F412203

General Info

Members Datasets Scaffolds Average Seq Length
335 231 328 216

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100182034|Ga0075429_1001820342
Length 216
Sequence VTITITAFELSPDGGQGLARDTRVRWALEEVGQPYEVRLVSFRAMKEPAHLALHPFGQIPTYEEGDLALFETGAIVLHIAGRHTAGLLPKDPNARARAITWMFAAVNTLEPPILELANAKLLEGDRPWNRDRLPLVEDRVRNRMGQLARRLGDADWLEGAFSAGDLMMASVLLRLRSSGMLDEYPKLAAYVARGEARPAYKRAFAAQLAVNKRGSP

Samples

Sample ID Description Type Environment
1 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
2 2738543024 Aminobacter sp. AP02 Isolate Unclassified
3 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
4 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
5 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
6 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
7 2906610324
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0.3
Rhizoplane 0.9
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10264288 3300003322 Bacteria 2884
2 Ga0065707_10087099 3300005295 Bacteria 5165
3 Ga0070658_10001781 3300005327 Bacteria 18132
4 Ga0070658_10049503 3300005327 Bacteria 3404
5 Ga0070690_100004936 3300005330 Bacteria 7464
6 Ga0068869_100087570 3300005334 Bacteria 2336
7 Ga0068869_100338127 3300005334 Bacteria 1225
8 Ga0070680_100008738 3300005336 Bacteria 7767
9 Ga0070682_100037781 3300005337 Bacteria 2958
10 Ga0068868_100002469 3300005338 Bacteria 12824
11 Ga0068868_100007039 3300005338 Bacteria 7995
12 Ga0070689_100011173 3300005340 Bacteria 6424
13 Ga0070691_10014365 3300005341 Bacteria 3631
14 Ga0070687_100002786 3300005343 Bacteria 6648
15 Ga0070661_100026454 3300005344 Bacteria 4173
16 Ga0070692_10008219 3300005345 Bacteria 4645
17 Ga0070692_10044898 3300005345 Bacteria 2278
18 Ga0070692_10210959 3300005345 Bacteria 1142
19 Ga0070669_100004771 3300005353 Bacteria 9777
20 Ga0070709_10000425 3300005434 Bacteria 25583
21 Ga0070709_10039995 3300005434 Bacteria 2880
22 Ga0070713_100000007 3300005436 Bacteria 186402
23 Ga0070701_10008745 3300005438 Bacteria 4397
24 Ga0070711_100012501 3300005439 Bacteria 5307
25 Ga0070705_100001196 3300005440 Bacteria 14119
26 Ga0070705_100108779 3300005440 Bacteria 1766
27 Ga0070700_100023108 3300005441 Bacteria 3635
28 Ga0070694_100004615 3300005444 Bacteria 8289
29 Ga0070694_100028561 3300005444 Bacteria 3631
30 Ga0070694_100230828 3300005444 Bacteria 1392
31 Ga0070678_100248129 3300005456 Bacteria 1492
32 Ga0070678_100302842 3300005456 Bacteria 1359
33 Ga0070662_100218470 3300005457 Bacteria 1520
34 Ga0070681_10000186 3300005458 Bacteria 47903
35 Ga0068867_100027259 3300005459 Bacteria 4104
36 Ga0068867_100041412 3300005459 Bacteria 3366
37 Ga0068867_100121590 3300005459 Bacteria 2019
38 Ga0068867_100130498 3300005459 Bacteria 1952
39 Ga0070679_100000209 3300005530 Bacteria 47903
40 Ga0070679_100005379 3300005530 Bacteria 11859
41 Ga0070679_100224515 3300005530 Bacteria 1839
42 Ga0068853_100003904 3300005539 Bacteria 11430
43 Ga0070672_100298282 3300005543 Bacteria 1366
44 Ga0070686_100254809 3300005544 Bacteria 1283
45 Ga0070695_100007502 3300005545 Bacteria 6460
46 Ga0070695_100037101 3300005545 Bacteria 3070
47 Ga0070696_100024509 3300005546 Bacteria 4101
48 Ga0070696_100167400 3300005546 Bacteria 1623
49 Ga0070693_100091431 3300005547 Bacteria 1835
50 Ga0070693_100161836 3300005547 Bacteria 1426
51 Ga0070665_100000177 3300005548 Bacteria 113201
52 Ga0070704_100044939 3300005549 Bacteria 3072
53 Ga0070704_100047727 3300005549 Bacteria 2995
54 Ga0068855_100379468 3300005563 Bacteria 1552
55 Ga0068857_100001679 3300005577 Bacteria 17799
56 Ga0068854_100051486 3300005578 Bacteria 2950
57 Ga0068856_100001033 3300005614 Bacteria 29595
58 Ga0068856_100037039 3300005614 Bacteria 4785
59 Ga0068856_100097027 3300005614 Bacteria 2936
60 Ga0070702_100075029 3300005615 Bacteria 2008
61 Ga0068852_100391919 3300005616 Bacteria 1364
62 Ga0068859_100073597 3300005617 Bacteria 3455
63 Ga0068859_100075145 3300005617 Bacteria 3419
64 Ga0068861_100003769 3300005719 Bacteria 10119
65 Ga0068861_100070450 3300005719 Bacteria 2707
66 Ga0068863_100113623 3300005841 Bacteria 2580
67 Ga0068858_100054416 3300005842 Bacteria 3700
68 Ga0068860_100050090 3300005843 Bacteria 3977
69 Ga0068862_100008599 3300005844 Bacteria 8448
70 Ga0068862_100054049 3300005844 Bacteria 3438
71 Ga0068862_100147999 3300005844 Bacteria 2089
72 Ga0081540_1011962 3300005983 Bacteria 5755
73 Ga0075365_10042243 3300006038 Bacteria 2980
74 Ga0075363_100010821 3300006048 Bacteria 4349
75 Ga0075363_100126206 3300006048 Bacteria 1433
76 Ga0075432_10052209 3300006058 Bacteria 1444
77 Ga0070716_100014997 3300006173 Bacteria 3976
78 Ga0070712_100000015 3300006175 Bacteria 106593
79 Ga0075362_10003750 3300006177 Bacteria 5373
80 Ga0075362_10054409 3300006177 Bacteria 1798
81 Ga0075367_10013666 3300006178 Bacteria 4372
82 Ga0075366_10084846 3300006195 Bacteria 1894
83 Ga0097621_100027924 3300006237 Bacteria 4444
84 Ga0097621_100034677 3300006237 Bacteria 4027
85 Ga0068871_100001839 3300006358 Bacteria 14339
86 Ga0068871_100110602 3300006358 Bacteria 2311
87 Ga0075428_100000602 3300006844 Bacteria 36732
88 Ga0075428_100150801 3300006844 Bacteria 2525
89 Ga0075428_100243855 3300006844 Bacteria 1938
90 Ga0075430_100106683 3300006846 Bacteria 2337
91 Ga0075431_100937281 3300006847 Bacteria 834
92 Ga0075434_100053562 3300006871 Bacteria 4008
93 Ga0075434_100073669 3300006871 Bacteria 3407
94 Ga0075429_100004662 3300006880 Bacteria 11801
95 Ga0075429_100182034 3300006880 Bacteria 1841
96 Ga0068865_100097355 3300006881 Bacteria 2147
97 Ga0075436_100000024 3300006914 Bacteria 115057
98 Ga0075436_100021546 3300006914 Bacteria 4424
99 Ga0097620_100073597 3300006931 Bacteria 3455
100 Ga0097620_100075148 3300006931 Bacteria 3419
101 Ga0075435_100050964 3300007076 Bacteria 3333
102 Ga0105240_10008320 3300009093 Bacteria 14846
103 Ga0105240_10146795 3300009093 Bacteria 2814
104 Ga0105240_10560434 3300009093 Bacteria 1263
105 Ga0111539_10033914 3300009094 Bacteria 6194
106 Ga0111539_10105654 3300009094 Bacteria 3303
107 Ga0111539_10120120 3300009094 Bacteria 3079
108 Ga0111539_10177286 3300009094 Bacteria 2490
109 Ga0105245_10015653 3300009098 Bacteria 6615
110 Ga0114129_10001652 3300009147 Bacteria 30334
111 Ga0105243_10004481 3300009148 Bacteria 11041
112 Ga0105243_10023078 3300009148 Bacteria 4733
113 Ga0105243_10392854 3300009148 Bacteria 1286
114 Ga0105241_10135415 3300009174 Bacteria 1999
115 Ga0105241_10161773 3300009174 Bacteria 1841
116 Ga0105241_10168016 3300009174 Bacteria 1809
117 Ga0105242_10006099 3300009176 Bacteria 9292
118 Ga0105242_10173875 3300009176 Bacteria 1894
119 Ga0105248_10359203 3300009177 Bacteria 1640
120 Ga0105237_10012578 3300009545 Bacteria 8914
121 Ga0105238_10266284 3300009551 Bacteria 1694
122 Ga0105238_10291064 3300009551 Bacteria 1615
123 Ga0105249_10020455 3300009553 Bacteria 5917
124 Ga0105249_10089017 3300009553 Bacteria 2884
125 Ga0105249_10300934 3300009553 Bacteria 1609
126 Ga0105147_102904 3300009982 Bacteria 1426
127 Ga0105239_10104630 3300010375 Bacteria 3134
128 Ga0105239_10230763 3300010375 Bacteria 2076
129 Ga0157373_10021274 3300013100 Bacteria 4710
130 Ga0157370_10014300 3300013104 Bacteria 8122
131 Ga0157369_10125436 3300013105 Bacteria 2722
132 Ga0157374_10402464 3300013296 Bacteria 1366
133 Ga0157378_10019499 3300013297 Bacteria 5962
134 Ga0157372_10108954 3300013307 Bacteria 3171
135 Ga0157375_10139055 3300013308 Bacteria 2554
136 Ga0163163_10149944 3300014325 Bacteria 2376
137 Ga0157377_10186154 3300014745 Bacteria 1309
138 Ga0157379_10004054 3300014968 Bacteria 12495
139 Ga0157379_10276047 3300014968 Bacteria 1529
140 Ga0157376_10034849 3300014969 Bacteria 4067
141 Ga0157376_10138059 3300014969 Bacteria 2184
142 Ga0209566_105543 3300025225 Bacteria 1575
143 Ga0209646_1000087 3300025246 Bacteria 193273
144 Ga0209646_1004159 3300025246 Bacteria 2680
145 Ga0209759_1012805 3300025256 Bacteria 2303
146 Ga0207697_10065537 3300025315 Bacteria 1516
147 Ga0207699_10000188 3300025906 Bacteria 37593
148 Ga0207699_10052639 3300025906 Bacteria 2411
149 Ga0207705_10143094 3300025909 Bacteria 1787
150 Ga0207654_10233200 3300025911 Bacteria 1227
151 Ga0207707_10000168 3300025912 Bacteria 68834
152 Ga0207695_10012101 3300025913 Bacteria 10371
153 Ga0207695_10076659 3300025913 Bacteria 3398
154 Ga0207693_10000048 3300025915 Bacteria 100685
155 Ga0207663_10346924 3300025916 Bacteria 1123
156 Ga0207660_10000227 3300025917 Bacteria 36209
157 Ga0207660_10010122 3300025917 Bacteria 6109
158 Ga0207660_10055048 3300025917 Bacteria 2841
159 Ga0207660_10131575 3300025917 Bacteria 1905
160 Ga0207660_10148141 3300025917 Bacteria 1801
161 Ga0207662_10001351 3300025918 Bacteria 11846
162 Ga0207649_10074195 3300025920 Bacteria 2182
163 Ga0207652_10000158 3300025921 Bacteria 73781
164 Ga0207652_10008132 3300025921 Bacteria 8422
165 Ga0207652_10090119 3300025921 Bacteria 2694
166 Ga0207681_10028515 3300025923 Bacteria 3616
167 Ga0207694_10044033 3300025924 Bacteria 3446
168 Ga0207694_10118911 3300025924 Bacteria 2108
169 Ga0207694_10170786 3300025924 Bacteria 1760
170 Ga0207700_10000014 3300025928 Bacteria 229475
171 Ga0207706_10341888 3300025933 Bacteria 1302
172 Ga0207686_10026092 3300025934 Bacteria 3406
173 Ga0207686_10165523 3300025934 Bacteria 1554
174 Ga0207686_10327730 3300025934 Bacteria 1146
175 Ga0207709_10002403 3300025935 Bacteria 11783
176 Ga0207709_10009375 3300025935 Bacteria 5386
177 Ga0207670_10059573 3300025936 Bacteria 2597
178 Ga0207704_10083882 3300025938 Bacteria 2069
179 Ga0207704_10176928 3300025938 Bacteria 1537
180 Ga0207665_10024105 3300025939 Bacteria 4010
181 Ga0207691_10027481 3300025940 Bacteria 5333
182 Ga0207711_10722484 3300025941 Bacteria 929
183 Ga0207689_10011736 3300025942 Bacteria 7510
184 Ga0207689_10634683 3300025942 Bacteria 899
185 Ga0207667_10068822 3300025949 Bacteria 3685
186 Ga0207712_10080668 3300025961 Bacteria 2367
187 Ga0207640_10020488 3300025981 Bacteria 3928
188 Ga0207640_10401338 3300025981 Bacteria 1117
189 Ga0207677_10002899 3300026023 Bacteria 9057
190 Ga0207677_10045430 3300026023 Bacteria 2933
191 Ga0207708_10063944 3300026075 Bacteria 2811
192 Ga0207708_10175695 3300026075 Bacteria 1698
193 Ga0207702_10000011 3300026078 Bacteria 284514
194 Ga0207702_10069876 3300026078 Bacteria 3019
195 Ga0207702_10115343 3300026078 Bacteria 2395
196 Ga0207641_10135857 3300026088 Bacteria 2213
197 Ga0207641_10167519 3300026088 Bacteria 2002
198 Ga0207648_10002687 3300026089 Bacteria 18922
199 Ga0207648_10004721 3300026089 Bacteria 13925
200 Ga0207648_10011599 3300026089 Bacteria 8298
201 Ga0207648_10193640 3300026089 Bacteria 1802
202 Ga0207676_10113849 3300026095 Bacteria 2269
203 Ga0207676_10313004 3300026095 Bacteria 1438
204 Ga0207674_10000002 3300026116 Bacteria 279738
205 Ga0207675_100008410 3300026118 Bacteria 9726
206 Ga0207675_100090812 3300026118 Bacteria 2872
207 Ga0207683_10046770 3300026121 Bacteria 3788
208 Ga0207683_10065625 3300026121 Bacteria 3200
209 Ga0209967_1009842 3300027364 Bacteria 1327
210 Ga0210000_1000344 3300027462 Bacteria 6616
211 Ga0209999_1010612 3300027543 Bacteria 1665
212 Ga0209982_1019105 3300027552 Bacteria 1050
213 Ga0209983_1019293 3300027665 Bacteria 1417
214 Ga0207428_10048729 3300027907 Bacteria 3397
215 Ga0207428_10155719 3300027907 Bacteria 1738
216 Ga0207428_10449967 3300027907 Bacteria 939
217 Ga0268266_10001008 3300028379 Bacteria 35458
218 Ga0268265_10172421 3300028380 Bacteria 1850
219 Ga0268265_10916168 3300028380 Bacteria 861
220 Ga0268264_10085554 3300028381 Bacteria 2706
221 Ga0268264_10265512 3300028381 Bacteria 1601
222 Ga0307515_10109056 3300028794 Bacteria 3255
223 Ga0307513_10004198 3300031456 Bacteria 19268
224 Ga0307513_10559567 3300031456 Bacteria 855
225 Ga0307408_100138990 3300031548 Bacteria 1905
226 Ga0307408_100369085 3300031548 Bacteria 1223
227 Ga0307516_10086526 3300031730 Bacteria 2970
228 Ga0307409_100798176 3300031995 Bacteria 951
229 Ga0307416_100894999 3300032002 Bacteria 987
230 Ga0307414_10231923 3300032004 Bacteria 1522
231 Ga0307415_100375755 3300032126 Bacteria 1205
232 Ga0373948_0002090 3300034817 Bacteria 2900
233 Ga0373950_0055179 3300034818 Bacteria 787
234 Ga0373928_0022779 3300035084 Bacteria 1331
235 Ga0373929_0024088 3300035085 Bacteria 1255
236 Ga0373940_0003292 3300035088 Bacteria 3278
237 Ga0373940_0052743 3300035088 Bacteria 1146
238 Ga0373932_0002270 3300035112 Bacteria 4913
239 Ga0373941_0017735 3300035115 Bacteria 1956
240 Ga0373960_0016643 3300035121 Bacteria 1895
241 Ga0373962_0003890 3300035242 Bacteria 3596
242 Ga0373931_0000479 3300035691 Bacteria 16290
243 Ga0373931_0099898 3300035691 Bacteria 1630
244 Ga0373935_0098935 3300035692 Bacteria 1920
245 Ga0373925_0317315 3300037068 Bacteria 1260
246 Ga0395905_0019373 3300037471 Bacteria 6450
247 Ga0395901_0459962 3300038443 Bacteria 1300
248 Ga0395901_0498668 3300038443 Bacteria 1240
249 Ga0395901_0751712 3300038443 Bacteria 968
250 Ga0439434_0009525 3300042435 Bacteria 2857
251 Ga0439444_0001836 3300042437 Bacteria 2816
252 Ga0439460_0066210 3300042461 Bacteria 1111
253 Ga0451577_0211165 3300042876 Bacteria 1753
254 Ga0453684_0539867 3300044712 Bacteria 1286
255 Ga0466959_0026108 3300045049 Bacteria 4332
256 Ga0451576_0013103 3300045051 Bacteria 9285
257 Ga0451576_0013530 3300045051 Bacteria 9127
258 Ga0451576_0042556 3300045051 Bacteria 4794
259 Ga0495629_0310204 3300046459 Bacteria 1079
260 Ga0495644_0162218 3300046523 Bacteria 857
261 Ga0495598_0191157 3300046537 Bacteria 735
262 Ga0495621_0043053 3300046539 Bacteria 1592
263 Ga0495625_0178873 3300046660 Bacteria 1412
264 Ga0495581_0023198 3300047315 Bacteria 3595
265 Ga0495636_0020548 3300047318 Bacteria 2661
266 Ga0496100_0416899 3300048903 Bacteria 1025
267 Ga0496102_0135449 3300048905 Bacteria 2308
268 Ga0496114_0690596 3300048917 Bacteria 896
269 Ga0496118_0025084 3300048921 Bacteria 5125
270 Ga0496124_0038367 3300048927 Bacteria 4161
271 Ga0496125_0044360 3300048928 Bacteria 3762
272 Ga0496126_0051944 3300048929 Bacteria 3729
273 Ga0501032_0209046 3300049569 Bacteria 1273
274 Ga0501033_0228417 3300049570 Bacteria 1323
275 Ga0501037_0270881 3300049573 Bacteria 1185
276 Ga0501038_0468242 3300049574 Bacteria 967
277 Ga0501039_0702434 3300049575 Bacteria 791
278 Ga0501040_0058379 3300049576 Bacteria 2650
279 Ga0501043_0108115 3300049579 Bacteria 2185
280 Ga0501047_0376824 3300049581 Bacteria 1254
281 Ga0501047_0588677 3300049581 Bacteria 935
282 Ga0501067_0084552 3300049583 Bacteria 1760
283 Ga0501067_0105652 3300049583 Bacteria 1565
284 Ga0501068_0117878 3300049584 Bacteria 1654
285 Ga0501069_0018443 3300049585 Bacteria 3765
286 Ga0501071_0206717 3300049587 Bacteria 1476
287 Ga0501071_0591795 3300049587 Bacteria 853
288 Ga0501072_0294203 3300049588 Bacteria 1291
289 Ga0501073_0072969 3300049589 Bacteria 2390
290 Ga0501074_0085015 3300049590 Bacteria 2267
291 Ga0501075_0179127 3300049591 Bacteria 1617
292 Ga0501075_0232210 3300049591 Bacteria 1407
293 Ga0501076_0047390 3300049592 Bacteria 3398
294 Ga0501076_0135234 3300049592 Bacteria 2001
295 Ga0501077_0426826 3300049593 Bacteria 848
296 Ga0501249_013579 3300049679 Bacteria 1733
297 Ga0501079_0403569 3300049741 Bacteria 1072
298 Ga0501080_0105506 3300049742 Bacteria 2612
299 Ga0501080_0521101 3300049742 Bacteria 1061
300 Ga0501083_0106234 3300049744 Bacteria 1848
301 Ga0501241_094753 3300049758 Unclassified 636
302 Ga0501035_0159139 3300049822 Bacteria 1956
303 Ga0501044_0174963 3300049823 Bacteria 2116
304 Ga0501045_0093720 3300049824 Bacteria 2221
305 nmdc:mga0yw44_157578_c1 3300050492 Bacteria 1485
306 nmdc:mga0k408_111233_c1 3300050493 Bacteria 1619
307 nmdc:mga06z11_143858_c1 3300050494 Bacteria 1350
308 nmdc:mga04h51_241863_c1 3300050495 Bacteria 721
309 nmdc:mga05p37_2170_c1 3300050507 Bacteria 22883
310 nmdc:mga09592_193_c1 3300050508 Bacteria 43770
311 nmdc:mga09592_54062_c1 3300050508 Bacteria 3392
312 nmdc:mga0qj67_120375_c1 3300050509 Bacteria 2123
313 nmdc:mga06r32_1425_c1 3300050510 Bacteria 21581
314 nmdc:mga08y16_159710_c1 3300050511 Bacteria 2342
315 nmdc:mga08y16_262_c1 3300050511 Bacteria 47546
316 nmdc:mga08y16_649076_c1 3300050511 Bacteria 1060
317 nmdc:mga08y16_67384_c1 3300050511 Bacteria 3734
318 nmdc:mga08y16_850006_c1 3300050511 Bacteria 902
319 nmdc:mga0n895_51565_c1 3300050512 Bacteria 4037
320 nmdc:mga0rr50_42756_c1 3300050513 Bacteria 3311
321 nmdc:mga08x19_29848_c1 3300050514 Bacteria 3422
322 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
323 Ga0500583_0000358 3300053092 Bacteria 15015
324 Ga0500641_0001149 3300053096 Bacteria 9411
325 Ga0500592_027465 3300053116 Bacteria 918
326 Ga0500616_0000006 3300053153 Bacteria 944738
327 Ga0501082_0131735 3300060353 Bacteria 2170
328 Ga0501082_0934193 3300060353 Bacteria 759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0020548 Ga0495636_0020548_879_1442 181
2 3300049758 Ga0501241_094753 Ga0501241_094753_33_614 185
3 3300032004 Ga0307414_10231923 Ga0307414_102319232 190
4 3300046539 Ga0495621_0043053 Ga0495621_0043053_566_1219 197
5 3300035692 Ga0373935_0098935 Ga0373935_0098935_648_1334 198
6 3300037068 Ga0373925_0317315 Ga0373925_0317315_179_865 198
7 3300049581 Ga0501047_0588677 Ga0501047_0588677_269_922 199
8 3300049823 Ga0501044_0174963 Ga0501044_0174963_15_668 199
9 3300013307 Ga0157372_10108954 Ga0157372_101089545 200
10 3300025917 Ga0207660_10131575 Ga0207660_101315752 200
11 3300026078 Ga0207702_10115343 Ga0207702_101153432 200
12 3300049589 Ga0501073_0072969 Ga0501073_0072969_679_1332 201
13 3300005344 Ga0070661_100026454 Ga0070661_1000264543 203
14 3300025920 Ga0207649_10074195 Ga0207649_100741952 203
15 3300031548 Ga0307408_100138990 Ga0307408_1001389902 204
16 3300048917 Ga0496114_0690596 Ga0496114_0690596_159_794 204
17 3300025924 Ga0207694_10044033 Ga0207694_100440331 205
18 iso_pu_bacteria 2582581316 2585336430 207
19 iso_pu_bacteria 2738543024 2739306575 207
20 iso_pu_bacteria 2852103415 2852105742 207
21 iso_pu_bacteria 2874123672 2874129913 207
22 iso_pu_bacteria 2883354860 2883359165 207
23 iso_pu_bacteria 2885409591 2885416276 207
24 iso_pu_bacteria 2906610324 2906617305 207
25 3300005338 Ga0068868_100002469 Ga0068868_1000024699 208
26 3300005459 Ga0068867_100027259 Ga0068867_1000272595 208
27 3300014969 Ga0157376_10138059 Ga0157376_101380592 208
28 3300025934 Ga0207686_10327730 Ga0207686_103277302 208
29 3300026023 Ga0207677_10002899 Ga0207677_1000289912 208
30 3300026089 Ga0207648_10193640 Ga0207648_101936402 208
31 3300005295 Ga0065707_10087099 Ga0065707_100870993 210
32 3300009174 Ga0105241_10161773 Ga0105241_101617731 210
33 3300034817 Ga0373948_0002090 Ga0373948_0002090_2109_2759 210
34 3300034818 Ga0373950_0055179 Ga0373950_0055179_49_699 210
35 3300035084 Ga0373928_0022779 Ga0373928_0022779_395_1045 210
36 3300035088 Ga0373940_0003292 Ga0373940_0003292_385_1035 210
37 3300035112 Ga0373932_0002270 Ga0373932_0002270_1163_1813 210
38 3300035115 Ga0373941_0017735 Ga0373941_0017735_1289_1939 210
39 3300035242 Ga0373962_0003890 Ga0373962_0003890_859_1509 210
40 3300035691 Ga0373931_0000479 Ga0373931_0000479_1253_1903 210
41 3300045051 Ga0451576_0013103 Ga0451576_0013103_347_997 210
42 3300005327 Ga0070658_10001781 Ga0070658_1000178113 211
43 3300005330 Ga0070690_100004936 Ga0070690_1000049361 211
44 3300005334 Ga0068869_100087570 Ga0068869_1000875703 211
45 3300005334 Ga0068869_100338127 Ga0068869_1003381272 211
46 3300005336 Ga0070680_100008738 Ga0070680_1000087382 211
47 3300005337 Ga0070682_100037781 Ga0070682_1000377815 211
48 3300005338 Ga0068868_100007039 Ga0068868_10000703910 211
49 3300005340 Ga0070689_100011173 Ga0070689_1000111738 211
50 3300005341 Ga0070691_10014365 Ga0070691_100143653 211
51 3300005343 Ga0070687_100002786 Ga0070687_1000027865 211
52 3300005345 Ga0070692_10008219 Ga0070692_100082193 211
53 3300005345 Ga0070692_10044898 Ga0070692_100448983 211
54 3300005345 Ga0070692_10210959 Ga0070692_102109591 211
55 3300005353 Ga0070669_100004771 Ga0070669_1000047713 211
56 3300005434 Ga0070709_10000425 Ga0070709_1000042520 211
57 3300005434 Ga0070709_10039995 Ga0070709_100399953 211
58 3300005436 Ga0070713_100000007 Ga0070713_100000007168 211
59 3300005438 Ga0070701_10008745 Ga0070701_100087454 211
60 3300005439 Ga0070711_100012501 Ga0070711_1000125016 211
61 3300005440 Ga0070705_100001196 Ga0070705_1000011964 211
62 3300005440 Ga0070705_100108779 Ga0070705_1001087792 211
63 3300005441 Ga0070700_100023108 Ga0070700_1000231083 211
64 3300005444 Ga0070694_100004615 Ga0070694_1000046152 211
65 3300005444 Ga0070694_100028561 Ga0070694_1000285613 211
66 3300005444 Ga0070694_100230828 Ga0070694_1002308281 211
67 3300005456 Ga0070678_100248129 Ga0070678_1002481292 211
68 3300005456 Ga0070678_100302842 Ga0070678_1003028422 211
69 3300005457 Ga0070662_100218470 Ga0070662_1002184702 211
70 3300005458 Ga0070681_10000186 Ga0070681_1000018621 211
71 3300005459 Ga0068867_100041412 Ga0068867_1000414124 211
72 3300005459 Ga0068867_100121590 Ga0068867_1001215904 211
73 3300005459 Ga0068867_100130498 Ga0068867_1001304981 211
74 3300005530 Ga0070679_100000209 Ga0070679_10000020927 211
75 3300005530 Ga0070679_100005379 Ga0070679_1000053795 211
76 3300005530 Ga0070679_100224515 Ga0070679_1002245154 211
77 3300005539 Ga0068853_100003904 Ga0068853_10000390415 211
78 3300005543 Ga0070672_100298282 Ga0070672_1002982822 211
79 3300005544 Ga0070686_100254809 Ga0070686_1002548091 211
80 3300005545 Ga0070695_100007502 Ga0070695_1000075028 211
81 3300005545 Ga0070695_100037101 Ga0070695_1000371014 211
82 3300005546 Ga0070696_100024509 Ga0070696_1000245094 211
83 3300005546 Ga0070696_100167400 Ga0070696_1001674002 211
84 3300005547 Ga0070693_100091431 Ga0070693_1000914311 211
85 3300005547 Ga0070693_100161836 Ga0070693_1001618362 211
86 3300005548 Ga0070665_100000177 Ga0070665_100000177107 211
87 3300005549 Ga0070704_100044939 Ga0070704_1000449394 211
88 3300005549 Ga0070704_100047727 Ga0070704_1000477274 211
89 3300005563 Ga0068855_100379468 Ga0068855_1003794682 211
90 3300005577 Ga0068857_100001679 Ga0068857_1000016792 211
91 3300005578 Ga0068854_100051486 Ga0068854_1000514865 211
92 3300005614 Ga0068856_100001033 Ga0068856_10000103320 211
93 3300005614 Ga0068856_100037039 Ga0068856_1000370392 211
94 3300005614 Ga0068856_100097027 Ga0068856_1000970273 211
95 3300005615 Ga0070702_100075029 Ga0070702_1000750292 211
96 3300005616 Ga0068852_100391919 Ga0068852_1003919192 211
97 3300005617 Ga0068859_100075145 Ga0068859_1000751454 211
98 3300005719 Ga0068861_100003769 Ga0068861_10000376913 211
99 3300005719 Ga0068861_100070450 Ga0068861_1000704502 211
100 3300005841 Ga0068863_100113623 Ga0068863_1001136235 211
101 3300005842 Ga0068858_100054416 Ga0068858_1000544165 211
102 3300005843 Ga0068860_100050090 Ga0068860_1000500905 211
103 3300005844 Ga0068862_100008599 Ga0068862_1000085994 211
104 3300005844 Ga0068862_100054049 Ga0068862_1000540493 211
105 3300005844 Ga0068862_100147999 Ga0068862_1001479992 211
106 3300005983 Ga0081540_1011962 Ga0081540_10119625 211
107 3300006038 Ga0075365_10042243 Ga0075365_100422432 211
108 3300006048 Ga0075363_100010821 Ga0075363_1000108212 211
109 3300006048 Ga0075363_100126206 Ga0075363_1001262062 211
110 3300006058 Ga0075432_10052209 Ga0075432_100522092 211
111 3300006173 Ga0070716_100014997 Ga0070716_1000149973 211
112 3300006175 Ga0070712_100000015 Ga0070712_10000001589 211
113 3300006177 Ga0075362_10003750 Ga0075362_100037504 211
114 3300006177 Ga0075362_10054409 Ga0075362_100544092 211
115 3300006178 Ga0075367_10013666 Ga0075367_100136662 211
116 3300006195 Ga0075366_10084846 Ga0075366_100848462 211
117 3300006237 Ga0097621_100034677 Ga0097621_1000346775 211
118 3300006358 Ga0068871_100001839 Ga0068871_1000018395 211
119 3300006844 Ga0075428_100000602 Ga0075428_10000060222 211
120 3300006844 Ga0075428_100150801 Ga0075428_1001508013 211
121 3300006844 Ga0075428_100243855 Ga0075428_1002438552 211
122 3300006846 Ga0075430_100106683 Ga0075430_1001066834 211
123 3300006847 Ga0075431_100937281 Ga0075431_1009372812 211
124 3300006871 Ga0075434_100053562 Ga0075434_1000535624 211
125 3300006871 Ga0075434_100073669 Ga0075434_1000736694 211
126 3300006880 Ga0075429_100004662 Ga0075429_1000046627 211
127 3300006880 Ga0075429_100182034 Ga0075429_1001820342 211
128 3300006881 Ga0068865_100097355 Ga0068865_1000973554 211
129 3300006914 Ga0075436_100000024 Ga0075436_10000002436 211
130 3300006914 Ga0075436_100021546 Ga0075436_1000215463 211
131 3300006931 Ga0097620_100075148 Ga0097620_1000751484 211
132 3300007076 Ga0075435_100050964 Ga0075435_1000509643 211
133 3300009093 Ga0105240_10008320 Ga0105240_1000832012 211
134 3300009093 Ga0105240_10146795 Ga0105240_101467952 211
135 3300009093 Ga0105240_10560434 Ga0105240_105604343 211
136 3300009094 Ga0111539_10033914 Ga0111539_100339144 211
137 3300009094 Ga0111539_10120120 Ga0111539_101201202 211
138 3300009094 Ga0111539_10177286 Ga0111539_101772862 211
139 3300009098 Ga0105245_10015653 Ga0105245_100156533 211
140 3300009147 Ga0114129_10001652 Ga0114129_1000165220 211
141 3300009148 Ga0105243_10004481 Ga0105243_1000448111 211
142 3300009148 Ga0105243_10023078 Ga0105243_100230786 211
143 3300009148 Ga0105243_10392854 Ga0105243_103928541 211
144 3300009174 Ga0105241_10135415 Ga0105241_101354151 211
145 3300009174 Ga0105241_10168016 Ga0105241_101680162 211
146 3300009176 Ga0105242_10006099 Ga0105242_100060998 211
147 3300009176 Ga0105242_10173875 Ga0105242_101738752 211
148 3300009177 Ga0105248_10359203 Ga0105248_103592032 211
149 3300009545 Ga0105237_10012578 Ga0105237_1001257812 211
150 3300009551 Ga0105238_10266284 Ga0105238_102662842 211
151 3300009551 Ga0105238_10291064 Ga0105238_102910642 211
152 3300009553 Ga0105249_10020455 Ga0105249_100204552 211
153 3300009553 Ga0105249_10089017 Ga0105249_100890173 211
154 3300009553 Ga0105249_10300934 Ga0105249_103009342 211
155 3300009982 Ga0105147_102904 Ga0105147_1029041 211
156 3300010375 Ga0105239_10104630 Ga0105239_101046302 211
157 3300010375 Ga0105239_10230763 Ga0105239_102307632 211
158 3300013100 Ga0157373_10021274 Ga0157373_100212745 211
159 3300013104 Ga0157370_10014300 Ga0157370_100143002 211
160 3300013105 Ga0157369_10125436 Ga0157369_101254361 211
161 3300013296 Ga0157374_10402464 Ga0157374_104024642 211
162 3300013297 Ga0157378_10019499 Ga0157378_100194992 211
163 3300013308 Ga0157375_10139055 Ga0157375_101390555 211
164 3300014325 Ga0163163_10149944 Ga0163163_101499442 211
165 3300014745 Ga0157377_10186154 Ga0157377_101861542 211
166 3300014968 Ga0157379_10004054 Ga0157379_100040549 211
167 3300014968 Ga0157379_10276047 Ga0157379_102760472 211
168 3300014969 Ga0157376_10034849 Ga0157376_100348493 211
169 3300025225 Ga0209566_105543 Ga0209566_1055432 211
170 3300025246 Ga0209646_1000087 Ga0209646_100008718 211
171 3300025246 Ga0209646_1004159 Ga0209646_10041593 211
172 3300025256 Ga0209759_1012805 Ga0209759_10128053 211
173 3300025315 Ga0207697_10065537 Ga0207697_100655372 211
174 3300025906 Ga0207699_10000188 Ga0207699_1000018821 211
175 3300025906 Ga0207699_10052639 Ga0207699_100526394 211
176 3300025911 Ga0207654_10233200 Ga0207654_102332002 211
177 3300025912 Ga0207707_10000168 Ga0207707_1000016817 211
178 3300025913 Ga0207695_10012101 Ga0207695_100121014 211
179 3300025913 Ga0207695_10076659 Ga0207695_100766594 211
180 3300025915 Ga0207693_10000048 Ga0207693_1000004886 211
181 3300025916 Ga0207663_10346924 Ga0207663_103469241 211
182 3300025917 Ga0207660_10000227 Ga0207660_1000022718 211
183 3300025917 Ga0207660_10010122 Ga0207660_100101228 211
184 3300025917 Ga0207660_10055048 Ga0207660_100550481 211
185 3300025917 Ga0207660_10148141 Ga0207660_101481412 211
186 3300025918 Ga0207662_10001351 Ga0207662_1000135113 211
187 3300025921 Ga0207652_10000158 Ga0207652_1000015850 211
188 3300025921 Ga0207652_10008132 Ga0207652_100081325 211
189 3300025921 Ga0207652_10090119 Ga0207652_100901194 211
190 3300025923 Ga0207681_10028515 Ga0207681_100285152 211
191 3300025924 Ga0207694_10118911 Ga0207694_101189113 211
192 3300025924 Ga0207694_10170786 Ga0207694_101707862 211
193 3300025928 Ga0207700_10000014 Ga0207700_1000001454 211
194 3300025933 Ga0207706_10341888 Ga0207706_103418882 211
195 3300025934 Ga0207686_10026092 Ga0207686_100260923 211
196 3300025934 Ga0207686_10165523 Ga0207686_101655231 211
197 3300025935 Ga0207709_10002403 Ga0207709_1000240310 211
198 3300025935 Ga0207709_10009375 Ga0207709_100093755 211
199 3300025936 Ga0207670_10059573 Ga0207670_100595734 211
200 3300025938 Ga0207704_10083882 Ga0207704_100838823 211
201 3300025938 Ga0207704_10176928 Ga0207704_101769282 211
202 3300025939 Ga0207665_10024105 Ga0207665_100241053 211
203 3300025940 Ga0207691_10027481 Ga0207691_100274817 211
204 3300025942 Ga0207689_10011736 Ga0207689_100117369 211
205 3300025942 Ga0207689_10634683 Ga0207689_106346832 211
206 3300025949 Ga0207667_10068822 Ga0207667_100688222 211
207 3300025961 Ga0207712_10080668 Ga0207712_100806683 211
208 3300025981 Ga0207640_10020488 Ga0207640_100204883 211
209 3300025981 Ga0207640_10401338 Ga0207640_104013381 211
210 3300026023 Ga0207677_10045430 Ga0207677_100454304 211
211 3300026075 Ga0207708_10063944 Ga0207708_100639443 211
212 3300026075 Ga0207708_10175695 Ga0207708_101756954 211
213 3300026078 Ga0207702_10000011 Ga0207702_10000011279 211
214 3300026078 Ga0207702_10069876 Ga0207702_100698764 211
215 3300026088 Ga0207641_10135857 Ga0207641_101358573 211
216 3300026088 Ga0207641_10167519 Ga0207641_101675191 211
217 3300026089 Ga0207648_10002687 Ga0207648_100026872 211
218 3300026089 Ga0207648_10004721 Ga0207648_100047219 211
219 3300026089 Ga0207648_10011599 Ga0207648_100115993 211
220 3300026095 Ga0207676_10113849 Ga0207676_101138492 211
221 3300026116 Ga0207674_10000002 Ga0207674_10000002272 211
222 3300026118 Ga0207675_100008410 Ga0207675_1000084109 211
223 3300026118 Ga0207675_100090812 Ga0207675_1000908123 211
224 3300026121 Ga0207683_10046770 Ga0207683_100467704 211
225 3300026121 Ga0207683_10065625 Ga0207683_100656255 211
226 3300027364 Ga0209967_1009842 Ga0209967_10098422 211
227 3300027462 Ga0210000_1000344 Ga0210000_10003442 211
228 3300027543 Ga0209999_1010612 Ga0209999_10106122 211
229 3300027552 Ga0209982_1019105 Ga0209982_10191052 211
230 3300027665 Ga0209983_1019293 Ga0209983_10192932 211
231 3300027907 Ga0207428_10048729 Ga0207428_100487295 211
232 3300027907 Ga0207428_10155719 Ga0207428_101557193 211
233 3300027907 Ga0207428_10449967 Ga0207428_104499672 211
234 3300028379 Ga0268266_10001008 Ga0268266_1000100812 211
235 3300028380 Ga0268265_10172421 Ga0268265_101724213 211
236 3300028380 Ga0268265_10916168 Ga0268265_109161682 211
237 3300028381 Ga0268264_10085554 Ga0268264_100855544 211
238 3300028381 Ga0268264_10265512 Ga0268264_102655121 211
239 3300028794 Ga0307515_10109056 Ga0307515_101090562 211
240 3300031456 Ga0307513_10004198 Ga0307513_1000419817 211
241 3300031456 Ga0307513_10559567 Ga0307513_105595671 211
242 3300031548 Ga0307408_100369085 Ga0307408_1003690852 211
243 3300031730 Ga0307516_10086526 Ga0307516_100865264 211
244 3300031995 Ga0307409_100798176 Ga0307409_1007981761 211
245 3300032002 Ga0307416_100894999 Ga0307416_1008949991 211
246 3300032126 Ga0307415_100375755 Ga0307415_1003757552 211
247 3300035085 Ga0373929_0024088 Ga0373929_0024088_116_769 211
248 3300035088 Ga0373940_0052743 Ga0373940_0052743_77_730 211
249 3300035121 Ga0373960_0016643 Ga0373960_0016643_341_994 211
250 3300035691 Ga0373931_0099898 Ga0373931_0099898_763_1419 211
251 3300037471 Ga0395905_0019373 Ga0395905_0019373_852_1496 211
252 3300038443 Ga0395901_0459962 Ga0395901_0459962_231_872 211
253 3300038443 Ga0395901_0498668 Ga0395901_0498668_51_704 211
254 3300038443 Ga0395901_0751712 Ga0395901_0751712_272_910 211
255 3300042435 Ga0439434_0009525 Ga0439434_0009525_70_723 211
256 3300042437 Ga0439444_0001836 Ga0439444_0001836_1938_2591 211
257 3300042461 Ga0439460_0066210 Ga0439460_0066210_95_748 211
258 3300042876 Ga0451577_0211165 Ga0451577_0211165_164_817 211
259 3300044712 Ga0453684_0539867 Ga0453684_0539867_224_877 211
260 3300045049 Ga0466959_0026108 Ga0466959_0026108_1537_2199 211
261 3300045051 Ga0451576_0013530 Ga0451576_0013530_2008_2661 211
262 3300045051 Ga0451576_0042556 Ga0451576_0042556_347_1000 211
263 3300046459 Ga0495629_0310204 Ga0495629_0310204_13_666 211
264 3300046523 Ga0495644_0162218 Ga0495644_0162218_158_811 211
265 3300046537 Ga0495598_0191157 Ga0495598_0191157_23_676 211
266 3300046660 Ga0495625_0178873 Ga0495625_0178873_109_762 211
267 3300047315 Ga0495581_0023198 Ga0495581_0023198_2380_3033 211
268 3300048903 Ga0496100_0416899 Ga0496100_0416899_70_723 211
269 3300048905 Ga0496102_0135449 Ga0496102_0135449_1446_2105 211
270 3300048921 Ga0496118_0025084 Ga0496118_0025084_338_991 211
271 3300048927 Ga0496124_0038367 Ga0496124_0038367_1868_2578 211
272 3300048928 Ga0496125_0044360 Ga0496125_0044360_414_1124 211
273 3300048929 Ga0496126_0051944 Ga0496126_0051944_2521_3177 211
274 3300049569 Ga0501032_0209046 Ga0501032_0209046_325_981 211
275 3300049570 Ga0501033_0228417 Ga0501033_0228417_177_833 211
276 3300049573 Ga0501037_0270881 Ga0501037_0270881_326_979 211
277 3300049574 Ga0501038_0468242 Ga0501038_0468242_187_840 211
278 3300049575 Ga0501039_0702434 Ga0501039_0702434_51_704 211
279 3300049576 Ga0501040_0058379 Ga0501040_0058379_628_1275 211
280 3300049579 Ga0501043_0108115 Ga0501043_0108115_1290_1943 211
281 3300049581 Ga0501047_0376824 Ga0501047_0376824_250_906 211
282 3300049583 Ga0501067_0084552 Ga0501067_0084552_542_1180 211
283 3300049583 Ga0501067_0105652 Ga0501067_0105652_517_1170 211
284 3300049584 Ga0501068_0117878 Ga0501068_0117878_747_1385 211
285 3300049585 Ga0501069_0018443 Ga0501069_0018443_2476_3135 211
286 3300049587 Ga0501071_0206717 Ga0501071_0206717_103_756 211
287 3300049587 Ga0501071_0591795 Ga0501071_0591795_171_824 211
288 3300049588 Ga0501072_0294203 Ga0501072_0294203_193_846 211
289 3300049590 Ga0501074_0085015 Ga0501074_0085015_1084_1725 211
290 3300049591 Ga0501075_0179127 Ga0501075_0179127_816_1454 211
291 3300049591 Ga0501075_0232210 Ga0501075_0232210_53_706 211
292 3300049592 Ga0501076_0047390 Ga0501076_0047390_1293_1931 211
293 3300049592 Ga0501076_0135234 Ga0501076_0135234_170_823 211
294 3300049593 Ga0501077_0426826 Ga0501077_0426826_145_786 211
295 3300049679 Ga0501249_013579 Ga0501249_013579_619_1266 211
296 3300049741 Ga0501079_0403569 Ga0501079_0403569_27_665 211
297 3300049742 Ga0501080_0105506 Ga0501080_0105506_45_683 211
298 3300049742 Ga0501080_0521101 Ga0501080_0521101_168_821 211
299 3300049744 Ga0501083_0106234 Ga0501083_0106234_263_916 211
300 3300049822 Ga0501035_0159139 Ga0501035_0159139_1083_1739 211
301 3300049824 Ga0501045_0093720 Ga0501045_0093720_364_1017 211
302 3300050492 nmdc:mga0yw44_157578_c1 nmdc:mga0yw44_157578_c1_817_1461 211
303 3300050493 nmdc:mga0k408_111233_c1 nmdc:mga0k408_111233_c1_17_661 211
304 3300050494 nmdc:mga06z11_143858_c1 nmdc:mga06z11_143858_c1_277_921 211
305 3300050495 nmdc:mga04h51_241863_c1 nmdc:mga04h51_241863_c1_50_694 211
306 3300050507 nmdc:mga05p37_2170_c1 nmdc:mga05p37_2170_c1_2961_3614 211
307 3300050508 nmdc:mga09592_193_c1 nmdc:mga09592_193_c1_37271_37924 211
308 3300050508 nmdc:mga09592_54062_c1 nmdc:mga09592_54062_c1_1673_2326 211
309 3300050509 nmdc:mga0qj67_120375_c1 nmdc:mga0qj67_120375_c1_1303_1953 211
310 3300050510 nmdc:mga06r32_1425_c1 nmdc:mga06r32_1425_c1_18362_19015 211
311 3300050511 nmdc:mga08y16_159710_c1 nmdc:mga08y16_159710_c1_1054_1698 211
312 3300050511 nmdc:mga08y16_262_c1 nmdc:mga08y16_262_c1_16466_17119 211
313 3300050511 nmdc:mga08y16_649076_c1 nmdc:mga08y16_649076_c1_155_790 211
314 3300050511 nmdc:mga08y16_850006_c1 nmdc:mga08y16_850006_c1_74_724 211
315 3300050512 nmdc:mga0n895_51565_c1 nmdc:mga0n895_51565_c1_583_1242 211
316 3300050513 nmdc:mga0rr50_42756_c1 nmdc:mga0rr50_42756_c1_1931_2578 211
317 3300050514 nmdc:mga08x19_29848_c1 nmdc:mga08x19_29848_c1_2367_3059 211
318 3300050514 nmdc:mga08x19_86_c1 nmdc:mga08x19_86_c1_75506_76165 211
319 3300053092 Ga0500583_0000358 Ga0500583_0000358_11589_12272 211
320 3300053096 Ga0500641_0001149 Ga0500641_0001149_3280_3933 211
321 3300053116 Ga0500592_027465 Ga0500592_027465_74_718 211
322 3300053153 Ga0500616_0000006 Ga0500616_0000006_830199_830852 211
323 3300060353 Ga0501082_0131735 Ga0501082_0131735_1389_2027 211
324 3300060353 Ga0501082_0934193 Ga0501082_0934193_68_721 211
325 3300005327 Ga0070658_10049503 Ga0070658_100495032 212
326 3300005617 Ga0068859_100073597 Ga0068859_1000735972 212
327 3300006237 Ga0097621_100027924 Ga0097621_1000279245 212
328 3300006358 Ga0068871_100110602 Ga0068871_1001106022 212
329 3300006931 Ga0097620_100073597 Ga0097620_1000735972 212
330 3300009094 Ga0111539_10105654 Ga0111539_101056542 212
331 3300025909 Ga0207705_10143094 Ga0207705_101430944 212
332 3300025941 Ga0207711_10722484 Ga0207711_107224841 212
333 3300050511 nmdc:mga08y16_67384_c1 nmdc:mga08y16_67384_c1_1197_1895 212
334 3300003322 rootL2_10264288 rootL2_102642882 213
335 3300026095 Ga0207676_10313004 Ga0207676_103130042 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

22

86

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

15

81

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

113

193

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

22

82

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9718 2 211
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.965 1 213
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9628 1 213
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9582 1 213
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9555 1 213
ID Description Score Start End Superfamily
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.989 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9865 2 87 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9778 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9737 2 87 3.40.30.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9438 88 204 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A527H6A2-F1-model_v4 Glutathione S-transferase 0.9952 1 148 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9943 1 108 GO:0016740
AF-A0A086P651-F1-model_v4 Glutathione S-transferase 0.9912 1 109 GO:0016740
AF-A0A527A1T9-F1-model_v4 Glutathione S-transferase 0.9894 1 78 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9853 1 108 GO:0016740

Feature Viewer

pLDDT pTM Quality
90.22 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map