga0207690_10000003 Ga0207690_10000003371 144
294 3300025932 Ga0207690_10000004 Ga0207690_10000004371 144
295 3300025932 Ga0207690_10004468 Ga0207690_100044686 144
296 3300025949 Ga0207667_10702175 Ga0207667_107021751 144
297 3300025960 Ga0207651_10353460 Ga0207651_103534602 144
298 3300026023 Ga0207677_10000014 Ga0207677_10000014205 144
299 3300026075 Ga0207708_11051023 Ga0207708_110510232 144
300 3300026088 Ga0207641_10013366 Ga0207641_100133663 144
301 3300028379 Ga0268266_10000414 Ga0268266_1000041433 144
302 3300028379 Ga0268266_10082572 Ga0268266_100825722 144
303 3300032004 Ga0307414_11783467 Ga0307414_117834671 144
304 3300039437 Ga0436365_0102423 Ga0436365_0102423_22698_23135 144
305 3300039437 Ga0436365_0487522 Ga0436365_0487522_12454_12891 144
306 3300039437 Ga0436365_1487768 Ga0436365_1487768_1218_1661 144
307 3300039437 Ga0436365_1792312 Ga0436365_1792312_1999_2442 144
308 3300039453 Ga0436362_0740394 Ga0436362_0740394_22698_23135 144
309 3300046528 Ga0495642_0067472 Ga0495642_0067472_822_1265 144
310 3300048918 Ga0496115_0216090 Ga0496115_0216090_653_1105 144
311 3300048921 Ga0496118_0170172 Ga0496118_0170172_352_804 144
312 3300048922 Ga0496119_0153595 Ga0496119_0153595_340_792 144
313 3300048924 Ga0496121_0008708 Ga0496121_0008708_3160_3612 144
314 3300048924 Ga0496121_0019788 Ga0496121_0019788_3397_3849 144
315 3300048929 Ga0496126_0012159 Ga0496126_0012159_5539_5991 144
316 3300053087 Ga0500643_056755 Ga0500643_056755_403_843 144
317 3300009177 Ga0105248_10017071 Ga0105248_100170712 145
318 3300025941 Ga0207711_10038379 Ga0207711_100383792 145
319 3300000549 LJQas_1006858 LJQas_10068582 146
320 3300005295 Ga0065707_10554733 Ga0065707_105547331 146
321 3300005843 Ga0068860_100001425 Ga0068860_1000014255 146
322 3300006353 Ga0075370_10478931 Ga0075370_104789312 146
323 3300009101 Ga0105247_10003119 Ga0105247_100031193 146
324 3300009148 Ga0105243_12312116 Ga0105243_123121161 146
325 3300014326 Ga0157380_10672288 Ga0157380_106722881 146
326 3300025900 Ga0207710_10003845 Ga0207710_100038453 146
327 3300026088 Ga0207641_10003047 Ga0207641_1000304713 146
328 3300026088 Ga0207641_10745482 Ga0207641_107454822 146
329 3300028381 Ga0268264_10000974 Ga0268264_1000097415 146
330 3300031456 Ga0307513_10048836 Ga0307513_100488363 146
331 3300039450 Ga0436363_1063151 Ga0436363_1063151_235_687 146
332 3300042876 Ga0451577_0538260 Ga0451577_0538260_37_528 146
333 3300048920 Ga0496117_0068570 Ga0496117_0068570_1177_1713 146
334 3300048921 Ga0496118_0134093 Ga0496118_0134093_391_927 146
335 3300050516 nmdc:mga0sz30_27297_c1 nmdc:mga0sz30_27297_c1_1271_1753 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

58

136

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.909 26 145
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9062 23 146
1ixl-assembly1.cif.gz_A crystal structure of uncharacterized protein ph1136 from pyrococcus horikoshii 0.9061 32 146
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9049 26 145
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9046 31 145
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9049 26 145 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9012 20 145 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8905 19 144 3.10.129.10
af_A0A1D6F200_19_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8897 30 146 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8886 23 146 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A0Q8XKJ1-F1-model_v4 Phenylacetic acid degradation protein 0.9909 24 145 GO:0005829
GO:0061522
AF-A0A7Y0BLM3-F1-model_v4 PaaI family thioesterase 0.9889 10 146 GO:0016289
AF-A0A4U1L686-F1-model_v4 PaaI family thioesterase 0.9887 29 146 GO:0005829
GO:0061522
AF-A0A259HG76-F1-model_v4 Phenylacetic acid degradation protein 0.9886 22 129 GO:0016289
AF-A0A245ZJ21-F1-model_v4 Thioesterase domain-containing protein 0.9878 23 146 GO:0016289

Feature Viewer

pLDDT pTM Quality
91.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map