F412150

General Info

Members Datasets Scaffolds Average Seq Length
335 146 670 102

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101469556|Ga0070693_1014695562
Length 96
Sequence MQKLGYWKTTVLAALVAMPLVAGCGKTIGETIDDTTITAMLNDPNVGGTGIDVDTYKGVVTLSGRVKNQGEHDQALALARRVDGVTEVKDALQVIP

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
80 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
88 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
89 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
90 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
91 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
94 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 12.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_101469556 3300005547 Bacteria 532
2 MBSR1b_contig_9110000 2162886012 Bacteria 1450
3 JGI25406J46586_10000195 3300003203 Bacteria 26897
4 Ga0065712_10099435 3300005290 Bacteria 2091
5 Ga0065712_10117453 3300005290 Bacteria 1714
6 Ga0065712_10237377 3300005290 Bacteria 994
7 Ga0065715_10124473 3300005293 Bacteria 2153
8 Ga0065715_10188702 3300005293 Bacteria 1429
9 Ga0065715_10248618 3300005293 Bacteria 1175
10 Ga0065715_10744466 3300005293 Bacteria 633
11 Ga0065707_10546524 3300005295 Bacteria 724
12 Ga0070658_10517964 3300005327 Bacteria 1031
13 Ga0070658_11881208 3300005327 Unclassified 517
14 Ga0070670_100044995 3300005331 Bacteria 3794
15 Ga0068869_100056648 3300005334 Bacteria 2859
16 Ga0068869_100412177 3300005334 Unclassified 1113
17 Ga0070680_100543236 3300005336 Unclassified 996
18 Ga0070680_101668311 3300005336 Bacteria 552
19 Ga0070661_100278864 3300005344 Bacteria 1296
20 Ga0070668_100618304 3300005347 Bacteria 949
21 Ga0070668_101075490 3300005347 Bacteria 725
22 Ga0070675_100596364 3300005354 Bacteria 1002
23 Ga0070675_100896397 3300005354 Bacteria 813
24 Ga0070674_100082380 3300005356 Bacteria 2302
25 Ga0070674_101940976 3300005356 Unclassified 535
26 Ga0070673_100757723 3300005364 Bacteria 894
27 Ga0070673_101487510 3300005364 Bacteria 638
28 Ga0070688_100071247 3300005365 Bacteria 2225
29 Ga0070700_100302512 3300005441 Bacteria 1168
30 Ga0070700_101909489 3300005441 Bacteria 513
31 Ga0070708_100107940 3300005445 Bacteria 2556
32 Ga0070678_100064561 3300005456 Bacteria 2714
33 Ga0070678_100236530 3300005456 Bacteria 1525
34 Ga0068867_100610729 3300005459 Bacteria 952
35 Ga0068867_100736511 3300005459 Bacteria 873
36 Ga0070707_100232032 3300005468 Bacteria 1796
37 Ga0070698_100009107 3300005471 Bacteria 10664
38 Ga0070699_101229655 3300005518 Bacteria 687
39 Ga0070704_101277066 3300005549 Unclassified 671
40 Ga0070704_102037773 3300005549 Bacteria 533
41 Ga0070664_100442906 3300005564 Bacteria 1192
42 Ga0068857_100488773 3300005577 Bacteria 1154
43 Ga0068859_100242918 3300005617 Bacteria 1890
44 Ga0068864_100318693 3300005618 Bacteria 1460
45 Ga0068861_101877679 3300005719 Bacteria 595
46 Ga0068863_102753156 3300005841 Bacteria 500
47 Ga0068860_101327634 3300005843 Bacteria 740
48 Ga0081539_10000096 3300005985 Bacteria 204059
49 Ga0097621_100067037 3300006237 Bacteria 2958
50 Ga0075428_100003208 3300006844 Bacteria 17888
51 Ga0075428_100025383 3300006844 Bacteria 6558
52 Ga0075428_100029134 3300006844 Bacteria 6109
53 Ga0075428_100278925 3300006844 Bacteria 1798
54 Ga0075428_101004763 3300006844 Unclassified 883
55 Ga0075430_100007119 3300006846 Bacteria 9435
56 Ga0075430_100077497 3300006846 Bacteria 2786
57 Ga0075430_100134587 3300006846 Bacteria 2060
58 Ga0075430_100180774 3300006846 Bacteria 1754
59 Ga0075431_100003906 3300006847 Bacteria 14507
60 Ga0075431_100006081 3300006847 Bacteria 11966
61 Ga0075431_100018655 3300006847 Bacteria 7068
62 Ga0075431_100158102 3300006847 Bacteria 2331
63 Ga0075431_100307616 3300006847 Bacteria 1600
64 Ga0075431_101332959 3300006847 Bacteria 678
65 Ga0075429_100009756 3300006880 Bacteria 8323
66 Ga0075429_100023007 3300006880 Bacteria 5402
67 Ga0075429_100137592 3300006880 Bacteria 2138
68 Ga0075429_100956509 3300006880 Bacteria 749
69 Ga0075429_101346718 3300006880 Unclassified 622
70 Ga0097620_100242904 3300006931 Bacteria 1890
71 Ga0111539_10080296 3300009094 Bacteria 3837
72 Ga0111539_10202915 3300009094 Bacteria 2312
73 Ga0111539_10494895 3300009094 Bacteria 1424
74 Ga0111539_11021757 3300009094 Bacteria 961
75 Ga0111539_11933718 3300009094 Bacteria 684
76 Ga0111539_12990020 3300009094 Unclassified 546
77 Ga0114129_10000400 3300009147 Bacteria 50737
78 Ga0114129_10009548 3300009147 Bacteria 13840
79 Ga0114129_10124496 3300009147 Bacteria 3545
80 Ga0114129_10267077 3300009147 Bacteria 2291
81 Ga0114129_10284128 3300009147 Bacteria 2210
82 Ga0114129_10415941 3300009147 Bacteria 1769
83 Ga0114129_12510439 3300009147 Bacteria 616
84 Ga0105248_10869154 3300009177 Bacteria 1018
85 Ga0163163_11190621 3300014325 Bacteria 825
86 Ga0157380_10008432 3300014326 Bacteria 7359
87 Ga0157380_10165486 3300014326 Bacteria 1926
88 Ga0157380_10185253 3300014326 Bacteria 1833
89 Ga0157377_10996171 3300014745 Unclassified 634
90 Ga0157376_11036225 3300014969 Bacteria 844
91 Ga0157376_11236001 3300014969 Bacteria 776
92 Ga0163161_10666663 3300017792 Bacteria 863
93 Ga0207697_10263666 3300025315 Bacteria 763
94 Ga0207682_10154125 3300025893 Bacteria 1038
95 Ga0207643_11036679 3300025908 Bacteria 530
96 Ga0207660_11398220 3300025917 Bacteria 567
97 Ga0207649_11136490 3300025920 Unclassified 617
98 Ga0207646_10103773 3300025922 Bacteria 2550
99 Ga0207650_10051207 3300025925 Bacteria 3055
100 Ga0207659_10030745 3300025926 Bacteria 3672
101 Ga0207659_11669975 3300025926 Bacteria 543
102 Ga0207669_10133896 3300025937 Bacteria 1708
103 Ga0207669_10917190 3300025937 Unclassified 733
104 Ga0207691_10107495 3300025940 Bacteria 2483
105 Ga0207711_11573289 3300025941 Unclassified 601
106 Ga0207689_10620598 3300025942 Unclassified 910
107 Ga0207679_10511560 3300025945 Bacteria 1073
108 Ga0207679_12124526 3300025945 Unclassified 510
109 Ga0207668_11126865 3300025972 Bacteria 704
110 Ga0207708_10239022 3300026075 Bacteria 1460
111 Ga0207708_11430840 3300026075 Bacteria 607
112 Ga0207648_10694871 3300026089 Bacteria 942
113 Ga0207648_11112808 3300026089 Bacteria 741
114 Ga0207675_100793587 3300026118 Bacteria 960
115 Ga0207683_10088309 3300026121 Bacteria 2758
116 Ga0207683_10257285 3300026121 Bacteria 1594
117 Ga0209974_10184250 3300027876 Bacteria 766
118 Ga0207428_10083088 3300027907 Bacteria 2498
119 Ga0207428_10996523 3300027907 Bacteria 589
120 Ga0307408_100167737 3300031548 Bacteria 1750
121 Ga0307408_100178357 3300031548 Bacteria 1702
122 Ga0307408_100186187 3300031548 Bacteria 1669
123 Ga0307408_100290668 3300031548 Bacteria 1365
124 Ga0307408_100667029 3300031548 Bacteria 931
125 Ga0307408_100728724 3300031548 Bacteria 894
126 Ga0307408_100807089 3300031548 Bacteria 852
127 Ga0307408_101609919 3300031548 Bacteria 617
128 Ga0307408_102200744 3300031548 Unclassified 533
129 Ga0307405_10623605 3300031731 Bacteria 883
130 Ga0307413_10182938 3300031824 Bacteria 1496
131 Ga0307413_11892374 3300031824 Unclassified 536
132 Ga0307410_10090269 3300031852 Bacteria 2173
133 Ga0307410_10310227 3300031852 Bacteria 1248
134 Ga0307410_10911947 3300031852 Bacteria 753
135 Ga0307406_10224741 3300031901 Bacteria 1398
136 Ga0307406_10666147 3300031901 Bacteria 865
137 Ga0307406_11805363 3300031901 Bacteria 544
138 Ga0307407_11382850 3300031903 Bacteria 554
139 Ga0307412_10030178 3300031911 Bacteria 3410
140 Ga0307412_10336838 3300031911 Bacteria 1206
141 Ga0307412_10415997 3300031911 Bacteria 1099
142 Ga0307412_10572531 3300031911 Bacteria 952
143 Ga0307412_10761707 3300031911 Bacteria 837
144 Ga0307409_100069364 3300031995 Bacteria 2793
145 Ga0307409_100189345 3300031995 Bacteria 1830
146 Ga0307409_100401196 3300031995 Bacteria 1310
147 Ga0307409_100481431 3300031995 Bacteria 1204
148 Ga0307409_100730532 3300031995 Bacteria 992
149 Ga0307416_100084409 3300032002 Bacteria 2699
150 Ga0307416_100165684 3300032002 Bacteria 2049
151 Ga0307416_100328714 3300032002 Bacteria 1535
152 Ga0307416_100339238 3300032002 Bacteria 1515
153 Ga0307416_100353588 3300032002 Bacteria 1488
154 Ga0307416_100497492 3300032002 Bacteria 1283
155 Ga0307416_101001815 3300032002 Bacteria 938
156 Ga0307416_101242615 3300032002 Bacteria 851
157 Ga0307416_101505738 3300032002 Bacteria 778
158 Ga0307414_10282194 3300032004 Bacteria 1396
159 Ga0307414_11608258 3300032004 Unclassified 606
160 Ga0307411_10005807 3300032005 Bacteria 6113
161 Ga0307411_10151806 3300032005 Bacteria 1722
162 Ga0307411_10224487 3300032005 Bacteria 1460
163 Ga0307411_10526947 3300032005 Bacteria 1004
164 Ga0307411_10611678 3300032005 Bacteria 938
165 Ga0307411_10644824 3300032005 Bacteria 916
166 Ga0307415_100129231 3300032126 Bacteria 1909
167 Ga0307415_100494017 3300032126 Bacteria 1068
168 Ga0307415_101286442 3300032126 Unclassified 692
169 Ga0307415_102248820 3300032126 Bacteria 534
170 Ga0439439_0015560 3300041406 Bacteria 1859
171 Ga0451802_0562273 3300041460 Bacteria 636
172 Ga0451853_0020255 3300041512 Bacteria 3063
173 Ga0439431_0097323 3300041997 Bacteria 806
174 Ga0439441_171257 3300042001 Unclassified 519
175 Ga0439449_0401303 3300042007 Unclassified 520
176 Ga0439457_085712 3300042014 Bacteria 726
177 Ga0450920_137561 3300042122 Unclassified 516
178 Ga0450923_161560 3300042125 Unclassified 546
179 Ga0450890_028283 3300042127 Unclassified 788
180 Ga0450910_022136 3300042147 Bacteria 965
181 Ga0439446_0073209 3300042156 Bacteria 1051
182 Ga0439446_0130553 3300042156 Bacteria 814
183 Ga0439446_0362716 3300042156 Bacteria 518
184 Ga0439434_0066296 3300042435 Bacteria 1133
185 Ga0439434_0080710 3300042435 Bacteria 1032
186 Ga0439434_0110849 3300042435 Unclassified 889
187 Ga0439435_0003772 3300042436 Bacteria 3191
188 Ga0439435_0031549 3300042436 Bacteria 1441
189 Ga0439435_0122186 3300042436 Unclassified 817
190 Ga0439435_0173884 3300042436 Bacteria 701
191 Ga0439435_0280887 3300042436 Bacteria 567
192 Ga0439460_0108943 3300042461 Bacteria 897
193 Ga0450918_075258 3300042531 Bacteria 638
194 Ga0439440_0005250 3300042993 Bacteria 2570
195 Ga0496106_1070219 3300048909 Archaea 633
196 Ga0501299_039505 3300049522 Bacteria 942
197 Ga0501031_0060186 3300049568 Bacteria 2475
198 Ga0501031_0119686 3300049568 Bacteria 1720
199 Ga0501032_0809939 3300049569 Unclassified 591
200 Ga0501033_0326804 3300049570 Bacteria 1077
201 Ga0501033_1053304 3300049570 Bacteria 542
202 Ga0501034_1603826 3300049571 Bacteria 524
203 Ga0501036_0028937 3300049572 Bacteria 4682
204 Ga0501036_0040204 3300049572 Bacteria 3955
205 Ga0501036_0233265 3300049572 Bacteria 1544
206 Ga0501036_0293626 3300049572 Bacteria 1360
207 Ga0501036_0496063 3300049572 Bacteria 1016
208 Ga0501036_1200913 3300049572 Unclassified 618
209 Ga0501036_1323213 3300049572 Unclassified 585
210 Ga0501037_0825118 3300049573 Unclassified 611
211 Ga0501038_0106530 3300049574 Bacteria 2327
212 Ga0501038_1045207 3300049574 Bacteria 598
213 Ga0501039_0004603 3300049575 Bacteria 10432
214 Ga0501039_1291321 3300049575 Unclassified 563
215 Ga0501040_0006564 3300049576 Bacteria 7555
216 Ga0501040_0240459 3300049576 Bacteria 1290
217 Ga0501041_0011795 3300049577 Bacteria 5174
218 Ga0501041_0014327 3300049577 Bacteria 4707
219 Ga0501041_0403503 3300049577 Bacteria 866
220 Ga0501042_0010011 3300049578 Bacteria 6340
221 Ga0501042_0347357 3300049578 Unclassified 1073
222 Ga0501042_1212466 3300049578 Unclassified 550
223 Ga0501043_0101074 3300049579 Bacteria 2266
224 Ga0501043_0261034 3300049579 Bacteria 1332
225 Ga0501046_0029010 3300049580 Bacteria 4503
226 Ga0501046_0108070 3300049580 Bacteria 2128
227 Ga0501046_0821066 3300049580 Bacteria 651
228 Ga0501048_0211019 3300049582 Bacteria 1377
229 Ga0501048_0223008 3300049582 Bacteria 1337
230 Ga0501048_0297042 3300049582 Bacteria 1149
231 Ga0501048_0697371 3300049582 Bacteria 729
232 Ga0501048_0788174 3300049582 Bacteria 683
233 Ga0501068_0189890 3300049584 Bacteria 1301
234 Ga0501068_0216779 3300049584 Bacteria 1216
235 Ga0501069_0206665 3300049585 Bacteria 1139
236 Ga0501069_0604729 3300049585 Bacteria 658
237 Ga0501070_0326805 3300049586 Bacteria 1247
238 Ga0501071_0008117 3300049587 Bacteria 6926
239 Ga0501071_0133686 3300049587 Bacteria 1844
240 Ga0501071_0174126 3300049587 Bacteria 1611
241 Ga0501071_0322903 3300049587 Bacteria 1172
242 Ga0501071_0372687 3300049587 Bacteria 1088
243 Ga0501071_0385950 3300049587 Bacteria 1068
244 Ga0501072_0034790 3300049588 Bacteria 3948
245 Ga0501072_0103598 3300049588 Bacteria 2262
246 Ga0501072_0119008 3300049588 Bacteria 2104
247 Ga0501072_0206973 3300049588 Bacteria 1564
248 Ga0501072_0256821 3300049588 Bacteria 1391
249 Ga0501072_0271494 3300049588 Bacteria 1349
250 Ga0501073_0018326 3300049589 Bacteria 5059
251 Ga0501074_0405211 3300049590 Bacteria 967
252 Ga0501074_0626182 3300049590 Bacteria 760
253 Ga0501075_0002082 3300049591 Bacteria 13218
254 Ga0501075_0411283 3300049591 Bacteria 1031
255 Ga0501075_0694526 3300049591 Unclassified 775
256 Ga0501075_1173082 3300049591 Bacteria 583
257 Ga0501075_1214179 3300049591 Bacteria 572
258 Ga0501076_0006948 3300049592 Bacteria 8226
259 Ga0501076_0038440 3300049592 Bacteria 3757
260 Ga0501076_0065021 3300049592 Bacteria 2908
261 Ga0501076_0163447 3300049592 Bacteria 1814
262 Ga0501076_1397640 3300049592 Bacteria 575
263 Ga0501077_0029471 3300049593 Bacteria 3489
264 Ga0501077_0115383 3300049593 Bacteria 1702
265 Ga0501077_1041548 3300049593 Unclassified 526
266 Ga0501217_254663 3300049661 Bacteria 567
267 Ga0501235_075698 3300049669 Bacteria 800
268 Ga0501235_161205 3300049669 Unclassified 587
269 Ga0501225_0301388 3300049705 Unclassified 542
270 Ga0501079_0041752 3300049741 Bacteria 3542
271 Ga0501079_0049206 3300049741 Bacteria 3253
272 Ga0501079_0159891 3300049741 Bacteria 1756
273 Ga0501079_0274432 3300049741 Bacteria 1318
274 Ga0501079_0365317 3300049741 Bacteria 1131
275 Ga0501079_1095985 3300049741 Bacteria 627
276 Ga0501079_1191512 3300049741 Bacteria 600
277 Ga0501080_0130474 3300049742 Bacteria 2327
278 Ga0501080_0148776 3300049742 Bacteria 2165
279 Ga0501081_0018031 3300049743 Bacteria 4685
280 Ga0501081_0139884 3300049743 Bacteria 1734
281 Ga0501081_0171441 3300049743 Bacteria 1567
282 Ga0501081_0438821 3300049743 Bacteria 969
283 Ga0501083_0290601 3300049744 Bacteria 1063
284 Ga0501083_1087449 3300049744 Unclassified 520
285 Ga0501263_041267 3300049760 Unclassified 679
286 Ga0501035_0089959 3300049822 Bacteria 2703
287 Ga0501035_0208550 3300049822 Bacteria 1673
288 Ga0501045_0005654 3300049824 Bacteria 8650
289 Ga0501045_0024935 3300049824 Bacteria 4296
290 Ga0501045_0185442 3300049824 Bacteria 1550
291 nmdc:mga05p37_1307353_c1 3300050507 Bacteria 739
292 nmdc:mga05p37_142532_c1 3300050507 Bacteria 2935
293 nmdc:mga05p37_1963046_c1 3300050507 Unclassified 556
294 nmdc:mga05p37_474_c1 3300050507 Bacteria 43786
295 nmdc:mga05p37_97255_c1 3300050507 Bacteria 3626
296 nmdc:mga05p37_991482_c1 3300050507 Bacteria 894
297 nmdc:mga09592_1016120_c1 3300050508 Bacteria 692
298 nmdc:mga09592_1220561_c1 3300050508 Unclassified 621
299 nmdc:mga09592_5776_c1 3300050508 Bacteria 10092
300 nmdc:mga09592_7008_c1 3300050508 Bacteria 9164
301 nmdc:mga0qj67_15248_c1 3300050509 Bacteria 5817
302 nmdc:mga0qj67_49138_c1 3300050509 Bacteria 3334
303 nmdc:mga0qj67_51878_c1 3300050509 Bacteria 3245
304 nmdc:mga0qj67_563735_c1 3300050509 Bacteria 913
305 nmdc:mga0qj67_5727_c1 3300050509 Bacteria 9091
306 nmdc:mga06r32_108136_c1 3300050510 Bacteria 2733
307 nmdc:mga06r32_13797_c1 3300050510 Bacteria 7329
308 nmdc:mga06r32_275275_c1 3300050510 Bacteria 1671
309 nmdc:mga06r32_4302_c1 3300050510 Bacteria 12747
310 nmdc:mga06r32_436088_c1 3300050510 Bacteria 1291
311 nmdc:mga06r32_4617_c1 3300050510 Bacteria 12347
312 nmdc:mga06r32_702331_c1 3300050510 Bacteria 977
313 nmdc:mga08y16_492305_c1 3300050511 Bacteria 1247
314 nmdc:mga08y16_71723_c1 3300050511 Bacteria 3609
315 nmdc:mga0n895_368028_c1 3300050512 Bacteria 1455
316 nmdc:mga0rr50_86539_c1 3300050513 Bacteria 2431
317 nmdc:mga0a205_92119_c1 3300050515 Bacteria 2929
318 Ga0501084_0036549 3300054114 Bacteria 4102
319 Ga0501084_0040115 3300054114 Bacteria 3916
320 Ga0501084_0135343 3300054114 Bacteria 2075
321 Ga0501084_0288776 3300054114 Bacteria 1385
322 Ga0590071_001353 3300059421 Bacteria 6508
323 Ga0590074_027506 3300059423 Unclassified 996
324 Ga0590075_001598 3300059424 Bacteria 5598
325 Ga0590077_001171 3300059426 Bacteria 6377
326 Ga0590077_014347 3300059426 Bacteria 1651
327 Ga0501082_0047612 3300060353 Bacteria 3695
328 Ga0501082_0157993 3300060353 Bacteria 1970
329 Ga0501082_0158268 3300060353 Bacteria 1968
330 Ga0501082_1048065 3300060353 Bacteria 713
331 Ga0530510_0000759 3300061734 Bacteria 20962
332 Ga0530510_0010218 3300061734 Bacteria 6575
333 Ga0530510_0211747 3300061734 Bacteria 1440
334 Ga0530510_0703299 3300061734 Unclassified 770
335 Ga0530510_1174353 3300061734 Bacteria 588
336 Ga0070693_101469556
337 MBSR1b_contig_9110000
338 JGI25406J46586_10000195
339 Ga0065712_10099435
340 Ga0065712_10117453
341 Ga0065712_10237377
342 Ga0065715_10124473
343 Ga0065715_10188702
344 Ga0065715_10248618
345 Ga0065715_10744466
346 Ga0065707_10546524
347 Ga0070658_10517964
348 Ga0070658_11881208
349 Ga0070670_100044995
350 Ga0068869_100056648
351 Ga0068869_100412177
352 Ga0070680_100543236
353 Ga0070680_101668311
354 Ga0070661_100278864
355 Ga0070668_100618304
356 Ga0070668_101075490
357 Ga0070675_100596364
358 Ga0070675_100896397
359 Ga0070674_100082380
360 Ga0070674_101940976
361 Ga0070673_100757723
362 Ga0070673_101487510
363 Ga0070688_100071247
364 Ga0070700_100302512
365 Ga0070700_101909489
366 Ga0070708_100107940
367 Ga0070678_100064561
368 Ga0070678_100236530
369 Ga0068867_100610729
370 Ga0068867_100736511
371 Ga0070707_100232032
372 Ga0070698_100009107
373 Ga0070699_101229655
374 Ga0070704_101277066
375 Ga0070704_102037773
376 Ga0070664_100442906
377 Ga0068857_100488773
378 Ga0068859_100242918
379 Ga0068864_100318693
380 Ga0068861_101877679
381 Ga0068863_102753156
382 Ga0068860_101327634
383 Ga0081539_10000096
384 Ga0097621_100067037
385 Ga0075428_100003208
386 Ga0075428_100025383
387 Ga0075428_100029134
388 Ga0075428_100278925
389 Ga0075428_101004763
390 Ga0075430_100007119
391 Ga0075430_100077497
392 Ga0075430_100134587
393 Ga0075430_100180774
394 Ga0075431_100003906
395 Ga0075431_100006081
396 Ga0075431_100018655
397 Ga0075431_100158102
398 Ga0075431_100307616
399 Ga0075431_101332959
400 Ga0075429_100009756
401 Ga0075429_100023007
402 Ga0075429_100137592
403 Ga0075429_100956509
404 Ga0075429_101346718
405 Ga0097620_100242904
406 Ga0111539_10080296
407 Ga0111539_10202915
408 Ga0111539_10494895
409 Ga0111539_11021757
410 Ga0111539_11933718
411 Ga0111539_12990020
412 Ga0114129_10000400
413 Ga0114129_10009548
414 Ga0114129_10124496
415 Ga0114129_10267077
416 Ga0114129_10284128
417 Ga0114129_10415941
418 Ga0114129_12510439
419 Ga0105248_10869154
420 Ga0163163_11190621
421 Ga0157380_10008432
422 Ga0157380_10165486
423 Ga0157380_10185253
424 Ga0157377_10996171
425 Ga0157376_11036225
426 Ga0157376_11236001
427 Ga0163161_10666663
428 Ga0207697_10263666
429 Ga0207682_10154125
430 Ga0207643_11036679
431 Ga0207660_11398220
432 Ga0207649_11136490
433 Ga0207646_10103773
434 Ga0207650_10051207
435 Ga0207659_10030745
436 Ga0207659_11669975
437 Ga0207669_10133896
438 Ga0207669_10917190
439 Ga0207691_10107495
440 Ga0207711_11573289
441 Ga0207689_10620598
442 Ga0207679_10511560
443 Ga0207679_12124526
444 Ga0207668_11126865
445 Ga0207708_10239022
446 Ga0207708_11430840
447 Ga0207648_10694871
448 Ga0207648_11112808
449 Ga0207675_100793587
450 Ga0207683_10088309
451 Ga0207683_10257285
452 Ga0209974_10184250
453 Ga0207428_10083088
454 Ga0207428_10996523
455 Ga0307408_100167737
456 Ga0307408_100178357
457 Ga0307408_100186187
458 Ga0307408_100290668
459 Ga0307408_100667029
460 Ga0307408_100728724
461 Ga0307408_100807089
462 Ga0307408_101609919
463 Ga0307408_102200744
464 Ga0307405_10623605
465 Ga0307413_10182938
466 Ga0307413_11892374
467 Ga0307410_10090269
468 Ga0307410_10310227
469 Ga0307410_10911947
470 Ga0307406_10224741
471 Ga0307406_10666147
472 Ga0307406_11805363
473 Ga0307407_11382850
474 Ga0307412_10030178
475 Ga0307412_10336838
476 Ga0307412_10415997
477 Ga0307412_10572531
478 Ga0307412_10761707
479 Ga0307409_100069364
480 Ga0307409_100189345
481 Ga0307409_100401196
482 Ga0307409_100481431
483 Ga0307409_100730532
484 Ga0307416_100084409
485 Ga0307416_100165684
486 Ga0307416_100328714
487 Ga0307416_100339238
488 Ga0307416_100353588
489 Ga0307416_100497492
490 Ga0307416_101001815
491 Ga0307416_101242615
492 Ga0307416_101505738
493 Ga0307414_10282194
494 Ga0307414_11608258
495 Ga0307411_10005807
496 Ga0307411_10151806
497 Ga0307411_10224487
498 Ga0307411_10526947
499 Ga0307411_10611678
500 Ga0307411_10644824
501 Ga0307415_100129231
502 Ga0307415_100494017
503 Ga0307415_101286442
504 Ga0307415_102248820
505 Ga0439439_0015560
506 Ga0451802_0562273
507 Ga0451853_0020255
508 Ga0439431_0097323
509 Ga0439441_171257
510 Ga0439449_0401303
511 Ga0439457_085712
512 Ga0450920_137561
513 Ga0450923_161560
514 Ga0450890_028283
515 Ga0450910_022136
516 Ga0439446_0073209
517 Ga0439446_0130553
518 Ga0439446_0362716
519 Ga0439434_0066296
520 Ga0439434_0080710
521 Ga0439434_0110849
522 Ga0439435_0003772
523 Ga0439435_0031549
524 Ga0439435_0122186
525 Ga0439435_0173884
526 Ga0439435_0280887
527 Ga0439460_0108943
528 Ga0450918_075258
529 Ga0439440_0005250
530 Ga0496106_1070219
531 Ga0501299_039505
532 Ga0501031_0060186
533 Ga0501031_0119686
534 Ga0501032_0809939
535 Ga0501033_0326804
536 Ga0501033_1053304
537 Ga0501034_1603826
538 Ga0501036_0028937
539 Ga0501036_0040204
540 Ga0501036_0233265
541 Ga0501036_0293626
542 Ga0501036_0496063
543 Ga0501036_1200913
544 Ga0501036_1323213
545 Ga0501037_0825118
546 Ga0501038_0106530
547 Ga0501038_1045207
548 Ga0501039_0004603
549 Ga0501039_1291321
550 Ga0501040_0006564
551 Ga0501040_0240459
552 Ga0501041_0011795
553 Ga0501041_0014327
554 Ga0501041_0403503
555 Ga0501042_0010011
556 Ga0501042_0347357
557 Ga0501042_1212466
558 Ga0501043_0101074
559 Ga0501043_0261034
560 Ga0501046_0029010
561 Ga0501046_0108070
562 Ga0501046_0821066
563 Ga0501048_0211019
564 Ga0501048_0223008
565 Ga0501048_0297042
566 Ga0501048_0697371
567 Ga0501048_0788174
568 Ga0501068_0189890
569 Ga0501068_0216779
570 Ga0501069_0206665
571 Ga0501069_0604729
572 Ga0501070_0326805
573 Ga0501071_0008117
574 Ga0501071_0133686
575 Ga0501071_0174126
576 Ga0501071_0322903
577 Ga0501071_0372687
578 Ga0501071_0385950
579 Ga0501072_0034790
580 Ga0501072_0103598
581 Ga0501072_0119008
582 Ga0501072_0206973
583 Ga0501072_0256821
584 Ga0501072_0271494
585 Ga0501073_0018326
586 Ga0501074_0405211
587 Ga0501074_0626182
588 Ga0501075_0002082
589 Ga0501075_0411283
590 Ga0501075_0694526
591 Ga0501075_1173082
592 Ga0501075_1214179
593 Ga0501076_0006948
594 Ga0501076_0038440
595 Ga0501076_0065021
596 Ga0501076_0163447
597 Ga0501076_1397640
598 Ga0501077_0029471
599 Ga0501077_0115383
600 Ga0501077_1041548
601 Ga0501217_254663
602 Ga0501235_075698
603 Ga0501235_161205
604 Ga0501225_0301388
605 Ga0501079_0041752
606 Ga0501079_0049206
607 Ga0501079_0159891
608 Ga0501079_0274432
609 Ga0501079_0365317
610 Ga0501079_1095985
611 Ga0501079_1191512
612 Ga0501080_0130474
613 Ga0501080_0148776
614 Ga0501081_0018031
615 Ga0501081_0139884
616 Ga0501081_0171441
617 Ga0501081_0438821
618 Ga0501083_0290601
619 Ga0501083_1087449
620 Ga0501263_041267
621 Ga0501035_0089959
622 Ga0501035_0208550
623 Ga0501045_0005654
624 Ga0501045_0024935
625 Ga0501045_0185442
626 nmdc:mga05p37_1307353_c1
627 nmdc:mga05p37_142532_c1
628 nmdc:mga05p37_1963046_c1
629 nmdc:mga05p37_474_c1
630 nmdc:mga05p37_97255_c1
631 nmdc:mga05p37_991482_c1
632 nmdc:mga09592_1016120_c1
633 nmdc:mga09592_1220561_c1
634 nmdc:mga09592_5776_c1
635 nmdc:mga09592_7008_c1
636 nmdc:mga0qj67_15248_c1
637 nmdc:mga0qj67_49138_c1
638 nmdc:mga0qj67_51878_c1
639 nmdc:mga0qj67_563735_c1
640 nmdc:mga0qj67_5727_c1
641 nmdc:mga06r32_108136_c1
642 nmdc:mga06r32_13797_c1
643 nmdc:mga06r32_275275_c1
644 nmdc:mga06r32_4302_c1
645 nmdc:mga06r32_436088_c1
646 nmdc:mga06r32_4617_c1
647 nmdc:mga06r32_702331_c1
648 nmdc:mga08y16_492305_c1
649 nmdc:mga08y16_71723_c1
650 nmdc:mga0n895_368028_c1
651 nmdc:mga0rr50_86539_c1
652 nmdc:mga0a205_92119_c1
653 Ga0501084_0036549
654 Ga0501084_0040115
655 Ga0501084_0135343
656 Ga0501084_0288776
657 Ga0590071_001353
658 Ga0590074_027506
659 Ga0590075_001598
660 Ga0590077_001171
661 Ga0590077_014347
662 Ga0501082_0047612
663 Ga0501082_0157993
664 Ga0501082_0158268
665 Ga0501082_1048065
666 Ga0530510_0000759
667 Ga0530510_0010218
668 Ga0530510_0211747
669 Ga0530510_0703299
670 Ga0530510_1174353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04972

BON

BON domain

29

96

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xmv-assembly1.cif.gz_A the crystal structure of neisseria gonorrhoeae dolp (ngo1985) 0.8731 33 99
6v4v-assembly1.cif.gz_A-2 the crystal structure of bona from acinetobacter baumannii 0.8436 34 103
3h7k-assembly1.cif.gz_A crystal structure of arabidopsis thaliana agmatine deiminase complexed with a covalently bound reaction intermediate 0.8109 57 98
4qq0-assembly1.cif.gz_A cdsd - the structural protein of the type iii secretion system of chlamydia trachomatis: c-terminal domain 0.8024 34 101
4alz-assembly1.cif.gz_A the yersinia t3ss basal body component yscd reveals a different structural periplasmatic domain organization to known homologue prgh 0.7962 35 101
ID Description Score Start End Superfamily
af_P0AFH8_137_201_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.973 37 100 3.30.1340.30
af_P64596_46_115_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.9715 33 100 3.30.1340.30
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.9714 37 100 3.30.1340.30
af_P64596_124_191_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9607 33 100 3.30.70.330
af_P0AFH8_137_201_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.9439 37 100 3.30.1340.30
ID Description Score Start End GO Terms
AF-A0A2N2TVK2-F1-model_v4 BON domain-containing protein 1.004 34 100 GO:0005509
AF-A0A3A0ESV5-F1-model_v4 BON domain-containing protein 1.002 34 99
AF-A0A1A9NKN4-F1-model_v4 BON domain-containing protein 1.001 34 100
AF-A0A2N2MAM6-F1-model_v4 BON domain-containing protein 1.001 34 99
AF-K9DFP9-F1-model_v4 BON domain-containing protein 1 34 100

Map