F412093

General Info

Members Datasets Scaffolds Average Seq Length
335 206 670 168

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100121111|Ga0070680_1001211112
Length 200
Sequence MSEPSAIIQMKVCMLGAYAVGKTSLVARFVKSIFSEKYHTTIGVKVDKKTVRIGEQDVSMILWDLAGEDDFYQVRMSYLRGSAGYLLVADGMRRQTLDKAFELQQRTEKEIGKAPFILVINKLDQVGQWEIKDTDLNQFSSSGWEVVSTSAKTGIGVEQTFLALGKRLMGIDEGTITRPMAEVDPEHDASPDQDAGKGKW

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 27.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100121111 3300005336 Bacteria 2184
2 JGI26145J50221_1008789 3300003371 Bacteria 871
3 Ga0065707_10256963 3300005295 Bacteria 1108
4 Ga0070676_10381383 3300005328 Bacteria 976
5 Ga0070676_11274874 3300005328 Unclassified 560
6 Ga0070683_100655670 3300005329 Unclassified 1005
7 Ga0070670_100019213 3300005331 Bacteria 5859
8 Ga0068869_100283783 3300005334 Bacteria 1332
9 Ga0068869_100721105 3300005334 Unclassified 852
10 Ga0070682_100314516 3300005337 Bacteria 1154
11 Ga0068868_100221728 3300005338 Bacteria 1583
12 Ga0070660_100073358 3300005339 Bacteria 2676
13 Ga0070689_100190407 3300005340 Bacteria 1670
14 Ga0070687_100060058 3300005343 Bacteria 2004
15 Ga0070687_100084788 3300005343 Bacteria 1737
16 Ga0070661_100049152 3300005344 Bacteria 3088
17 Ga0070692_10054810 3300005345 Bacteria 2083
18 Ga0070669_100013817 3300005353 Bacteria 5739
19 Ga0070669_100371288 3300005353 Bacteria 1165
20 Ga0070688_100916729 3300005365 Unclassified 692
21 Ga0070659_100017356 3300005366 Bacteria 5414
22 Ga0070710_10047318 3300005437 Bacteria 2398
23 Ga0070711_100004850 3300005439 Bacteria 7983
24 Ga0070705_100525432 3300005440 Bacteria 903
25 Ga0070694_100043738 3300005444 Unclassified 2996
26 Ga0070694_100079296 3300005444 Bacteria 2279
27 Ga0070708_100052409 3300005445 Bacteria 3618
28 Ga0070708_100489820 3300005445 Unclassified 1160
29 Ga0070662_100300015 3300005457 Bacteria 1305
30 Ga0070662_100301839 3300005457 Bacteria 1301
31 Ga0070662_100456398 3300005457 Unclassified 1061
32 Ga0070681_10025584 3300005458 Bacteria 5937
33 Ga0070706_100006426 3300005467 Bacteria 11103
34 Ga0070706_100014409 3300005467 Bacteria 7306
35 Ga0070706_100231289 3300005467 Bacteria 1726
36 Ga0070706_101100662 3300005467 Unclassified 731
37 Ga0070707_100196183 3300005468 Bacteria 1968
38 Ga0070707_100370551 3300005468 Bacteria 1391
39 Ga0070707_100991190 3300005468 Bacteria 805
40 Ga0070707_101260019 3300005468 Bacteria 706
41 Ga0070698_100069047 3300005471 Bacteria 3549
42 Ga0070698_100184222 3300005471 Bacteria 2026
43 Ga0070679_100129517 3300005530 Bacteria 2505
44 Ga0070684_100045677 3300005535 Bacteria 3793
45 Ga0070684_100075023 3300005535 Bacteria 2982
46 Ga0070697_100003346 3300005536 Bacteria 12314
47 Ga0070697_100024017 3300005536 Unclassified 4852
48 Ga0070695_100058469 3300005545 Bacteria 2493
49 Ga0070695_100649039 3300005545 Bacteria 833
50 Ga0070696_100121897 3300005546 Bacteria 1888
51 Ga0070696_100507106 3300005546 Bacteria 961
52 Ga0070696_101036720 3300005546 Bacteria 687
53 Ga0070693_100167451 3300005547 Unclassified 1405
54 Ga0070665_100309810 3300005548 Bacteria 1582
55 Ga0070704_100021318 3300005549 Bacteria 4199
56 Ga0070704_100111948 3300005549 Unclassified 2079
57 Ga0070704_100261866 3300005549 Bacteria 1425
58 Ga0070664_100322288 3300005564 Bacteria 1400
59 Ga0070664_101276255 3300005564 Unclassified 693
60 Ga0068857_100001675 3300005577 Bacteria 17807
61 Ga0068857_100467908 3300005577 Bacteria 1180
62 Ga0068857_100764537 3300005577 Bacteria 921
63 Ga0068854_100474082 3300005578 Bacteria 1050
64 Ga0068859_100336394 3300005617 Bacteria 1604
65 Ga0068859_100439216 3300005617 Bacteria 1401
66 Ga0068864_100006567 3300005618 Bacteria 9526
67 Ga0068864_100016731 3300005618 Bacteria 6111
68 Ga0068864_100103056 3300005618 Bacteria 2533
69 Ga0068858_100248203 3300005842 Bacteria 1690
70 Ga0068858_100456940 3300005842 Bacteria 1231
71 Ga0068858_101002512 3300005842 Bacteria 818
72 Ga0068860_100346020 3300005843 Bacteria 1462
73 Ga0068860_100464792 3300005843 Unclassified 1259
74 Ga0068860_100471790 3300005843 Unclassified 1250
75 Ga0068860_101080384 3300005843 Unclassified 821
76 Ga0068862_100036101 3300005844 Unclassified 4188
77 Ga0068862_100353503 3300005844 Bacteria 1364
78 Ga0068862_100953453 3300005844 Unclassified 846
79 Ga0081455_10111826 3300005937 Bacteria 2169
80 Ga0070715_10048796 3300006163 Bacteria 1811
81 Ga0070716_100028899 3300006173 Unclassified 2992
82 Ga0070712_100044732 3300006175 Unclassified 3054
83 Ga0075428_100136323 3300006844 Bacteria 2669
84 Ga0075431_100057385 3300006847 Bacteria 4016
85 Ga0075431_100070923 3300006847 Bacteria 3594
86 Ga0075431_100332678 3300006847 Unclassified 1529
87 Ga0075431_100627568 3300006847 Bacteria 1057
88 Ga0075433_10001052 3300006852 Bacteria 19767
89 Ga0075433_10019802 3300006852 Bacteria 5615
90 Ga0075434_100024561 3300006871 Bacteria 5892
91 Ga0075429_100959042 3300006880 Bacteria 748
92 Ga0097620_100336384 3300006931 Bacteria 1604
93 Ga0097620_100439177 3300006931 Bacteria 1401
94 Ga0075435_100230911 3300007076 Bacteria 1572
95 Ga0111539_10001037 3300009094 Bacteria 36456
96 Ga0111539_10055820 3300009094 Bacteria 4696
97 Ga0111539_11376254 3300009094 Bacteria 819
98 Ga0114129_10010243 3300009147 Bacteria 13374
99 Ga0114129_10017405 3300009147 Bacteria 10237
100 Ga0114129_10999584 3300009147 Bacteria 1053
101 Ga0114129_11442261 3300009147 Unclassified 848
102 Ga0105243_11466636 3300009148 Bacteria 705
103 Ga0105242_10502289 3300009176 Bacteria 1154
104 Ga0105242_12301797 3300009176 Unclassified 585
105 Ga0105249_10142897 3300009553 Bacteria 2296
106 Ga0105249_10234065 3300009553 Bacteria 1813
107 Ga0105249_10455176 3300009553 Bacteria 1319
108 Ga0105246_10308856 3300011119 Bacteria 1280
109 Ga0105246_10499953 3300011119 Bacteria 1032
110 Ga0157373_10018552 3300013100 Bacteria 5064
111 Ga0157371_10858059 3300013102 Bacteria 687
112 Ga0157374_10793528 3300013296 Unclassified 963
113 Ga0157378_10250597 3300013297 Bacteria 1695
114 Ga0157378_10368578 3300013297 Bacteria 1407
115 Ga0163162_10121240 3300013306 Unclassified 2719
116 Ga0163162_10334641 3300013306 Bacteria 1646
117 Ga0157372_10033068 3300013307 Bacteria 5677
118 Ga0157375_10036632 3300013308 Unclassified 4695
119 Ga0157375_11382574 3300013308 Bacteria 829
120 Ga0157375_11943658 3300013308 Unclassified 699
121 Ga0163163_10022509 3300014325 Bacteria 5969
122 Ga0163163_10038167 3300014325 Unclassified 4678
123 Ga0163163_10086709 3300014325 Bacteria 3140
124 Ga0163163_10205326 3300014325 Unclassified 2019
125 Ga0157380_10136822 3300014326 Bacteria 2098
126 Ga0157380_10237471 3300014326 Bacteria 1641
127 Ga0157377_10048319 3300014745 Unclassified 2387
128 Ga0163161_11126739 3300017792 Bacteria 675
129 Ga0213876_10002450 3300021384 Bacteria 10894
130 Ga0213876_10410229 3300021384 Bacteria 721
131 Ga0228598_1001115 3300024227 Bacteria 5930
132 Ga0228598_1060242 3300024227 Unclassified 756
133 Ga0207692_10079696 3300025898 Bacteria 1748
134 Ga0207685_10001458 3300025905 Bacteria 4972
135 Ga0207684_10021913 3300025910 Bacteria 5455
136 Ga0207684_10057987 3300025910 Unclassified 3286
137 Ga0207684_10207539 3300025910 Bacteria 1690
138 Ga0207707_10061285 3300025912 Bacteria 3273
139 Ga0207663_10007415 3300025916 Bacteria 5685
140 Ga0207663_10074658 3300025916 Unclassified 2198
141 Ga0207657_10049135 3300025919 Bacteria 3678
142 Ga0207652_10167473 3300025921 Bacteria 1971
143 Ga0207646_10310406 3300025922 Bacteria 1425
144 Ga0207646_10989780 3300025922 Unclassified 743
145 Ga0207681_10376903 3300025923 Bacteria 1141
146 Ga0207650_10197029 3300025925 Bacteria 1612
147 Ga0207659_10008640 3300025926 Bacteria 6336
148 Ga0207706_10092936 3300025933 Bacteria 2653
149 Ga0207686_10373965 3300025934 Bacteria 1079
150 Ga0207670_10043103 3300025936 Bacteria 2978
151 Ga0207670_10316882 3300025936 Bacteria 1226
152 Ga0207665_10084339 3300025939 Bacteria 2193
153 Ga0207689_10358915 3300025942 Bacteria 1212
154 Ga0207661_10599316 3300025944 Bacteria 1011
155 Ga0207667_10348953 3300025949 Unclassified 1509
156 Ga0207712_10246468 3300025961 Bacteria 1442
157 Ga0207712_10838364 3300025961 Bacteria 810
158 Ga0207677_10323695 3300026023 Bacteria 1282
159 Ga0207703_10188022 3300026035 Bacteria 1827
160 Ga0207676_10010429 3300026095 Bacteria 6616
161 Ga0207676_10120731 3300026095 Bacteria 2210
162 Ga0207676_10235244 3300026095 Bacteria 1640
163 Ga0207676_10783180 3300026095 Unclassified 929
164 Ga0207674_10001760 3300026116 Bacteria 27687
165 Ga0207674_10055698 3300026116 Unclassified 4019
166 Ga0209981_1014503 3300027378 Bacteria 1100
167 Ga0209996_1014292 3300027395 Bacteria 1077
168 Ga0210000_1016799 3300027462 Bacteria 1107
169 Ga0209968_1068256 3300027526 Unclassified 632
170 Ga0209999_1009727 3300027543 Bacteria 1735
171 Ga0209970_1000263 3300027614 Bacteria 8645
172 Ga0210002_1011779 3300027617 Bacteria 1354
173 Ga0209983_1000075 3300027665 Bacteria 15593
174 Ga0209971_1000122 3300027682 Bacteria 23095
175 Ga0209971_1114213 3300027682 Bacteria 663
176 Ga0209966_1018225 3300027695 Bacteria 1343
177 Ga0209998_10010035 3300027717 Bacteria 1962
178 Ga0209974_10000270 3300027876 Bacteria 16820
179 Ga0209974_10162577 3300027876 Bacteria 810
180 Ga0268265_10351344 3300028380 Unclassified 1346
181 Ga0268265_10592551 3300028380 Bacteria 1058
182 Ga0268265_10763803 3300028380 Unclassified 939
183 Ga0268264_10095059 3300028381 Unclassified 2578
184 Ga0265762_1004948 3300030760 Unclassified 2385
185 Ga0265760_10023731 3300031090 Bacteria 1783
186 Ga0265330_10051741 3300031235 Bacteria 1800
187 Ga0265332_10024373 3300031238 Bacteria 2662
188 Ga0265325_10010151 3300031241 Bacteria 5465
189 Ga0265325_10102696 3300031241 Bacteria 1398
190 Ga0265340_10001213 3300031247 Bacteria 14770
191 Ga0265339_10080427 3300031249 Bacteria 1723
192 Ga0265331_10013048 3300031250 Bacteria 4477
193 Ga0265327_10060438 3300031251 Bacteria 1937
194 Ga0265316_10020814 3300031344 Bacteria 5571
195 Ga0265316_10581872 3300031344 Unclassified 795
196 Ga0265313_10006849 3300031595 Bacteria 7948
197 Ga0265314_10057454 3300031711 Bacteria 2671
198 Ga0265342_10216231 3300031712 Bacteria 1034
199 Ga0316576_10195122 3300031727 Bacteria 1526
200 Ga0316578_10480798 3300031728 Bacteria 733
201 Ga0307414_10190280 3300032004 Unclassified 1660
202 Ga0307411_10091406 3300032005 Bacteria 2126
203 Ga0307415_100433177 3300032126 Bacteria 1132
204 Ga0316593_10063914 3300032168 Bacteria 1263
205 Ga0316212_1004742 3300033547 Unclassified 1971
206 Ga0373934_0010516 3300035086 Unclassified 3474
207 Ga0373923_0061965 3300035111 Unclassified 1590
208 Ga0373953_0006676 3300035117 Unclassified 3818
209 Ga0373954_0002775 3300035118 Bacteria 7376
210 Ga0373957_0016336 3300035120 Unclassified 2568
211 Ga0373955_0058034 3300035172 Unclassified 2128
212 Ga0316574_0374546 3300035398 Unclassified 899
213 Ga0373933_0000273 3300035724 Bacteria 33651
214 Ga0373937_0000806 3300036401 Bacteria 26844
215 Ga0373937_0234086 3300036401 Bacteria 1730
216 Ga0373937_0511094 3300036401 Unclassified 1141
217 Ga0373937_0560053 3300036401 Unclassified 1086
218 Ga0316584_0247399 3300036712 Unclassified 1303
219 Ga0395899_0005075 3300037312 Bacteria 10244
220 Ga0395899_0169249 3300037312 Bacteria 1539
221 Ga0395900_0021772 3300037418 Bacteria 6554
222 Ga0395900_0279118 3300037418 Bacteria 1663
223 Ga0395898_0020932 3300037466 Bacteria 6638
224 Ga0436364_1043089 3300037853 Unclassified 1388
225 Ga0395901_0000429 3300038443 Bacteria 49524
226 Ga0395901_0125036 3300038443 Bacteria 2702
227 Ga0400483_239411 3300039062 Bacteria 1593
228 Ga0400483_240150 3300039062 Bacteria 2038
229 Ga0436365_1413413 3300039437 Bacteria 1032
230 Ga0436365_1418787 3300039437 Bacteria 51993
231 Ga0436360_1209727 3300039438 Unclassified 1358
232 Ga0439433_0010384 3300041999 Unclassified 2034
233 Ga0450896_004696 3300042133 Unclassified 1855
234 Ga0439435_0005182 3300042436 Bacteria 2855
235 Ga0439460_0035901 3300042461 Unclassified 1435
236 Ga0451577_0418400 3300042876 Bacteria 1217
237 Ga0451577_1155317 3300042876 Bacteria 691
238 Ga0453684_0002884 3300044712 Bacteria 40335
239 Ga0495592_0146852 3300046454 Unclassified 1634
240 Ga0495651_0057368 3300046462 Unclassified 2989
241 Ga0495580_0075313 3300046472 Unclassified 2355
242 Ga0495580_0376047 3300046472 Unclassified 960
243 Ga0495580_0651658 3300046472 Unclassified 692
244 Ga0495664_0640575 3300046477 Bacteria 630
245 Ga0495608_0006398 3300046511 Bacteria 8363
246 Ga0495618_0097280 3300046514 Bacteria 1883
247 Ga0495618_0493481 3300046514 Unclassified 739
248 Ga0495628_0000023 3300046516 Bacteria 131565
249 Ga0495628_0277331 3300046516 Bacteria 1246
250 Ga0495665_0139638 3300046531 Bacteria 1267
251 Ga0495640_0190032 3300046533 Unclassified 1306
252 Ga0495587_0002364 3300046536 Bacteria 12597
253 Ga0495657_0036954 3300046675 Unclassified 3370
254 Ga0495623_0070225 3300046679 Unclassified 2182
255 Ga0495623_0115902 3300046679 Bacteria 1619
256 Ga0495646_0385628 3300046680 Bacteria 730
257 Ga0495600_0423854 3300046809 Bacteria 826
258 Ga0495604_0002196 3300047317 Bacteria 15633
259 Ga0495604_0095280 3300047317 Bacteria 2199
260 Ga0495604_0110862 3300047317 Bacteria 2001
261 Ga0495674_0613127 3300047319 Bacteria 861
262 Ga0495684_0004486 3300047471 Bacteria 10903
263 Ga0495684_0006036 3300047471 Bacteria 9419
264 Ga0495684_0035090 3300047471 Unclassified 3848
265 Ga0495684_0230672 3300047471 Unclassified 1354
266 Ga0495602_0001369 3300048088 Bacteria 24062
267 Ga0495602_0085034 3300048088 Bacteria 2645
268 Ga0496102_0028350 3300048905 Bacteria 5000
269 Ga0496104_1392249 3300048907 Unclassified 604
270 Ga0501032_0343541 3300049569 Unclassified 962
271 Ga0501033_0292168 3300049570 Unclassified 1149
272 Ga0501036_0386325 3300049572 Bacteria 1168
273 Ga0501038_0376438 3300049574 Bacteria 1102
274 Ga0501040_0038097 3300049576 Unclassified 3268
275 Ga0501040_0259638 3300049576 Bacteria 1240
276 Ga0501041_0009864 3300049577 Bacteria 5622
277 Ga0501041_0064087 3300049577 Bacteria 2251
278 Ga0501046_0057841 3300049580 Unclassified 3041
279 Ga0501048_0011991 3300049582 Bacteria 6460
280 Ga0501048_0211985 3300049582 Unclassified 1374
281 Ga0501048_0407020 3300049582 Bacteria 973
282 Ga0501068_0198488 3300049584 Bacteria 1272
283 Ga0501068_0347008 3300049584 Bacteria 954
284 Ga0501071_0012184 3300049587 Bacteria 5820
285 Ga0501071_0566558 3300049587 Unclassified 873
286 Ga0501071_0909838 3300049587 Unclassified 679
287 Ga0501072_0016731 3300049588 Bacteria 5634
288 Ga0501072_0197740 3300049588 Bacteria 1603
289 Ga0501072_0466292 3300049588 Bacteria 1000
290 Ga0501075_0002611 3300049591 Bacteria 12033
291 Ga0501075_0149998 3300049591 Bacteria 1777
292 Ga0501075_0178618 3300049591 Bacteria 1620
293 Ga0501076_0002613 3300049592 Bacteria 12403
294 Ga0501077_0632133 3300049593 Bacteria 688
295 Ga0501079_0005490 3300049741 Bacteria 9449
296 Ga0501079_0089267 3300049741 Unclassified 2387
297 Ga0501079_0227016 3300049741 Bacteria 1459
298 Ga0501079_0397481 3300049741 Unclassified 1081
299 Ga0501079_0864066 3300049741 Unclassified 712
300 Ga0501080_0039825 3300049742 Unclassified 4385
301 Ga0501080_0374002 3300049742 Bacteria 1284
302 Ga0501080_0659507 3300049742 Bacteria 925
303 Ga0501081_0038231 3300049743 Unclassified 3277
304 Ga0501081_0047167 3300049743 Bacteria 2964
305 Ga0501081_0135506 3300049743 Bacteria 1763
306 Ga0501081_0740026 3300049743 Unclassified 739
307 Ga0501083_0108060 3300049744 Bacteria 1830
308 Ga0501035_0076715 3300049822 Bacteria 2955
309 Ga0501044_0674653 3300049823 Unclassified 921
310 Ga0501045_0006245 3300049824 Bacteria 8244
311 Ga0501045_0035243 3300049824 Unclassified 3633
312 Ga0501045_0100553 3300049824 Bacteria 2140
313 nmdc:mga05p37_195776_c1 3300050507 Unclassified 2451
314 nmdc:mga05p37_31387_c1 3300050507 Bacteria 6488
315 nmdc:mga05p37_735203_c1 3300050507 Bacteria 1090
316 nmdc:mga05p37_953746_c1 3300050507 Bacteria 918
317 nmdc:mga09592_1120169_c1 3300050508 Bacteria 653
318 nmdc:mga0qj67_55358_c1 3300050509 Unclassified 3142
319 nmdc:mga06r32_394362_c1 3300050510 Unclassified 1366
320 nmdc:mga06r32_946448_c1 3300050510 Unclassified 816
321 nmdc:mga08y16_1131214_c1 3300050511 Bacteria 757
322 nmdc:mga08y16_379599_c1 3300050511 Bacteria 1449
323 nmdc:mga08y16_8921_c1 3300050511 Bacteria 10529
324 nmdc:mga0n895_10655_c1 3300050512 Bacteria 8139
325 nmdc:mga0n895_321016_c1 3300050512 Unclassified 1569
326 nmdc:mga0a205_1499_c1 3300050515 Bacteria 19908
327 nmdc:mga0a205_372957_c1 3300050515 Bacteria 1293
328 Ga0495619_0017690 3300053085 Unclassified 4516
329 Ga0501084_0030434 3300054114 Bacteria 4514
330 Ga0501084_0195677 3300054114 Bacteria 1706
331 Ga0501084_0363767 3300054114 Unclassified 1223
332 Ga0501082_0011778 3300060353 Bacteria 7519
333 Ga0530510_0004866 3300061734 Bacteria 9299
334 Ga0530510_0193991 3300061734 Bacteria 1508
335 Ga0530510_0517911 3300061734 Bacteria 905
336 Ga0070680_100121111
337 JGI26145J50221_1008789
338 Ga0065707_10256963
339 Ga0070676_10381383
340 Ga0070676_11274874
341 Ga0070683_100655670
342 Ga0070670_100019213
343 Ga0068869_100283783
344 Ga0068869_100721105
345 Ga0070682_100314516
346 Ga0068868_100221728
347 Ga0070660_100073358
348 Ga0070689_100190407
349 Ga0070687_100060058
350 Ga0070687_100084788
351 Ga0070661_100049152
352 Ga0070692_10054810
353 Ga0070669_100013817
354 Ga0070669_100371288
355 Ga0070688_100916729
356 Ga0070659_100017356
357 Ga0070710_10047318
358 Ga0070711_100004850
359 Ga0070705_100525432
360 Ga0070694_100043738
361 Ga0070694_100079296
362 Ga0070708_100052409
363 Ga0070708_100489820
364 Ga0070662_100300015
365 Ga0070662_100301839
366 Ga0070662_100456398
367 Ga0070681_10025584
368 Ga0070706_100006426
369 Ga0070706_100014409
370 Ga0070706_100231289
371 Ga0070706_101100662
372 Ga0070707_100196183
373 Ga0070707_100370551
374 Ga0070707_100991190
375 Ga0070707_101260019
376 Ga0070698_100069047
377 Ga0070698_100184222
378 Ga0070679_100129517
379 Ga0070684_100045677
380 Ga0070684_100075023
381 Ga0070697_100003346
382 Ga0070697_100024017
383 Ga0070695_100058469
384 Ga0070695_100649039
385 Ga0070696_100121897
386 Ga0070696_100507106
387 Ga0070696_101036720
388 Ga0070693_100167451
389 Ga0070665_100309810
390 Ga0070704_100021318
391 Ga0070704_100111948
392 Ga0070704_100261866
393 Ga0070664_100322288
394 Ga0070664_101276255
395 Ga0068857_100001675
396 Ga0068857_100467908
397 Ga0068857_100764537
398 Ga0068854_100474082
399 Ga0068859_100336394
400 Ga0068859_100439216
401 Ga0068864_100006567
402 Ga0068864_100016731
403 Ga0068864_100103056
404 Ga0068858_100248203
405 Ga0068858_100456940
406 Ga0068858_101002512
407 Ga0068860_100346020
408 Ga0068860_100464792
409 Ga0068860_100471790
410 Ga0068860_101080384
411 Ga0068862_100036101
412 Ga0068862_100353503
413 Ga0068862_100953453
414 Ga0081455_10111826
415 Ga0070715_10048796
416 Ga0070716_100028899
417 Ga0070712_100044732
418 Ga0075428_100136323
419 Ga0075431_100057385
420 Ga0075431_100070923
421 Ga0075431_100332678
422 Ga0075431_100627568
423 Ga0075433_10001052
424 Ga0075433_10019802
425 Ga0075434_100024561
426 Ga0075429_100959042
427 Ga0097620_100336384
428 Ga0097620_100439177
429 Ga0075435_100230911
430 Ga0111539_10001037
431 Ga0111539_10055820
432 Ga0111539_11376254
433 Ga0114129_10010243
434 Ga0114129_10017405
435 Ga0114129_10999584
436 Ga0114129_11442261
437 Ga0105243_11466636
438 Ga0105242_10502289
439 Ga0105242_12301797
440 Ga0105249_10142897
441 Ga0105249_10234065
442 Ga0105249_10455176
443 Ga0105246_10308856
444 Ga0105246_10499953
445 Ga0157373_10018552
446 Ga0157371_10858059
447 Ga0157374_10793528
448 Ga0157378_10250597
449 Ga0157378_10368578
450 Ga0163162_10121240
451 Ga0163162_10334641
452 Ga0157372_10033068
453 Ga0157375_10036632
454 Ga0157375_11382574
455 Ga0157375_11943658
456 Ga0163163_10022509
457 Ga0163163_10038167
458 Ga0163163_10086709
459 Ga0163163_10205326
460 Ga0157380_10136822
461 Ga0157380_10237471
462 Ga0157377_10048319
463 Ga0163161_11126739
464 Ga0213876_10002450
465 Ga0213876_10410229
466 Ga0228598_1001115
467 Ga0228598_1060242
468 Ga0207692_10079696
469 Ga0207685_10001458
470 Ga0207684_10021913
471 Ga0207684_10057987
472 Ga0207684_10207539
473 Ga0207707_10061285
474 Ga0207663_10007415
475 Ga0207663_10074658
476 Ga0207657_10049135
477 Ga0207652_10167473
478 Ga0207646_10310406
479 Ga0207646_10989780
480 Ga0207681_10376903
481 Ga0207650_10197029
482 Ga0207659_10008640
483 Ga0207706_10092936
484 Ga0207686_10373965
485 Ga0207670_10043103
486 Ga0207670_10316882
487 Ga0207665_10084339
488 Ga0207689_10358915
489 Ga0207661_10599316
490 Ga0207667_10348953
491 Ga0207712_10246468
492 Ga0207712_10838364
493 Ga0207677_10323695
494 Ga0207703_10188022
495 Ga0207676_10010429
496 Ga0207676_10120731
497 Ga0207676_10235244
498 Ga0207676_10783180
499 Ga0207674_10001760
500 Ga0207674_10055698
501 Ga0209981_1014503
502 Ga0209996_1014292
503 Ga0210000_1016799
504 Ga0209968_1068256
505 Ga0209999_1009727
506 Ga0209970_1000263
507 Ga0210002_1011779
508 Ga0209983_1000075
509 Ga0209971_1000122
510 Ga0209971_1114213
511 Ga0209966_1018225
512 Ga0209998_10010035
513 Ga0209974_10000270
514 Ga0209974_10162577
515 Ga0268265_10351344
516 Ga0268265_10592551
517 Ga0268265_10763803
518 Ga0268264_10095059
519 Ga0265762_1004948
520 Ga0265760_10023731
521 Ga0265330_10051741
522 Ga0265332_10024373
523 Ga0265325_10010151
524 Ga0265325_10102696
525 Ga0265340_10001213
526 Ga0265339_10080427
527 Ga0265331_10013048
528 Ga0265327_10060438
529 Ga0265316_10020814
530 Ga0265316_10581872
531 Ga0265313_10006849
532 Ga0265314_10057454
533 Ga0265342_10216231
534 Ga0316576_10195122
535 Ga0316578_10480798
536 Ga0307414_10190280
537 Ga0307411_10091406
538 Ga0307415_100433177
539 Ga0316593_10063914
540 Ga0316212_1004742
541 Ga0373934_0010516
542 Ga0373923_0061965
543 Ga0373953_0006676
544 Ga0373954_0002775
545 Ga0373957_0016336
546 Ga0373955_0058034
547 Ga0316574_0374546
548 Ga0373933_0000273
549 Ga0373937_0000806
550 Ga0373937_0234086
551 Ga0373937_0511094
552 Ga0373937_0560053
553 Ga0316584_0247399
554 Ga0395899_0005075
555 Ga0395899_0169249
556 Ga0395900_0021772
557 Ga0395900_0279118
558 Ga0395898_0020932
559 Ga0436364_1043089
560 Ga0395901_0000429
561 Ga0395901_0125036
562 Ga0400483_239411
563 Ga0400483_240150
564 Ga0436365_1413413
565 Ga0436365_1418787
566 Ga0436360_1209727
567 Ga0439433_0010384
568 Ga0450896_004696
569 Ga0439435_0005182
570 Ga0439460_0035901
571 Ga0451577_0418400
572 Ga0451577_1155317
573 Ga0453684_0002884
574 Ga0495592_0146852
575 Ga0495651_0057368
576 Ga0495580_0075313
577 Ga0495580_0376047
578 Ga0495580_0651658
579 Ga0495664_0640575
580 Ga0495608_0006398
581 Ga0495618_0097280
582 Ga0495618_0493481
583 Ga0495628_0000023
584 Ga0495628_0277331
585 Ga0495665_0139638
586 Ga0495640_0190032
587 Ga0495587_0002364
588 Ga0495657_0036954
589 Ga0495623_0070225
590 Ga0495623_0115902
591 Ga0495646_0385628
592 Ga0495600_0423854
593 Ga0495604_0002196
594 Ga0495604_0095280
595 Ga0495604_0110862
596 Ga0495674_0613127
597 Ga0495684_0004486
598 Ga0495684_0006036
599 Ga0495684_0035090
600 Ga0495684_0230672
601 Ga0495602_0001369
602 Ga0495602_0085034
603 Ga0496102_0028350
604 Ga0496104_1392249
605 Ga0501032_0343541
606 Ga0501033_0292168
607 Ga0501036_0386325
608 Ga0501038_0376438
609 Ga0501040_0038097
610 Ga0501040_0259638
611 Ga0501041_0009864
612 Ga0501041_0064087
613 Ga0501046_0057841
614 Ga0501048_0011991
615 Ga0501048_0211985
616 Ga0501048_0407020
617 Ga0501068_0198488
618 Ga0501068_0347008
619 Ga0501071_0012184
620 Ga0501071_0566558
621 Ga0501071_0909838
622 Ga0501072_0016731
623 Ga0501072_0197740
624 Ga0501072_0466292
625 Ga0501075_0002611
626 Ga0501075_0149998
627 Ga0501075_0178618
628 Ga0501076_0002613
629 Ga0501077_0632133
630 Ga0501079_0005490
631 Ga0501079_0089267
632 Ga0501079_0227016
633 Ga0501079_0397481
634 Ga0501079_0864066
635 Ga0501080_0039825
636 Ga0501080_0374002
637 Ga0501080_0659507
638 Ga0501081_0038231
639 Ga0501081_0047167
640 Ga0501081_0135506
641 Ga0501081_0740026
642 Ga0501083_0108060
643 Ga0501035_0076715
644 Ga0501044_0674653
645 Ga0501045_0006245
646 Ga0501045_0035243
647 Ga0501045_0100553
648 nmdc:mga05p37_195776_c1
649 nmdc:mga05p37_31387_c1
650 nmdc:mga05p37_735203_c1
651 nmdc:mga05p37_953746_c1
652 nmdc:mga09592_1120169_c1
653 nmdc:mga0qj67_55358_c1
654 nmdc:mga06r32_394362_c1
655 nmdc:mga06r32_946448_c1
656 nmdc:mga08y16_1131214_c1
657 nmdc:mga08y16_379599_c1
658 nmdc:mga08y16_8921_c1
659 nmdc:mga0n895_10655_c1
660 nmdc:mga0n895_321016_c1
661 nmdc:mga0a205_1499_c1
662 nmdc:mga0a205_372957_c1
663 Ga0495619_0017690
664 Ga0501084_0030434
665 Ga0501084_0195677
666 Ga0501084_0363767
667 Ga0501082_0011778
668 Ga0530510_0004866
669 Ga0530510_0193991
670 Ga0530510_0517911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00071

Ras

Ras family

11

170

0.96

PF08477

Roc

Ras of Complex, Roc, domain of DAPkinase

11

124

0.9

PF00025

Arf

ADP-ribosylation factor family

4

168

0.87

PF01926

MMR_HSR1

50S ribosome-binding GTPase

11

122

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tu4-assembly10.cif.gz_B crystal structure of rab5-gdp complex 0.918 1 161
2o52-assembly2.cif.gz_B crystal structure of human rab4b in complex with gdp 0.9172 2 164
1z0a-assembly4.cif.gz_D gdp-bound rab2a gtpase 0.9117 2 165
1tu4-assembly4.cif.gz_D crystal structure of rab5-gdp complex 0.9107 2 161
2o52-assembly1.cif.gz_A crystal structure of human rab4b in complex with gdp 0.9073 2 164
ID Description Score Start End Superfamily
af_Q9SJZ5_48_162_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9263 71 164 3.40.50.300
af_A0A1D6EL55_1_151_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9112 40 164 3.40.50.300
af_A0A1D6HV34_1_118_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.91 78 164 3.40.50.300
af_Q4CZ47_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9033 86 164 3.40.50.300
af_Q3E8G1_3_112_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9023 71 164 3.40.50.300
ID Description Score Start End GO Terms
AF-W4L503-F1-model_v4 GTP-binding protein 0.9386 42 162 GO:0003924
GO:0005525
AF-A0A1A8ET10-F1-model_v4 EF-hand calcium binding domain 4B 0.916 3 164 GO:0003924
GO:0005525
AF-W4L503-F1-model_v4 GTP-binding protein 0.9097 42 162 GO:0003924
GO:0005525
AF-A0A6A7G004-F1-model_v4 Rab-like protein 2A 0.9089 2 164 GO:0003924
GO:0005525
AF-A0A1A8ET10-F1-model_v4 EF-hand calcium binding domain 4B 0.895 3 164 GO:0003924
GO:0005525

Map