F411650

General Info

Members Datasets Scaffolds Average Seq Length
334 237 330 125

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100321242|Ga0070661_1003212422
Length 130
Sequence MSGFSLDANILIDTLLDHQPARREIVRIAESGARMWISRMAWIEVLSKGNDAVVQDALQFLDRFGLDEIDDEIAHRAAALRRERPRLKAPDAIILATAQIRGRILVTRNTRDFPESMPGIRVPYTLEEKA

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
188 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
189 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
192 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
195 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
199 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
203 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
204 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
205 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
210 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
220 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
231 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
236 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
237 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0.3
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.47
Nodule 0
Rhizoplane 4.79
Rhizosphere 75.15
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005296 3300001915 Bacteria 2724
2 JGI24737J22298_10001105 3300001990 Bacteria 9485
3 JGI24737J22298_10007013 3300001990 Bacteria 3820
4 JGI24742J22300_10083369 3300002244 Bacteria 606
5 JGI25153J46596_10000016 3300003215 Bacteria 285917
6 rootH1_10153465 3300003316 Bacteria 1188
7 rootH2_10161128 3300003320 Bacteria 1134
8 rootL2_10208047 3300003322 Bacteria 1338
9 rootH1_10153418 3300003323 Bacteria 1350
10 Ga0055525_1000035 3300003759 Bacteria 300887
11 Ga0070683_100510012 3300005329 Bacteria 1149
12 Ga0070670_100398366 3300005331 Bacteria 1215
13 Ga0070677_10727262 3300005333 Bacteria 561
14 Ga0070661_100044397 3300005344 Bacteria 3247
15 Ga0070661_100188875 3300005344 Bacteria 1571
16 Ga0070661_100321242 3300005344 Bacteria 1209
17 Ga0070668_100237105 3300005347 Bacteria 1510
18 Ga0070668_100268289 3300005347 Bacteria 1422
19 Ga0070675_101312037 3300005354 Bacteria 667
20 Ga0070674_100010588 3300005356 Bacteria 5582
21 Ga0070673_100326185 3300005364 Bacteria 1357
22 Ga0070659_100005817 3300005366 Bacteria 8881
23 Ga0070659_100084828 3300005366 Bacteria 2533
24 Ga0070659_100242634 3300005366 Bacteria 1492
25 Ga0070667_100945580 3300005367 Bacteria 803
26 Ga0070667_101781333 3300005367 Bacteria 579
27 Ga0070663_100022672 3300005455 Bacteria 4200
28 Ga0070678_100148158 3300005456 Bacteria 1887
29 Ga0070662_100001540 3300005457 Bacteria 14217
30 Ga0070662_100069933 3300005457 Bacteria 2585
31 Ga0070662_100181194 3300005457 Bacteria 1660
32 Ga0070707_100659287 3300005468 Bacteria 1009
33 Ga0070684_100706472 3300005535 Bacteria 940
34 Ga0070665_100226268 3300005548 Bacteria 1871
35 Ga0070664_100013595 3300005564 Bacteria 6632
36 Ga0068857_101162361 3300005577 Bacteria 746
37 Ga0068857_102446551 3300005577 Bacteria 513
38 Ga0068854_100146594 3300005578 Bacteria 1816
39 Ga0068856_100361433 3300005614 Bacteria 1470
40 Ga0068851_10130695 3300005834 Bacteria 1357
41 Ga0068860_100418273 3300005843 Bacteria 1328
42 Ga0081539_10067277 3300005985 Bacteria 1938
43 Ga0075365_11244847 3300006038 Bacteria 523
44 Ga0075369_10102755 3300006186 Bacteria 1283
45 Ga0075366_10079850 3300006195 Bacteria 1953
46 Ga0075366_10163752 3300006195 Bacteria 1348
47 Ga0075370_10017985 3300006353 Bacteria 3828
48 Ga0075370_10020133 3300006353 Bacteria 3643
49 Ga0075370_10568293 3300006353 Bacteria 686
50 Ga0114129_10147744 3300009147 Bacteria 3219
51 Ga0105243_10448172 3300009148 Bacteria 1210
52 Ga0105241_11522236 3300009174 Bacteria 644
53 Ga0105237_10345181 3300009545 Bacteria 1493
54 Ga0105239_12096854 3300010375 Unclassified 657
55 Ga0105246_10001299 3300011119 Bacteria 14665
56 Ga0157373_10050468 3300013100 Bacteria 2962
57 Ga0157373_10531379 3300013100 Bacteria 851
58 Ga0157373_10562017 3300013100 Bacteria 828
59 Ga0157373_10701893 3300013100 Bacteria 741
60 Ga0157371_10000030 3300013102 Bacteria 241585
61 Ga0157370_10364209 3300013104 Bacteria 1332
62 Ga0157370_10552557 3300013104 Bacteria 1055
63 Ga0157369_10647894 3300013105 Bacteria 1089
64 Ga0157372_10755280 3300013307 Bacteria 1131
65 Ga0157372_11534160 3300013307 Bacteria 767
66 Ga0157375_10040839 3300013308 Bacteria 4475
67 Ga0157380_11954623 3300014326 Bacteria 648
68 Ga0182008_10477211 3300014497 Bacteria 682
69 Ga0163161_10122181 3300017792 Bacteria 1958
70 Ga0163161_11912542 3300017792 Bacteria 528
71 Ga0206355_1039570 3300020076 Bacteria 569
72 Ga0213872_10020204 3300021361 Unclassified 3068
73 Ga0209563_100047 3300025230 Bacteria 366620
74 Ga0209758_1000035 3300025297 Bacteria 448190
75 Ga0207697_10145137 3300025315 Bacteria 1031
76 Ga0207656_10092356 3300025321 Bacteria 1376
77 Ga0207688_10122206 3300025901 Bacteria 1520
78 Ga0207647_10041095 3300025904 Bacteria 2910
79 Ga0207645_10047576 3300025907 Bacteria 2739
80 Ga0207705_10000935 3300025909 Bacteria 23840
81 Ga0207705_10107118 3300025909 Bacteria 2062
82 Ga0207654_10175028 3300025911 Bacteria 1396
83 Ga0207695_10289426 3300025913 Bacteria 1531
84 Ga0207649_10002100 3300025920 Bacteria 11311
85 Ga0207649_10264630 3300025920 Bacteria 1244
86 Ga0207649_10412555 3300025920 Bacteria 1013
87 Ga0207652_10769941 3300025921 Bacteria 856
88 Ga0207646_10672454 3300025922 Bacteria 927
89 Ga0207694_10016911 3300025924 Bacteria 5510
90 Ga0207650_10410500 3300025925 Bacteria 1122
91 Ga0207659_10513563 3300025926 Bacteria 1015
92 Ga0207690_10001091 3300025932 Bacteria 17308
93 Ga0207706_10064092 3300025933 Bacteria 3236
94 Ga0207706_10272585 3300025933 Bacteria 1476
95 Ga0207709_10727007 3300025935 Bacteria 796
96 Ga0207669_10017729 3300025937 Bacteria 3660
97 Ga0207661_10344164 3300025944 Bacteria 1344
98 Ga0207679_10117966 3300025945 Bacteria 2107
99 Ga0207667_10000004 3300025949 Bacteria 737718
100 Ga0207667_10001173 3300025949 Bacteria 32921
101 Ga0207667_11925012 3300025949 Bacteria 553
102 Ga0207667_12249418 3300025949 Bacteria 502
103 Ga0207651_10104993 3300025960 Bacteria 2106
104 Ga0207668_10112278 3300025972 Bacteria 2047
105 Ga0207668_11354843 3300025972 Bacteria 641
106 Ga0207640_10008295 3300025981 Bacteria 5766
107 Ga0207640_11875439 3300025981 Unclassified 542
108 Ga0207658_10829385 3300025986 Bacteria 840
109 Ga0207639_10001650 3300026041 Bacteria 15015
110 Ga0207678_10034175 3300026067 Bacteria 4429
111 Ga0207702_10499094 3300026078 Bacteria 1186
112 Ga0207702_11559455 3300026078 Bacteria 654
113 Ga0207674_10331804 3300026116 Bacteria 1471
114 Ga0207674_11181917 3300026116 Bacteria 734
115 Ga0207674_11494480 3300026116 Bacteria 645
116 Ga0207683_10054513 3300026121 Bacteria 3506
117 Ga0207698_10005725 3300026142 Bacteria 7704
118 Ga0209974_10122063 3300027876 Bacteria 924
119 Ga0268266_10228717 3300028379 Bacteria 1712
120 Ga0268264_10354914 3300028381 Bacteria 1397
121 Ga0307408_100036348 3300031548 Bacteria 3462
122 Ga0307405_10000222 3300031731 Bacteria 20532
123 Ga0307405_10092533 3300031731 Bacteria 2006
124 Ga0307405_10279712 3300031731 Bacteria 1255
125 Ga0307413_10007315 3300031824 Bacteria 5118
126 Ga0307413_10529764 3300031824 Bacteria 952
127 Ga0307413_10911122 3300031824 Bacteria 747
128 Ga0307410_10029494 3300031852 Bacteria 3494
129 Ga0307406_10041391 3300031901 Bacteria 2870
130 Ga0307406_10064668 3300031901 Bacteria 2375
131 Ga0307406_10252141 3300031901 Bacteria 1330
132 Ga0307407_10007906 3300031903 Bacteria 4847
133 Ga0307412_10044519 3300031911 Bacteria 2896
134 Ga0307412_10052904 3300031911 Bacteria 2690
135 Ga0307412_10360502 3300031911 Bacteria 1170
136 Ga0307412_10707565 3300031911 Bacteria 865
137 Ga0307409_100032994 3300031995 Bacteria 3762
138 Ga0307409_100102080 3300031995 Bacteria 2382
139 Ga0307416_100090471 3300032002 Bacteria 2624
140 Ga0307416_100348582 3300032002 Bacteria 1497
141 Ga0307416_101199174 3300032002 Bacteria 865
142 Ga0307414_10095530 3300032004 Bacteria 2221
143 Ga0307414_10182010 3300032004 Bacteria 1691
144 Ga0307411_10006397 3300032005 Bacteria 5890
145 Ga0307411_10092977 3300032005 Bacteria 2110
146 Ga0307411_10189789 3300032005 Bacteria 1568
147 Ga0307415_101141280 3300032126 Unclassified 731
148 Ga0307415_102090486 3300032126 Bacteria 553
149 Ga0307510_10207601 3300033180 Bacteria 1485
150 Ga0395900_0126277 3300037418 Bacteria 2624
151 Ga0395901_0118819 3300038443 Bacteria 2777
152 Ga0436361_0279804 3300039447 Bacteria 27260
153 Ga0451787_378797 3300041441 Bacteria 1100
154 Ga0451833_0720054 3300041491 Viruses 788
155 Ga0451853_3900627 3300041512 Bacteria 843
156 Ga0439449_0018530 3300042007 Bacteria 2613
157 Ga0466963_0064112 3300044694 Bacteria 2461
158 Ga0453684_0437447 3300044712 Bacteria 1458
159 Ga0451576_0070024 3300045051 Bacteria 3651
160 Ga0466967_0472135 3300045976 Bacteria 1228
161 Ga0495627_000172 3300046453 Bacteria 73650
162 Ga0495627_000766 3300046453 Bacteria 23882
163 Ga0495591_160500 3300046458 Bacteria 538
164 Ga0495638_0115918 3300046460 Bacteria 1587
165 Ga0495650_0000174 3300046471 Bacteria 142519
166 Ga0495650_0000905 3300046471 Bacteria 34945
167 Ga0495584_0025534 3300046491 Bacteria 2995
168 Ga0495585_0001815 3300046492 Bacteria 16168
169 Ga0495585_0261748 3300046492 Bacteria 860
170 Ga0495596_0000328 3300046500 Bacteria 30994
171 Ga0495596_0134307 3300046500 Bacteria 960
172 Ga0495607_0002731 3300046501 Bacteria 14079
173 Ga0495607_0021037 3300046501 Bacteria 4110
174 Ga0495583_0000271 3300046506 Bacteria 85085
175 Ga0495583_0007539 3300046506 Bacteria 6809
176 Ga0495583_0007682 3300046506 Bacteria 6720
177 Ga0495583_0090812 3300046506 Bacteria 1315
178 Ga0495606_0011760 3300046507 Bacteria 7093
179 Ga0495606_0129221 3300046507 Bacteria 1503
180 Ga0495610_0000280 3300046512 Bacteria 53046
181 Ga0495631_0098497 3300046518 Bacteria 1259
182 Ga0495631_0426701 3300046518 Bacteria 565
183 Ga0495632_0000561 3300046519 Bacteria 34706
184 Ga0495632_0127479 3300046519 Bacteria 1186
185 Ga0495632_0150246 3300046519 Bacteria 1077
186 Ga0495637_0003085 3300046520 Bacteria 8890
187 Ga0495637_0073817 3300046520 Bacteria 1371
188 Ga0495643_0003030 3300046522 Bacteria 12636
189 Ga0495643_0005898 3300046522 Bacteria 8181
190 Ga0495643_0006999 3300046522 Bacteria 7329
191 Ga0495648_0035580 3300046524 Bacteria 3227
192 Ga0495663_0000479 3300046525 Bacteria 14555
193 Ga0495609_0136058 3300046538 Bacteria 1050
194 Ga0495622_0022155 3300046557 Bacteria 2960
195 Ga0495633_0000735 3300046558 Bacteria 29673
196 Ga0495633_0050752 3300046558 Bacteria 1955
197 Ga0495668_0208062 3300046616 Bacteria 1071
198 Ga0495611_0021648 3300046648 Bacteria 2778
199 Ga0495611_0089592 3300046648 Bacteria 1421
200 Ga0495625_0000503 3300046660 Bacteria 58118
201 Ga0495625_0005716 3300046660 Bacteria 11252
202 Ga0495625_0006713 3300046660 Bacteria 10202
203 Ga0495625_0012080 3300046660 Bacteria 7007
204 Ga0495625_0059644 3300046660 Bacteria 2706
205 Ga0495625_0226963 3300046660 Bacteria 1221
206 Ga0495661_0093937 3300046665 Bacteria 1701
207 Ga0495661_0391805 3300046665 Bacteria 677
208 Ga0495669_0000027 3300046684 Bacteria 109260
209 Ga0495670_0170413 3300046691 Bacteria 1146
210 Ga0495671_0173398 3300046692 Bacteria 1048
211 Ga0495649_0104075 3300046694 Bacteria 1507
212 Ga0495600_0006398 3300046809 Bacteria 7169
213 Ga0495660_0149189 3300046810 Bacteria 1156
214 Ga0495683_0004584 3300047323 Bacteria 7805
215 Ga0495683_0048003 3300047323 Bacteria 2141
216 Ga0495687_000044 3300047443 Bacteria 215400
217 Ga0495677_0015935 3300047445 Bacteria 2728
218 Ga0495677_0255724 3300047445 Bacteria 685
219 Ga0495681_0000064 3300047470 Bacteria 99007
220 Ga0495681_0000110 3300047470 Bacteria 70960
221 Ga0495686_0013638 3300047472 Bacteria 5632
222 Ga0496101_0449550 3300048904 Bacteria 1016
223 Ga0496102_0000188 3300048905 Bacteria 83919
224 Ga0496103_0000426 3300048906 Bacteria 36650
225 Ga0496104_0005412 3300048907 Bacteria 11172
226 Ga0496105_0000605 3300048908 Bacteria 23957
227 Ga0496105_0821481 3300048908 Bacteria 705
228 Ga0496106_1081063 3300048909 Bacteria 629
229 Ga0496107_0109203 3300048910 Bacteria 2032
230 Ga0496110_0042411 3300048913 Bacteria 3971
231 Ga0496111_0048476 3300048914 Bacteria 3060
232 Ga0496112_0515810 3300048915 Bacteria 1130
233 Ga0496114_0043808 3300048917 Bacteria 3711
234 Ga0496114_0141553 3300048917 Bacteria 2083
235 Ga0496115_0000018 3300048918 Bacteria 182523
236 Ga0496116_0005647 3300048919 Bacteria 11516
237 Ga0496117_0000499 3300048920 Bacteria 64797
238 Ga0496117_0270790 3300048920 Bacteria 915
239 Ga0496118_0000399 3300048921 Bacteria 73329
240 Ga0496119_0002670 3300048922 Bacteria 19295
241 Ga0496121_0000263 3300048924 Bacteria 109553
242 Ga0496122_0009646 3300048925 Bacteria 10106
243 Ga0496123_0053226 3300048926 Bacteria 2677
244 Ga0496124_0000099 3300048927 Bacteria 182007
245 Ga0496124_0062293 3300048927 Bacteria 3122
246 Ga0496125_0000529 3300048928 Bacteria 65769
247 Ga0496126_0000707 3300048929 Bacteria 60949
248 Ga0496126_0100495 3300048929 Bacteria 2531
249 Ga0501031_0092727 3300049568 Bacteria 1971
250 Ga0501032_0053787 3300049569 Bacteria 2710
251 Ga0501033_0002980 3300049570 Bacteria 14139
252 Ga0501033_0244255 3300049570 Bacteria 1273
253 Ga0501036_0039781 3300049572 Bacteria 3978
254 Ga0501036_0549580 3300049572 Unclassified 960
255 Ga0501037_0148603 3300049573 Bacteria 1675
256 Ga0501037_0286888 3300049573 Bacteria 1146
257 Ga0501038_0052311 3300049574 Bacteria 3521
258 Ga0501039_0178915 3300049575 Bacteria 1668
259 Ga0501040_1067001 3300049576 Bacteria 586
260 Ga0501043_0096434 3300049579 Bacteria 2324
261 Ga0501046_0684251 3300049580 Bacteria 723
262 Ga0501047_0083032 3300049581 Bacteria 3079
263 Ga0501048_0571700 3300049582 Bacteria 811
264 Ga0501076_1445128 3300049592 Bacteria 565
265 Ga0501201_014074 3300049651 Bacteria 806
266 Ga0501207_027832 3300049654 Bacteria 938
267 Ga0501216_051716 3300049660 Bacteria 809
268 Ga0501217_007086 3300049661 Bacteria 2397
269 Ga0501224_025312 3300049664 Bacteria 887
270 Ga0501224_026636 3300049664 Bacteria 865
271 Ga0501233_206071 3300049668 Bacteria 574
272 Ga0501235_018387 3300049669 Bacteria 1550
273 Ga0501235_034548 3300049669 Bacteria 1147
274 Ga0501239_023463 3300049672 Bacteria 771
275 Ga0501247_058509 3300049677 Unclassified 587
276 Ga0501249_021495 3300049679 Bacteria 1408
277 Ga0501249_068945 3300049679 Bacteria 825
278 Ga0501257_012009 3300049686 Bacteria 1980
279 Ga0501257_036248 3300049686 Bacteria 1201
280 Ga0501258_003168 3300049687 Bacteria 1491
281 Ga0501221_055478 3300049704 Bacteria 903
282 Ga0501229_051621 3300049706 Bacteria 609
283 Ga0501234_007832 3300049707 Bacteria 1670
284 Ga0501262_023151 3300049759 Bacteria 862
285 Ga0501263_021820 3300049760 Bacteria 866
286 Ga0501263_091370 3300049760 Bacteria 514
287 Ga0501270_097041 3300049767 Unclassified 610
288 Ga0501272_017022 3300049769 Bacteria 853
289 Ga0501273_008621 3300049770 Bacteria 1224
290 Ga0501035_0008920 3300049822 Bacteria 9331
291 Ga0501035_0171949 3300049822 Bacteria 1871
292 Ga0501044_0005256 3300049823 Bacteria 14400
293 Ga0501044_0867403 3300049823 Bacteria 779
294 Ga0501204_010296 3300049850 Bacteria 1094
295 Ga0501212_010157 3300049851 Bacteria 1337
296 Ga0501212_037906 3300049851 Bacteria 791
297 nmdc:mga0yw44_1103890_c1 3300050492 Bacteria 536
298 nmdc:mga0k408_202060_c1 3300050493 Bacteria 1186
299 nmdc:mga0k408_206035_c1 3300050493 Bacteria 1174
300 nmdc:mga0k408_78256_c1 3300050493 Bacteria 1934
301 nmdc:mga07m45_1873_c1 3300050496 Bacteria 9717
302 nmdc:mga07m45_7980_c1 3300050496 Bacteria 5423
303 nmdc:mga0sz30_43501_c1 3300050516 Bacteria 1890
304 Ga0500610_0000486 3300053079 Bacteria 12218
305 Ga0500643_000004 3300053087 Bacteria 857484
306 Ga0500643_001971 3300053087 Bacteria 11122
307 Ga0500643_004167 3300053087 Bacteria 6633
308 Ga0500643_006101 3300053087 Bacteria 5093
309 Ga0500643_098895 3300053087 Bacteria 792
310 Ga0500583_0279970 3300053092 Bacteria 819
311 Ga0500562_000537 3300053108 Bacteria 9206
312 Ga0500592_007754 3300053116 Bacteria 1705
313 Ga0500594_0026365 3300053118 Bacteria 1497
314 Ga0500595_000375 3300053119 Bacteria 28868
315 Ga0500608_000515 3300053122 Bacteria 14466
316 Ga0500642_0000195 3300053130 Bacteria 24912
317 Ga0500559_0191164 3300053136 Bacteria 965
318 Ga0500564_000436 3300053138 Bacteria 12084
319 Ga0500588_0148138 3300053146 Bacteria 847
320 Ga0500604_0069783 3300053151 Bacteria 1118
321 Ga0500619_131816 3300053154 Bacteria 852
322 Ga0500622_0001744 3300053156 Bacteria 16764
323 Ga0500630_210037 3300053159 Bacteria 744
324 Ga0500567_000322 3300053723 Bacteria 15480
325 Ga0500625_000034 3300053729 Bacteria 48891
326 Ga0500645_000009 3300053730 Bacteria 206177
327 Ga0500645_104077 3300053730 Bacteria 799
328 Ga0500609_015730 3300053731 Bacteria 1025
329 Ga0500596_000536 3300053735 Bacteria 7196
330 Ga0500661_040830 3300055283 Bacteria 822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10147744 Ga0114129_101477444 115
2 3300046501 Ga0495607_0002731 Ga0495607_0002731_2637_3017 115
3 3300046507 Ga0495606_0129221 Ga0495606_0129221_763_1143 115
4 3300046522 Ga0495643_0006999 Ga0495643_0006999_4231_4611 115
5 3300049823 Ga0501044_0867403 Ga0501044_0867403_252_608 118
6 iso_pu_bacteria 2599185354 2600200676 118
7 iso_pu_bacteria 2751185897 2753763521 118
8 3300021361 Ga0213872_10020204 Ga0213872_100202043 120
9 3300039447 Ga0436361_0279804 Ga0436361_0279804_9130_9492 120
10 3300046519 Ga0495632_0150246 Ga0495632_0150246_670_1047 120
11 3300046522 Ga0495643_0003030 Ga0495643_0003030_6058_6435 120
12 3300020076 Ga0206355_1039570 Ga0206355_10395701 121
13 3300037418 Ga0395900_0126277 Ga0395900_0126277_432_803 121
14 3300044694 Ga0466963_0064112 Ga0466963_0064112_1693_2064 121
15 3300045976 Ga0466967_0472135 Ga0466967_0472135_298_669 121
16 3300005333 Ga0070677_10727262 Ga0070677_107272621 122
17 3300005577 Ga0068857_102446551 Ga0068857_1024465511 122
18 3300006353 Ga0075370_10020133 Ga0075370_100201333 122
19 3300013100 Ga0157373_10701893 Ga0157373_107018932 122
20 3300014497 Ga0182008_10477211 Ga0182008_104772112 122
21 3300025921 Ga0207652_10769941 Ga0207652_107699411 122
22 3300031911 Ga0307412_10052904 Ga0307412_100529043 122
23 3300031995 Ga0307409_100102080 Ga0307409_1001020803 122
24 3300032002 Ga0307416_101199174 Ga0307416_1011991742 122
25 3300038443 Ga0395901_0118819 Ga0395901_0118819_246_614 122
26 3300044712 Ga0453684_0437447 Ga0453684_0437447_991_1359 122
27 3300049664 Ga0501224_026636 Ga0501224_026636_468_836 122
28 3300049668 Ga0501233_206071 Ga0501233_206071_23_391 122
29 3300049669 Ga0501235_018387 Ga0501235_018387_531_899 122
30 3300049679 Ga0501249_021495 Ga0501249_021495_360_728 122
31 3300049686 Ga0501257_012009 Ga0501257_012009_408_776 122
32 3300049760 Ga0501263_091370 Ga0501263_091370_135_503 122
33 3300049767 Ga0501270_097041 Ga0501270_097041_46_414 122
34 3300049851 Ga0501212_010157 Ga0501212_010157_821_1189 122
35 3300050493 nmdc:mga0k408_206035_c1 nmdc:mga0k408_206035_c1_421_789 122
36 3300050496 nmdc:mga07m45_7980_c1 nmdc:mga07m45_7980_c1_699_1067 122
37 3300053087 Ga0500643_001971 Ga0500643_001971_8414_8782 122
38 3300053087 Ga0500643_004167 Ga0500643_004167_2521_2889 122
39 3300053087 Ga0500643_006101 Ga0500643_006101_2090_2458 122
40 3300053146 Ga0500588_0148138 Ga0500588_0148138_304_672 122
41 iso_pu_bacteria 2919709256 2919709761 122
42 iso_pu_bacteria 8054302542 8054307064 122
43 3300046500 Ga0495596_0000328 Ga0495596_0000328_30589_30966 125
44 3300046501 Ga0495607_0021037 Ga0495607_0021037_559_936 125
45 3300046506 Ga0495583_0090812 Ga0495583_0090812_612_989 125
46 3300046660 Ga0495625_0059644 Ga0495625_0059644_2287_2664 125
47 3300049568 Ga0501031_0092727 Ga0501031_0092727_279_656 125
48 3300049569 Ga0501032_0053787 Ga0501032_0053787_2056_2433 125
49 3300049570 Ga0501033_0002980 Ga0501033_0002980_11073_11450 125
50 3300049572 Ga0501036_0039781 Ga0501036_0039781_1046_1423 125
51 3300049573 Ga0501037_0148603 Ga0501037_0148603_468_845 125
52 3300049574 Ga0501038_0052311 Ga0501038_0052311_2006_2383 125
53 3300049575 Ga0501039_0178915 Ga0501039_0178915_634_1011 125
54 3300049576 Ga0501040_1067001 Ga0501040_1067001_106_483 125
55 3300049579 Ga0501043_0096434 Ga0501043_0096434_942_1319 125
56 3300049580 Ga0501046_0684251 Ga0501046_0684251_273_650 125
57 3300049581 Ga0501047_0083032 Ga0501047_0083032_898_1275 125
58 3300049582 Ga0501048_0571700 Ga0501048_0571700_216_593 125
59 3300049822 Ga0501035_0008920 Ga0501035_0008920_280_657 125
60 3300049822 Ga0501035_0171949 Ga0501035_0171949_96_473 125
61 3300049823 Ga0501044_0005256 Ga0501044_0005256_3025_3402 125
62 3300001915 JGI24741J21665_1005296 JGI24741J21665_10052963 126
63 3300001990 JGI24737J22298_10001105 JGI24737J22298_100011057 126
64 3300001990 JGI24737J22298_10007013 JGI24737J22298_100070136 126
65 3300002244 JGI24742J22300_10083369 JGI24742J22300_100833692 126
66 3300003215 JGI25153J46596_10000016 JGI25153J46596_10000016143 126
67 3300003316 rootH1_10153465 rootH1_101534652 126
68 3300003320 rootH2_10161128 rootH2_101611281 126
69 3300003322 rootL2_10208047 rootL2_102080473 126
70 3300003323 rootH1_10153418 rootH1_101534182 126
71 3300003759 Ga0055525_1000035 Ga0055525_100003576 126
72 3300005329 Ga0070683_100510012 Ga0070683_1005100123 126
73 3300005331 Ga0070670_100398366 Ga0070670_1003983663 126
74 3300005344 Ga0070661_100044397 Ga0070661_1000443972 126
75 3300005344 Ga0070661_100188875 Ga0070661_1001888752 126
76 3300005344 Ga0070661_100321242 Ga0070661_1003212422 126
77 3300005347 Ga0070668_100237105 Ga0070668_1002371052 126
78 3300005347 Ga0070668_100268289 Ga0070668_1002682893 126
79 3300005354 Ga0070675_101312037 Ga0070675_1013120372 126
80 3300005356 Ga0070674_100010588 Ga0070674_1000105885 126
81 3300005364 Ga0070673_100326185 Ga0070673_1003261852 126
82 3300005366 Ga0070659_100005817 Ga0070659_1000058177 126
83 3300005366 Ga0070659_100084828 Ga0070659_1000848282 126
84 3300005366 Ga0070659_100242634 Ga0070659_1002426344 126
85 3300005367 Ga0070667_100945580 Ga0070667_1009455802 126
86 3300005367 Ga0070667_101781333 Ga0070667_1017813332 126
87 3300005455 Ga0070663_100022672 Ga0070663_1000226721 126
88 3300005456 Ga0070678_100148158 Ga0070678_1001481583 126
89 3300005457 Ga0070662_100001540 Ga0070662_10000154010 126
90 3300005457 Ga0070662_100069933 Ga0070662_1000699332 126
91 3300005457 Ga0070662_100181194 Ga0070662_1001811943 126
92 3300005468 Ga0070707_100659287 Ga0070707_1006592872 126
93 3300005535 Ga0070684_100706472 Ga0070684_1007064722 126
94 3300005548 Ga0070665_100226268 Ga0070665_1002262682 126
95 3300005564 Ga0070664_100013595 Ga0070664_1000135953 126
96 3300005577 Ga0068857_101162361 Ga0068857_1011623612 126
97 3300005578 Ga0068854_100146594 Ga0068854_1001465943 126
98 3300005614 Ga0068856_100361433 Ga0068856_1003614333 126
99 3300005834 Ga0068851_10130695 Ga0068851_101306952 126
100 3300005843 Ga0068860_100418273 Ga0068860_1004182732 126
101 3300005985 Ga0081539_10067277 Ga0081539_100672772 126
102 3300006038 Ga0075365_11244847 Ga0075365_112448472 126
103 3300006186 Ga0075369_10102755 Ga0075369_101027552 126
104 3300006195 Ga0075366_10079850 Ga0075366_100798502 126
105 3300006195 Ga0075366_10163752 Ga0075366_101637522 126
106 3300006353 Ga0075370_10017985 Ga0075370_100179855 126
107 3300006353 Ga0075370_10568293 Ga0075370_105682932 126
108 3300009148 Ga0105243_10448172 Ga0105243_104481723 126
109 3300009174 Ga0105241_11522236 Ga0105241_115222362 126
110 3300009545 Ga0105237_10345181 Ga0105237_103451813 126
111 3300010375 Ga0105239_12096854 Ga0105239_120968541 126
112 3300011119 Ga0105246_10001299 Ga0105246_1000129913 126
113 3300013100 Ga0157373_10050468 Ga0157373_100504682 126
114 3300013100 Ga0157373_10531379 Ga0157373_105313792 126
115 3300013100 Ga0157373_10562017 Ga0157373_105620172 126
116 3300013102 Ga0157371_10000030 Ga0157371_1000003065 126
117 3300013104 Ga0157370_10364209 Ga0157370_103642093 126
118 3300013104 Ga0157370_10552557 Ga0157370_105525572 126
119 3300013105 Ga0157369_10647894 Ga0157369_106478943 126
120 3300013307 Ga0157372_10755280 Ga0157372_107552802 126
121 3300013307 Ga0157372_11534160 Ga0157372_115341602 126
122 3300013308 Ga0157375_10040839 Ga0157375_100408393 126
123 3300014326 Ga0157380_11954623 Ga0157380_119546232 126
124 3300017792 Ga0163161_10122181 Ga0163161_101221814 126
125 3300017792 Ga0163161_11912542 Ga0163161_119125422 126
126 3300025230 Ga0209563_100047 Ga0209563_100047276 126
127 3300025297 Ga0209758_1000035 Ga0209758_1000035214 126
128 3300025315 Ga0207697_10145137 Ga0207697_101451372 126
129 3300025321 Ga0207656_10092356 Ga0207656_100923562 126
130 3300025901 Ga0207688_10122206 Ga0207688_101222062 126
131 3300025904 Ga0207647_10041095 Ga0207647_100410954 126
132 3300025907 Ga0207645_10047576 Ga0207645_100475761 126
133 3300025909 Ga0207705_10000935 Ga0207705_100009357 126
134 3300025909 Ga0207705_10107118 Ga0207705_101071182 126
135 3300025911 Ga0207654_10175028 Ga0207654_101750282 126
136 3300025913 Ga0207695_10289426 Ga0207695_102894263 126
137 3300025920 Ga0207649_10002100 Ga0207649_100021003 126
138 3300025920 Ga0207649_10264630 Ga0207649_102646302 126
139 3300025920 Ga0207649_10412555 Ga0207649_104125552 126
140 3300025922 Ga0207646_10672454 Ga0207646_106724541 126
141 3300025924 Ga0207694_10016911 Ga0207694_100169113 126
142 3300025925 Ga0207650_10410500 Ga0207650_104105002 126
143 3300025926 Ga0207659_10513563 Ga0207659_105135632 126
144 3300025932 Ga0207690_10001091 Ga0207690_100010916 126
145 3300025933 Ga0207706_10064092 Ga0207706_100640922 126
146 3300025933 Ga0207706_10272585 Ga0207706_102725853 126
147 3300025935 Ga0207709_10727007 Ga0207709_107270072 126
148 3300025937 Ga0207669_10017729 Ga0207669_100177294 126
149 3300025944 Ga0207661_10344164 Ga0207661_103441641 126
150 3300025945 Ga0207679_10117966 Ga0207679_101179662 126
151 3300025949 Ga0207667_10000004 Ga0207667_10000004209 126
152 3300025949 Ga0207667_10001173 Ga0207667_1000117315 126
153 3300025949 Ga0207667_11925012 Ga0207667_119250121 126
154 3300025949 Ga0207667_12249418 Ga0207667_122494181 126
155 3300025960 Ga0207651_10104993 Ga0207651_101049932 126
156 3300025972 Ga0207668_10112278 Ga0207668_101122782 126
157 3300025972 Ga0207668_11354843 Ga0207668_113548432 126
158 3300025981 Ga0207640_10008295 Ga0207640_100082954 126
159 3300025981 Ga0207640_11875439 Ga0207640_118754392 126
160 3300025986 Ga0207658_10829385 Ga0207658_108293852 126
161 3300026041 Ga0207639_10001650 Ga0207639_1000165016 126
162 3300026067 Ga0207678_10034175 Ga0207678_100341751 126
163 3300026078 Ga0207702_10499094 Ga0207702_104990942 126
164 3300026078 Ga0207702_11559455 Ga0207702_115594552 126
165 3300026116 Ga0207674_10331804 Ga0207674_103318042 126
166 3300026116 Ga0207674_11181917 Ga0207674_111819172 126
167 3300026116 Ga0207674_11494480 Ga0207674_114944802 126
168 3300026121 Ga0207683_10054513 Ga0207683_100545132 126
169 3300026142 Ga0207698_10005725 Ga0207698_100057257 126
170 3300027876 Ga0209974_10122063 Ga0209974_101220632 126
171 3300028379 Ga0268266_10228717 Ga0268266_102287172 126
172 3300028381 Ga0268264_10354914 Ga0268264_103549142 126
173 3300031548 Ga0307408_100036348 Ga0307408_1000363483 126
174 3300031731 Ga0307405_10000222 Ga0307405_100002224 126
175 3300031731 Ga0307405_10092533 Ga0307405_100925333 126
176 3300031731 Ga0307405_10279712 Ga0307405_102797122 126
177 3300031824 Ga0307413_10007315 Ga0307413_100073152 126
178 3300031824 Ga0307413_10529764 Ga0307413_105297642 126
179 3300031824 Ga0307413_10911122 Ga0307413_109111222 126
180 3300031852 Ga0307410_10029494 Ga0307410_100294944 126
181 3300031901 Ga0307406_10041391 Ga0307406_100413912 126
182 3300031901 Ga0307406_10064668 Ga0307406_100646683 126
183 3300031901 Ga0307406_10252141 Ga0307406_102521412 126
184 3300031903 Ga0307407_10007906 Ga0307407_100079064 126
185 3300031911 Ga0307412_10044519 Ga0307412_100445193 126
186 3300031911 Ga0307412_10360502 Ga0307412_103605022 126
187 3300031911 Ga0307412_10707565 Ga0307412_107075652 126
188 3300031995 Ga0307409_100032994 Ga0307409_1000329944 126
189 3300032002 Ga0307416_100090471 Ga0307416_1000904713 126
190 3300032002 Ga0307416_100348582 Ga0307416_1003485823 126
191 3300032004 Ga0307414_10095530 Ga0307414_100955303 126
192 3300032004 Ga0307414_10182010 Ga0307414_101820102 126
193 3300032005 Ga0307411_10006397 Ga0307411_100063972 126
194 3300032005 Ga0307411_10092977 Ga0307411_100929772 126
195 3300032005 Ga0307411_10189789 Ga0307411_101897892 126
196 3300032126 Ga0307415_101141280 Ga0307415_1011412802 126
197 3300032126 Ga0307415_102090486 Ga0307415_1020904861 126
198 3300033180 Ga0307510_10207601 Ga0307510_102076011 126
199 3300041441 Ga0451787_378797 Ga0451787_378797_172_552 126
200 3300041491 Ga0451833_0720054 Ga0451833_0720054_395_775 126
201 3300041512 Ga0451853_3900627 Ga0451853_3900627_185_565 126
202 3300042007 Ga0439449_0018530 Ga0439449_0018530_97_477 126
203 3300045051 Ga0451576_0070024 Ga0451576_0070024_3216_3596 126
204 3300046453 Ga0495627_000172 Ga0495627_000172_68333_68713 126
205 3300046453 Ga0495627_000766 Ga0495627_000766_18924_19304 126
206 3300046458 Ga0495591_160500 Ga0495591_160500_91_471 126
207 3300046460 Ga0495638_0115918 Ga0495638_0115918_207_587 126
208 3300046471 Ga0495650_0000174 Ga0495650_0000174_107361_107741 126
209 3300046471 Ga0495650_0000905 Ga0495650_0000905_18023_18403 126
210 3300046491 Ga0495584_0025534 Ga0495584_0025534_1213_1593 126
211 3300046492 Ga0495585_0001815 Ga0495585_0001815_7217_7597 126
212 3300046492 Ga0495585_0261748 Ga0495585_0261748_327_707 126
213 3300046500 Ga0495596_0134307 Ga0495596_0134307_463_843 126
214 3300046506 Ga0495583_0000271 Ga0495583_0000271_11361_11741 126
215 3300046506 Ga0495583_0007539 Ga0495583_0007539_5430_5810 126
216 3300046506 Ga0495583_0007682 Ga0495583_0007682_4525_4905 126
217 3300046507 Ga0495606_0011760 Ga0495606_0011760_1930_2310 126
218 3300046512 Ga0495610_0000280 Ga0495610_0000280_33045_33425 126
219 3300046518 Ga0495631_0098497 Ga0495631_0098497_355_735 126
220 3300046518 Ga0495631_0426701 Ga0495631_0426701_99_479 126
221 3300046519 Ga0495632_0000561 Ga0495632_0000561_8671_9051 126
222 3300046519 Ga0495632_0127479 Ga0495632_0127479_509_889 126
223 3300046520 Ga0495637_0003085 Ga0495637_0003085_191_571 126
224 3300046520 Ga0495637_0073817 Ga0495637_0073817_742_1122 126
225 3300046522 Ga0495643_0005898 Ga0495643_0005898_7114_7494 126
226 3300046524 Ga0495648_0035580 Ga0495648_0035580_1861_2241 126
227 3300046525 Ga0495663_0000479 Ga0495663_0000479_5298_5678 126
228 3300046538 Ga0495609_0136058 Ga0495609_0136058_250_630 126
229 3300046557 Ga0495622_0022155 Ga0495622_0022155_1539_1919 126
230 3300046558 Ga0495633_0000735 Ga0495633_0000735_16373_16753 126
231 3300046558 Ga0495633_0050752 Ga0495633_0050752_391_771 126
232 3300046616 Ga0495668_0208062 Ga0495668_0208062_327_707 126
233 3300046648 Ga0495611_0021648 Ga0495611_0021648_233_613 126
234 3300046648 Ga0495611_0089592 Ga0495611_0089592_1008_1388 126
235 3300046660 Ga0495625_0000503 Ga0495625_0000503_2054_2434 126
236 3300046660 Ga0495625_0005716 Ga0495625_0005716_6977_7357 126
237 3300046660 Ga0495625_0006713 Ga0495625_0006713_2843_3223 126
238 3300046660 Ga0495625_0012080 Ga0495625_0012080_5745_6125 126
239 3300046660 Ga0495625_0226963 Ga0495625_0226963_607_987 126
240 3300046665 Ga0495661_0093937 Ga0495661_0093937_838_1218 126
241 3300046665 Ga0495661_0391805 Ga0495661_0391805_236_616 126
242 3300046684 Ga0495669_0000027 Ga0495669_0000027_40066_40446 126
243 3300046691 Ga0495670_0170413 Ga0495670_0170413_193_573 126
244 3300046692 Ga0495671_0173398 Ga0495671_0173398_207_587 126
245 3300046694 Ga0495649_0104075 Ga0495649_0104075_694_1074 126
246 3300046809 Ga0495600_0006398 Ga0495600_0006398_3678_4058 126
247 3300046810 Ga0495660_0149189 Ga0495660_0149189_610_990 126
248 3300047323 Ga0495683_0004584 Ga0495683_0004584_6642_7022 126
249 3300047323 Ga0495683_0048003 Ga0495683_0048003_358_738 126
250 3300047443 Ga0495687_000044 Ga0495687_000044_163943_164323 126
251 3300047445 Ga0495677_0015935 Ga0495677_0015935_1971_2351 126
252 3300047445 Ga0495677_0255724 Ga0495677_0255724_89_469 126
253 3300047470 Ga0495681_0000064 Ga0495681_0000064_30158_30538 126
254 3300047470 Ga0495681_0000110 Ga0495681_0000110_36921_37301 126
255 3300047472 Ga0495686_0013638 Ga0495686_0013638_1933_2313 126
256 3300048904 Ga0496101_0449550 Ga0496101_0449550_565_945 126
257 3300048905 Ga0496102_0000188 Ga0496102_0000188_41182_41562 126
258 3300048906 Ga0496103_0000426 Ga0496103_0000426_2749_3129 126
259 3300048907 Ga0496104_0005412 Ga0496104_0005412_6351_6731 126
260 3300048908 Ga0496105_0000605 Ga0496105_0000605_15461_15841 126
261 3300048908 Ga0496105_0821481 Ga0496105_0821481_239_619 126
262 3300048909 Ga0496106_1081063 Ga0496106_1081063_14_394 126
263 3300048910 Ga0496107_0109203 Ga0496107_0109203_26_406 126
264 3300048913 Ga0496110_0042411 Ga0496110_0042411_1772_2152 126
265 3300048914 Ga0496111_0048476 Ga0496111_0048476_1399_1779 126
266 3300048915 Ga0496112_0515810 Ga0496112_0515810_720_1100 126
267 3300048917 Ga0496114_0043808 Ga0496114_0043808_1046_1426 126
268 3300048917 Ga0496114_0141553 Ga0496114_0141553_1344_1724 126
269 3300048918 Ga0496115_0000018 Ga0496115_0000018_93455_93835 126
270 3300048919 Ga0496116_0005647 Ga0496116_0005647_1547_1927 126
271 3300048920 Ga0496117_0000499 Ga0496117_0000499_48749_49129 126
272 3300048920 Ga0496117_0270790 Ga0496117_0270790_206_586 126
273 3300048921 Ga0496118_0000399 Ga0496118_0000399_15664_16044 126
274 3300048922 Ga0496119_0002670 Ga0496119_0002670_14154_14534 126
275 3300048924 Ga0496121_0000263 Ga0496121_0000263_15620_16000 126
276 3300048925 Ga0496122_0009646 Ga0496122_0009646_386_766 126
277 3300048926 Ga0496123_0053226 Ga0496123_0053226_563_943 126
278 3300048927 Ga0496124_0000099 Ga0496124_0000099_88100_88480 126
279 3300048927 Ga0496124_0062293 Ga0496124_0062293_2072_2452 126
280 3300048928 Ga0496125_0000529 Ga0496125_0000529_49472_49852 126
281 3300048929 Ga0496126_0000707 Ga0496126_0000707_48625_49005 126
282 3300048929 Ga0496126_0100495 Ga0496126_0100495_1547_1927 126
283 3300049570 Ga0501033_0244255 Ga0501033_0244255_862_1242 126
284 3300049572 Ga0501036_0549580 Ga0501036_0549580_385_765 126
285 3300049573 Ga0501037_0286888 Ga0501037_0286888_366_758 126
286 3300049592 Ga0501076_1445128 Ga0501076_1445128_64_444 126
287 3300049651 Ga0501201_014074 Ga0501201_014074_159_539 126
288 3300049654 Ga0501207_027832 Ga0501207_027832_393_773 126
289 3300049660 Ga0501216_051716 Ga0501216_051716_398_778 126
290 3300049661 Ga0501217_007086 Ga0501217_007086_1894_2274 126
291 3300049664 Ga0501224_025312 Ga0501224_025312_152_532 126
292 3300049669 Ga0501235_034548 Ga0501235_034548_245_625 126
293 3300049672 Ga0501239_023463 Ga0501239_023463_234_614 126
294 3300049677 Ga0501247_058509 Ga0501247_058509_119_499 126
295 3300049679 Ga0501249_068945 Ga0501249_068945_214_594 126
296 3300049686 Ga0501257_036248 Ga0501257_036248_655_1035 126
297 3300049687 Ga0501258_003168 Ga0501258_003168_348_728 126
298 3300049704 Ga0501221_055478 Ga0501221_055478_166_546 126
299 3300049706 Ga0501229_051621 Ga0501229_051621_213_593 126
300 3300049707 Ga0501234_007832 Ga0501234_007832_994_1374 126
301 3300049759 Ga0501262_023151 Ga0501262_023151_376_756 126
302 3300049760 Ga0501263_021820 Ga0501263_021820_97_477 126
303 3300049769 Ga0501272_017022 Ga0501272_017022_76_456 126
304 3300049770 Ga0501273_008621 Ga0501273_008621_709_1089 126
305 3300049850 Ga0501204_010296 Ga0501204_010296_539_919 126
306 3300049851 Ga0501212_037906 Ga0501212_037906_236_616 126
307 3300050492 nmdc:mga0yw44_1103890_c1 nmdc:mga0yw44_1103890_c1_20_400 126
308 3300050493 nmdc:mga0k408_202060_c1 nmdc:mga0k408_202060_c1_697_1077 126
309 3300050493 nmdc:mga0k408_78256_c1 nmdc:mga0k408_78256_c1_1116_1496 126
310 3300050496 nmdc:mga07m45_1873_c1 nmdc:mga07m45_1873_c1_3233_3613 126
311 3300050516 nmdc:mga0sz30_43501_c1 nmdc:mga0sz30_43501_c1_175_555 126
312 3300053079 Ga0500610_0000486 Ga0500610_0000486_6416_6796 126
313 3300053087 Ga0500643_000004 Ga0500643_000004_568724_569116 126
314 3300053087 Ga0500643_098895 Ga0500643_098895_292_672 126
315 3300053092 Ga0500583_0279970 Ga0500583_0279970_370_750 126
316 3300053108 Ga0500562_000537 Ga0500562_000537_1128_1508 126
317 3300053116 Ga0500592_007754 Ga0500592_007754_706_1086 126
318 3300053118 Ga0500594_0026365 Ga0500594_0026365_206_586 126
319 3300053119 Ga0500595_000375 Ga0500595_000375_19326_19706 126
320 3300053122 Ga0500608_000515 Ga0500608_000515_4567_4947 126
321 3300053130 Ga0500642_0000195 Ga0500642_0000195_12907_13287 126
322 3300053136 Ga0500559_0191164 Ga0500559_0191164_558_950 126
323 3300053138 Ga0500564_000436 Ga0500564_000436_3836_4216 126
324 3300053151 Ga0500604_0069783 Ga0500604_0069783_342_722 126
325 3300053154 Ga0500619_131816 Ga0500619_131816_432_812 126
326 3300053156 Ga0500622_0001744 Ga0500622_0001744_14901_15281 126
327 3300053159 Ga0500630_210037 Ga0500630_210037_351_731 126
328 3300053723 Ga0500567_000322 Ga0500567_000322_8441_8821 126
329 3300053729 Ga0500625_000034 Ga0500625_000034_2457_2837 126
330 3300053730 Ga0500645_000009 Ga0500645_000009_69417_69797 126
331 3300053730 Ga0500645_104077 Ga0500645_104077_31_411 126
332 3300053731 Ga0500609_015730 Ga0500609_015730_583_963 126
333 3300053735 Ga0500596_000536 Ga0500596_000536_5466_5846 126
334 3300055283 Ga0500661_040830 Ga0500661_040830_166_546 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

5

115

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.9001 3 126
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.893 3 126
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.8557 4 114
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.8488 1 122
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.8342 2 118
ID Description Score Start End Superfamily
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9518 4 114 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8552 4 114 3.40.50.1010
af_P9WF67_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8536 4 111 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8518 4 124 3.40.50.1010
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8454 4 102 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A4P6XA50-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9783 1 126 GO:0004518
GO:0046872
AF-A0A2G4GCW7-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9758 3 126 GO:0004518
GO:0046872
AF-A0A5C7S0V5-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9743 2 126 GO:0004518
GO:0046872
AF-I9WF06-F1-model_v4 PilT-like protein 0.9731 1 126 GO:0004518
GO:0046872
AF-A0A496XDY9-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9719 3 108 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map