F411037

General Info

Members Datasets Scaffolds Average Seq Length
332 223 296 271

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0008034|Ga0466961_0008034_3052_3942
Length 296
Sequence VTSTRGGATLADLLPTGTRDLLAGVGRRVGAVENSIRFLGDMVVFTARALAAIPLVLRRYRAEVMRQIGQLTLGTGLFITFTGTLMVVIAESLFIGIEVGVEGFQSLNIIGIAPLTGFVSAYGNTREIAPIIAAVAVASQIGCKFTSQLGAQRISEEIDALEVMAIPSIPYLVTTRIVGAFTVIIPLYLVGLFGSYIATRYTVTIFFGQSTGTYDHYFNQFLRNIDIFYSVVKVMVFTIFITIIHTYYGYNAAGGPAGVGRATARAIRATTVIIAASDVLMTMLFWGLHGVRLGGG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2643221576 Nocardioides sp. Root614 Isolate Unclassified
5 2643221590 Nocardioides sp. Root682 Isolate Unclassified
6 2643221604 Nocardioides sp. Root190 Isolate Unclassified
7 2643221641 Nocardioides sp. Root122 Isolate Unclassified
8 2643221692 Nocardia sp. Root136 Isolate Unclassified
9 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
10 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
11 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2739367898 Nocardioides sp. CF479 Isolate Unclassified
14 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
15 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
16 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
17 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
18 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
19 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
20 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
21 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
22 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
23 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
24 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
25 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
26 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
27 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
28 2922554459 Rhodococcus sp. 66b Isolate Unclassified
29 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
223 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 0
Isolates 10.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 0.6
Rhizoplane 5.42
Rhizosphere 71.99
Stem 0
Stem Tuber 0
Unclassified 12.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10034565 3300001989 Bacteria 1722
2 JGI24738J21930_10002723 3300002075 Bacteria 4548
3 Ga0070658_10156659 3300005327 Bacteria 1910
4 Ga0070676_10202792 3300005328 Bacteria 1301
5 Ga0070670_100057222 3300005331 Bacteria 3347
6 Ga0068869_100138684 3300005334 Bacteria 1876
7 Ga0070682_100017488 3300005337 Bacteria 4180
8 Ga0070682_100250641 3300005337 Bacteria 1276
9 Ga0070660_100077431 3300005339 Bacteria 2606
10 Ga0070689_100582558 3300005340 Bacteria 967
11 Ga0070661_100468101 3300005344 Bacteria 1005
12 Ga0070668_100107325 3300005347 Bacteria 2219
13 Ga0070668_100177074 3300005347 Bacteria 1740
14 Ga0070669_100300354 3300005353 Bacteria 1291
15 Ga0070671_100001106 3300005355 Bacteria 19978
16 Ga0070671_100020036 3300005355 Bacteria 5449
17 Ga0070671_100079274 3300005355 Bacteria 2745
18 Ga0070667_100024306 3300005367 Bacteria 5032
19 Ga0070667_100087698 3300005367 Bacteria 2671
20 Ga0070713_100416708 3300005436 Bacteria 1257
21 Ga0070663_100058715 3300005455 Bacteria 2763
22 Ga0070663_100393017 3300005455 Bacteria 1132
23 Ga0070685_10021409 3300005466 Bacteria 3514
24 Ga0068853_100205844 3300005539 Bacteria 1792
25 Ga0070686_100037743 3300005544 Bacteria 2998
26 Ga0070665_100001212 3300005548 Bacteria 31450
27 Ga0070665_100001291 3300005548 Bacteria 29963
28 Ga0070665_100017616 3300005548 Bacteria 7175
29 Ga0070665_100128245 3300005548 Bacteria 2539
30 Ga0068855_100097844 3300005563 Bacteria 3380
31 Ga0068855_100617454 3300005563 Bacteria 1168
32 Ga0068852_100006783 3300005616 Bacteria 8308
33 Ga0068859_100127727 3300005617 Bacteria 2613
34 Ga0068859_100217744 3300005617 Bacteria 1997
35 Ga0068864_100072007 3300005618 Bacteria 3011
36 Ga0068861_100045108 3300005719 Bacteria 3317
37 Ga0068851_10078913 3300005834 Bacteria 1716
38 Ga0068863_100002702 3300005841 Bacteria 17515
39 Ga0068863_100377962 3300005841 Bacteria 1383
40 Ga0068858_100089332 3300005842 Bacteria 2867
41 Ga0068858_100172202 3300005842 Bacteria 2041
42 Ga0068860_100005801 3300005843 Bacteria 12434
43 Ga0068860_100101678 3300005843 Bacteria 2742
44 Ga0081455_10000360 3300005937 Bacteria 59979
45 Ga0081455_10255589 3300005937 Bacteria 1279
46 Ga0070717_10235836 3300006028 Bacteria 1612
47 Ga0075365_10104930 3300006038 Bacteria 1938
48 Ga0075365_10242501 3300006038 Bacteria 1266
49 Ga0075368_10060664 3300006042 Bacteria 1514
50 Ga0075363_100014524 3300006048 Bacteria 3851
51 Ga0075363_100036179 3300006048 Bacteria 2588
52 Ga0075363_100105228 3300006048 Bacteria 1565
53 Ga0075364_10010245 3300006051 Bacteria 5656
54 Ga0075364_10058728 3300006051 Bacteria 2521
55 Ga0075364_10076930 3300006051 Bacteria 2203
56 Ga0075364_10099942 3300006051 Bacteria 1931
57 Ga0075364_10169661 3300006051 Bacteria 1475
58 Ga0075367_10019261 3300006178 Bacteria 3782
59 Ga0075367_10047260 3300006178 Bacteria 2532
60 Ga0075369_10034046 3300006186 Bacteria 2161
61 Ga0097621_100143139 3300006237 Bacteria 2044
62 Ga0075370_10006102 3300006353 Bacteria 6042
63 Ga0075370_10023446 3300006353 Bacteria 3399
64 Ga0075370_10042323 3300006353 Bacteria 2573
65 Ga0075370_10155914 3300006353 Bacteria 1339
66 Ga0097620_100127727 3300006931 Bacteria 2613
67 Ga0097620_100217754 3300006931 Bacteria 1997
68 Ga0099795_10065273 3300007788 Bacteria 1361
69 Ga0105250_10023924 3300009092 Bacteria 2462
70 Ga0111539_10222413 3300009094 Bacteria 2199
71 Ga0105245_10026353 3300009098 Bacteria 5116
72 Ga0105245_10707245 3300009098 Bacteria 1041
73 Ga0105247_10036309 3300009101 Bacteria 3004
74 Ga0114129_10260952 3300009147 Bacteria 2322
75 Ga0105243_10073886 3300009148 Bacteria 2764
76 Ga0105241_10107312 3300009174 Bacteria 2230
77 Ga0105248_10088940 3300009177 Bacteria 3476
78 Ga0105237_10227721 3300009545 Bacteria 1865
79 Ga0105237_10450685 3300009545 Bacteria 1293
80 Ga0105238_10047092 3300009551 Bacteria 4349
81 Ga0105249_10260852 3300009553 Bacteria 1722
82 Ga0099796_10010379 3300010159 Bacteria 2559
83 Ga0105239_10344089 3300010375 Bacteria 1683
84 Ga0105246_10090213 3300011119 Bacteria 2207
85 Ga0157371_10218855 3300013102 Bacteria 1367
86 Ga0157369_10206698 3300013105 Bacteria 2059
87 Ga0157369_10446638 3300013105 Bacteria 1339
88 Ga0157369_10678195 3300013105 Bacteria 1062
89 Ga0157378_10366588 3300013297 Bacteria 1411
90 Ga0163162_10106359 3300013306 Bacteria 2901
91 Ga0163162_10408076 3300013306 Bacteria 1491
92 Ga0157375_10092916 3300013308 Bacteria 3082
93 Ga0163163_10151187 3300014325 Bacteria 2365
94 Ga0163163_10379167 3300014325 Bacteria 1472
95 Ga0163163_10901103 3300014325 Bacteria 948
96 Ga0157379_10059550 3300014968 Bacteria 3414
97 Ga0157379_10440577 3300014968 Bacteria 1201
98 Ga0207656_10048919 3300025321 Bacteria 1822
99 Ga0207645_10207055 3300025907 Bacteria 1291
100 Ga0207643_10013684 3300025908 Bacteria 4398
101 Ga0207705_10170698 3300025909 Bacteria 1637
102 Ga0207654_10080243 3300025911 Bacteria 1961
103 Ga0207671_10310014 3300025914 Bacteria 1247
104 Ga0207657_10019728 3300025919 Bacteria 6392
105 Ga0207681_10332401 3300025923 Bacteria 1212
106 Ga0207694_10114545 3300025924 Bacteria 2147
107 Ga0207687_10015620 3300025927 Bacteria 4980
108 Ga0207700_10440344 3300025928 Bacteria 1147
109 Ga0207664_10174496 3300025929 Bacteria 1842
110 Ga0207644_10003632 3300025931 Bacteria 10005
111 Ga0207644_10077901 3300025931 Bacteria 2442
112 Ga0207690_10062603 3300025932 Bacteria 2534
113 Ga0207689_10043631 3300025942 Bacteria 3707
114 Ga0207679_10098252 3300025945 Bacteria 2282
115 Ga0207712_10155169 3300025961 Bacteria 1773
116 Ga0207668_10199566 3300025972 Bacteria 1592
117 Ga0207658_10151930 3300025986 Bacteria 1887
118 Ga0207677_10095133 3300026023 Bacteria 2176
119 Ga0207703_10226920 3300026035 Bacteria 1672
120 Ga0207678_10018777 3300026067 Bacteria 6073
121 Ga0207678_10151556 3300026067 Bacteria 1980
122 Ga0207702_10054600 3300026078 Bacteria 3386
123 Ga0207641_10025067 3300026088 Bacteria 4917
124 Ga0207641_10036172 3300026088 Bacteria 4120
125 Ga0207641_10352339 3300026088 Bacteria 1403
126 Ga0207648_10100959 3300026089 Bacteria 2528
127 Ga0207676_10102077 3300026095 Bacteria 2380
128 Ga0207675_100014006 3300026118 Bacteria 7477
129 Ga0207698_10006374 3300026142 Bacteria 7354
130 Ga0209179_1045866 3300027512 Bacteria 928
131 Ga0268266_10002730 3300028379 Bacteria 18484
132 Ga0268266_10004062 3300028379 Bacteria 14146
133 Ga0268265_10049435 3300028380 Bacteria 3163
134 Ga0268264_10088563 3300028381 Bacteria 2664
135 Ga0268264_10371506 3300028381 Bacteria 1367
136 Ga0265336_10005477 3300028666 Bacteria 4678
137 Ga0307515_10458601 3300028794 Bacteria 889
138 Ga0316181_1286488 3300030744 Bacteria 5901
139 Ga0316182_1072268 3300030745 Bacteria 4773
140 Ga0307513_10008553 3300031456 Bacteria 13083
141 Ga0307405_10230399 3300031731 Bacteria 1365
142 Ga0307407_10149347 3300031903 Bacteria 1517
143 Ga0307412_10195638 3300031911 Bacteria 1532
144 Ga0307409_100177881 3300031995 Bacteria 1880
145 Ga0307416_100163216 3300032002 Bacteria 2063
146 Ga0395900_0095466 3300037418 Bacteria 3055
147 Ga0395898_0343694 3300037466 Bacteria 1423
148 Ga0395901_0799292 3300038443 Bacteria 932
149 Ga0439466_0053797 3300041411 Bacteria 1312
150 Ga0439465_0002711 3300041413 Bacteria 5788
151 Ga0439465_0033468 3300041413 Bacteria 1643
152 Ga0451793_1470662 3300041452 Bacteria 2283
153 Ga0451795_0595851 3300041456 Bacteria 1911
154 Ga0451833_0349589 3300041491 Bacteria 2775
155 Ga0451853_0505843 3300041512 Bacteria 1623
156 Ga0439442_007529 3300042002 Bacteria 2191
157 Ga0439445_0015489 3300042004 Bacteria 1868
158 Ga0439445_0083329 3300042004 Bacteria 895
159 Ga0439458_0019318 3300042157 Bacteria 1568
160 Ga0439459_0002990 3300042438 Bacteria 2652
161 Ga0466969_0029710 3300044656 Bacteria 2790
162 Ga0466972_0000932 3300044658 Bacteria 14072
163 Ga0466972_0008655 3300044658 Bacteria 5105
164 Ga0466972_0110244 3300044658 Bacteria 1301
165 Ga0466972_0120062 3300044658 Bacteria 1240
166 Ga0466965_0013484 3300044683 Bacteria 3857
167 Ga0466965_0016440 3300044683 Bacteria 3522
168 Ga0466966_0000562 3300044684 Bacteria 23668
169 Ga0466966_0016556 3300044684 Bacteria 4868
170 Ga0466961_0006272 3300044693 Bacteria 7551
171 Ga0466961_0008034 3300044693 Bacteria 6724
172 Ga0466961_0008893 3300044693 Bacteria 6405
173 Ga0466961_0022980 3300044693 Bacteria 4011
174 Ga0466961_0034897 3300044693 Bacteria 3230
175 Ga0466961_0108464 3300044693 Bacteria 1748
176 Ga0466961_0115382 3300044693 Bacteria 1688
177 Ga0466961_0169746 3300044693 Bacteria 1357
178 Ga0466963_0002108 3300044694 Bacteria 11000
179 Ga0466963_0023604 3300044694 Bacteria 3908
180 Ga0466963_0031067 3300044694 Bacteria 3450
181 Ga0466963_0086223 3300044694 Bacteria 2133
182 Ga0466964_0039708 3300044706 Bacteria 1898
183 Ga0466971_0039767 3300044719 Bacteria 2111
184 Ga0466968_0000286 3300044735 Bacteria 16083
185 Ga0466968_0125373 3300044735 Bacteria 1165
186 Ga0466970_0003750 3300044765 Bacteria 7432
187 Ga0466970_0033479 3300044765 Bacteria 2716
188 Ga0466957_0105731 3300044842 Bacteria 1779
189 Ga0466957_0170055 3300044842 Bacteria 1419
190 Ga0466957_0285666 3300044842 Bacteria 1105
191 Ga0466960_0005088 3300044901 Bacteria 5195
192 Ga0466960_0174227 3300044901 Bacteria 1163
193 Ga0466959_0028762 3300045049 Bacteria 4119
194 Ga0466959_0044748 3300045049 Bacteria 3261
195 Ga0466959_0343509 3300045049 Bacteria 1018
196 Ga0466958_0019629 3300045836 Bacteria 3934
197 Ga0466958_0043868 3300045836 Bacteria 2694
198 Ga0466958_0084595 3300045836 Bacteria 1956
199 Ga0466958_0173638 3300045836 Bacteria 1365
200 Ga0466967_0002628 3300045976 Bacteria 11311
201 Ga0466967_0003302 3300045976 Bacteria 10475
202 Ga0466967_0013778 3300045976 Bacteria 6266
203 Ga0466967_0018345 3300045976 Bacteria 5589
204 Ga0466967_0056929 3300045976 Bacteria 3449
205 Ga0466967_0057017 3300045976 Bacteria 3447
206 Ga0466967_0146205 3300045976 Bacteria 2205
207 Ga0495653_0153225 3300046463 Bacteria 1608
208 Ga0495653_0206435 3300046463 Bacteria 1330
209 Ga0495650_0030282 3300046471 Bacteria 2454
210 Ga0495580_0205207 3300046472 Bacteria 1357
211 Ga0495668_0000407 3300046616 Bacteria 56229
212 Ga0495668_0048927 3300046616 Bacteria 2344
213 Ga0495581_0015476 3300047315 Bacteria 4429
214 Ga0495683_0000314 3300047323 Bacteria 40788
215 Ga0496100_0006244 3300048903 Bacteria 6487
216 Ga0496101_0006973 3300048904 Bacteria 7295
217 Ga0496101_0045694 3300048904 Bacteria 3138
218 Ga0496102_0000772 3300048905 Bacteria 31172
219 Ga0496102_0409212 3300048905 Bacteria 1274
220 Ga0496103_0000018 3300048906 Bacteria 239585
221 Ga0496104_0029902 3300048907 Bacteria 5058
222 Ga0496105_0013729 3300048908 Bacteria 6432
223 Ga0496105_0042390 3300048908 Bacteria 3752
224 Ga0496105_0680822 3300048908 Bacteria 791
225 Ga0496108_0029153 3300048911 Bacteria 4569
226 Ga0496108_0078849 3300048911 Bacteria 2788
227 Ga0496109_0108237 3300048912 Bacteria 2583
228 Ga0496109_0214456 3300048912 Bacteria 1810
229 Ga0496110_0052506 3300048913 Bacteria 3582
230 Ga0496114_0135329 3300048917 Bacteria 2131
231 Ga0496116_0000173 3300048919 Bacteria 129928
232 Ga0496117_0000144 3300048920 Bacteria 153831
233 Ga0496118_0000096 3300048921 Bacteria 163988
234 Ga0496119_0001793 3300048922 Bacteria 25009
235 Ga0496119_0167966 3300048922 Bacteria 1161
236 Ga0496120_0034752 3300048923 Bacteria 3016
237 Ga0496121_0026060 3300048924 Bacteria 5526
238 Ga0496124_0012327 3300048927 Bacteria 8443
239 Ga0496125_0032164 3300048928 Bacteria 4663
240 Ga0496125_0037356 3300048928 Bacteria 4223
241 Ga0496125_0084204 3300048928 Bacteria 2415
242 Ga0496126_0000330 3300048929 Bacteria 101064
243 Ga0496126_0288471 3300048929 Bacteria 1358
244 Ga0501031_0206513 3300049568 Bacteria 1281
245 Ga0501032_0006037 3300049569 Bacteria 8937
246 Ga0501033_0224123 3300049570 Bacteria 1337
247 Ga0501034_0131518 3300049571 Bacteria 2485
248 Ga0501036_0002686 3300049572 Bacteria 14031
249 Ga0501037_0037803 3300049573 Bacteria 3559
250 Ga0501038_0000987 3300049574 Bacteria 25574
251 Ga0501038_0008702 3300049574 Bacteria 9317
252 Ga0501039_0027681 3300049575 Bacteria 4359
253 Ga0501039_0038886 3300049575 Bacteria 3674
254 Ga0501039_0069236 3300049575 Bacteria 2740
255 Ga0501039_0331485 3300049575 Bacteria 1196
256 Ga0501040_0202444 3300049576 Bacteria 1410
257 Ga0501041_0134953 3300049577 Bacteria 1538
258 Ga0501041_0181855 3300049577 Bacteria 1316
259 Ga0501042_0018782 3300049578 Bacteria 4791
260 Ga0501043_0005783 3300049579 Bacteria 9952
261 Ga0501043_0044559 3300049579 Bacteria 3488
262 Ga0501046_0020411 3300049580 Bacteria 5480
263 Ga0501047_0000660 3300049581 Bacteria 36046
264 Ga0501047_0023978 3300049581 Bacteria 5859
265 Ga0501047_0113581 3300049581 Bacteria 2591
266 Ga0501048_0000630 3300049582 Bacteria 25188
267 Ga0501048_0033085 3300049582 Bacteria 3736
268 Ga0501070_0004851 3300049586 Bacteria 11492
269 Ga0501071_0310650 3300049587 Bacteria 1196
270 Ga0501073_0010268 3300049589 Bacteria 6876
271 Ga0501074_0011102 3300049590 Bacteria 6541
272 Ga0501075_0132914 3300049591 Bacteria 1896
273 Ga0501075_0190342 3300049591 Bacteria 1565
274 Ga0501076_0573144 3300049592 Bacteria 931
275 Ga0501035_0012627 3300049822 Bacteria 7805
276 Ga0501044_0089207 3300049823 Bacteria 3112
277 Ga0501044_0656787 3300049823 Bacteria 937
278 Ga0501045_0172098 3300049824 Bacteria 1613
279 nmdc:mga03683_61029_c1 3300050489 Bacteria 1593
280 nmdc:mga03683_9132_c1 3300050489 Bacteria 3512
281 nmdc:mga03n38_23470_c1 3300050490 Bacteria 2510
282 nmdc:mga03n38_72608_c1 3300050490 Bacteria 1596
283 nmdc:mga00v17_18812_c1 3300050491 Bacteria 3931
284 nmdc:mga00v17_237187_c1 3300050491 Bacteria 1182
285 nmdc:mga00v17_277026_c1 3300050491 Bacteria 1089
286 nmdc:mga0yw44_241619_c1 3300050492 Bacteria 1200
287 nmdc:mga0yw44_24421_c1 3300050492 Bacteria 3420
288 nmdc:mga06z11_22325_c1 3300050494 Bacteria 2954
289 nmdc:mga07m45_143516_c1 3300050496 Bacteria 1383
290 nmdc:mga07m45_220156_c1 3300050496 Bacteria 1104
291 nmdc:mga05p37_449722_c1 3300050507 Bacteria 1491
292 nmdc:mga0sz30_54031_c1 3300050516 Bacteria 1708
293 Ga0500641_0002983 3300053096 Bacteria 5992
294 Ga0501084_0453512 3300054114 Bacteria 1084
295 Ga0466962_0022722 3300061719 Bacteria 3014
296 Ga0466962_0046956 3300061719 Bacteria 2063

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10065273 Ga0099795_100652731 222
2 3300027512 Ga0209179_1045866 Ga0209179_10458661 230
3 3300049577 Ga0501041_0134953 Ga0501041_0134953_44_742 232
4 3300049591 Ga0501075_0132914 Ga0501075_0132914_1183_1881 232
5 3300005355 Ga0070671_100079274 Ga0070671_1000792742 239
6 3300025928 Ga0207700_10440344 Ga0207700_104403442 240
7 3300048908 Ga0496105_0680822 Ga0496105_0680822_34_756 240
8 3300006048 Ga0075363_100014524 Ga0075363_1000145243 241
9 3300006051 Ga0075364_10010245 Ga0075364_100102454 241
10 3300006353 Ga0075370_10042323 Ga0075370_100423233 241
11 3300046616 Ga0495668_0048927 Ga0495668_0048927_832_1704 241
12 3300048928 Ga0496125_0084204 Ga0496125_0084204_276_1148 241
13 3300050490 nmdc:mga03n38_72608_c1 nmdc:mga03n38_72608_c1_178_1050 241
14 3300009092 Ga0105250_10023924 Ga0105250_100239242 243
15 3300009098 Ga0105245_10707245 Ga0105245_107072452 243
16 3300009147 Ga0114129_10260952 Ga0114129_102609522 243
17 3300009177 Ga0105248_10088940 Ga0105248_100889403 243
18 3300013105 Ga0157369_10678195 Ga0157369_106781952 243
19 3300013306 Ga0163162_10408076 Ga0163162_104080762 243
20 3300014325 Ga0163163_10379167 Ga0163163_103791672 243
21 3300042157 Ga0439458_0019318 Ga0439458_0019318_466_1260 243
22 3300042438 Ga0439459_0002990 Ga0439459_0002990_1081_1875 243
23 3300048904 Ga0496101_0045694 Ga0496101_0045694_1231_2025 243
24 3300048905 Ga0496102_0409212 Ga0496102_0409212_193_987 243
25 3300048907 Ga0496104_0029902 Ga0496104_0029902_3662_4456 243
26 3300048908 Ga0496105_0042390 Ga0496105_0042390_1962_2756 243
27 3300048911 Ga0496108_0078849 Ga0496108_0078849_1312_2106 243
28 3300048912 Ga0496109_0108237 Ga0496109_0108237_24_818 243
29 3300050489 nmdc:mga03683_9132_c1 nmdc:mga03683_9132_c1_1848_2642 243
30 3300050491 nmdc:mga00v17_18812_c1 nmdc:mga00v17_18812_c1_592_1386 243
31 3300050492 nmdc:mga0yw44_24421_c1 nmdc:mga0yw44_24421_c1_130_924 243
32 3300050507 nmdc:mga05p37_449722_c1 nmdc:mga05p37_449722_c1_211_1005 243
33 3300050516 nmdc:mga0sz30_54031_c1 nmdc:mga0sz30_54031_c1_470_1264 243
34 3300005340 Ga0070689_100582558 Ga0070689_1005825581 249
35 3300028666 Ga0265336_10005477 Ga0265336_100054772 249
36 3300010159 Ga0099796_10010379 Ga0099796_100103792 250
37 3300046463 Ga0495653_0206435 Ga0495653_0206435_209_1135 250
38 3300005331 Ga0070670_100057222 Ga0070670_1000572222 252
39 3300005347 Ga0070668_100107325 Ga0070668_1001073252 252
40 3300005355 Ga0070671_100020036 Ga0070671_1000200363 252
41 3300005367 Ga0070667_100024306 Ga0070667_1000243062 252
42 3300005544 Ga0070686_100037743 Ga0070686_1000377432 252
43 3300005548 Ga0070665_100017616 Ga0070665_1000176164 252
44 3300005617 Ga0068859_100127727 Ga0068859_1001277272 252
45 3300005719 Ga0068861_100045108 Ga0068861_1000451082 252
46 3300005842 Ga0068858_100089332 Ga0068858_1000893323 252
47 3300005843 Ga0068860_100101678 Ga0068860_1001016783 252
48 3300006038 Ga0075365_10104930 Ga0075365_101049302 252
49 3300006048 Ga0075363_100036179 Ga0075363_1000361792 252
50 3300006051 Ga0075364_10058728 Ga0075364_100587282 252
51 3300006051 Ga0075364_10099942 Ga0075364_100999422 252
52 3300006186 Ga0075369_10034046 Ga0075369_100340462 252
53 3300006353 Ga0075370_10155914 Ga0075370_101559142 252
54 3300006931 Ga0097620_100127727 Ga0097620_1001277273 252
55 3300025931 Ga0207644_10077901 Ga0207644_100779012 252
56 3300025961 Ga0207712_10155169 Ga0207712_101551692 252
57 3300025986 Ga0207658_10151930 Ga0207658_101519302 252
58 3300026035 Ga0207703_10226920 Ga0207703_102269202 252
59 3300026088 Ga0207641_10025067 Ga0207641_100250674 252
60 3300026118 Ga0207675_100014006 Ga0207675_1000140064 252
61 3300028379 Ga0268266_10004062 Ga0268266_100040623 252
62 3300028380 Ga0268265_10049435 Ga0268265_100494352 252
63 3300028381 Ga0268264_10088563 Ga0268264_100885632 252
64 3300050489 nmdc:mga03683_61029_c1 nmdc:mga03683_61029_c1_327_1187 252
65 3300050490 nmdc:mga03n38_23470_c1 nmdc:mga03n38_23470_c1_104_964 252
66 3300050496 nmdc:mga07m45_143516_c1 nmdc:mga07m45_143516_c1_498_1358 252
67 3300006028 Ga0070717_10235836 Ga0070717_102358361 253
68 3300041411 Ga0439466_0053797 Ga0439466_0053797_432_1289 253
69 3300041413 Ga0439465_0002711 Ga0439465_0002711_1873_2730 253
70 3300042002 Ga0439442_007529 Ga0439442_007529_742_1599 253
71 3300005436 Ga0070713_100416708 Ga0070713_1004167082 254
72 3300045836 Ga0466958_0084595 Ga0466958_0084595_1179_1946 254
73 3300006353 Ga0075370_10006102 Ga0075370_100061024 255
74 3300041512 Ga0451853_0505843 Ga0451853_0505843_429_1289 255
75 3300046472 Ga0495580_0205207 Ga0495580_0205207_130_990 255
76 3300046616 Ga0495668_0000407 Ga0495668_0000407_11013_11873 255
77 3300047315 Ga0495581_0015476 Ga0495581_0015476_1737_2597 255
78 3300048911 Ga0496108_0029153 Ga0496108_0029153_1117_1977 255
79 3300048928 Ga0496125_0032164 Ga0496125_0032164_167_1027 255
80 3300048929 Ga0496126_0288471 Ga0496126_0288471_430_1290 255
81 3300050491 nmdc:mga00v17_237187_c1 nmdc:mga00v17_237187_c1_184_1044 255
82 3300050496 nmdc:mga07m45_220156_c1 nmdc:mga07m45_220156_c1_150_1010 255
83 3300006048 Ga0075363_100105228 Ga0075363_1001052282 258
84 3300006353 Ga0075370_10023446 Ga0075370_100234463 258
85 3300042004 Ga0439445_0083329 Ga0439445_0083329_25_801 258
86 3300005937 Ga0081455_10255589 Ga0081455_102555892 260
87 iso_pu_bacteria 2919713450 2919717152 260
88 3300044658 Ga0466972_0008655 Ga0466972_0008655_3265_4128 263
89 3300044735 Ga0466968_0125373 Ga0466968_0125373_252_1115 263
90 3300047323 Ga0495683_0000314 Ga0495683_0000314_30575_31432 263
91 3300049823 Ga0501044_0656787 Ga0501044_0656787_34_891 263
92 3300005328 Ga0070676_10202792 Ga0070676_102027922 264
93 3300005334 Ga0068869_100138684 Ga0068869_1001386842 264
94 3300005337 Ga0070682_100017488 Ga0070682_1000174884 264
95 3300005339 Ga0070660_100077431 Ga0070660_1000774313 264
96 3300005344 Ga0070661_100468101 Ga0070661_1004681011 264
97 3300005347 Ga0070668_100177074 Ga0070668_1001770742 264
98 3300005455 Ga0070663_100058715 Ga0070663_1000587152 264
99 3300005466 Ga0070685_10021409 Ga0070685_100214093 264
100 3300005539 Ga0068853_100205844 Ga0068853_1002058442 264
101 3300005548 Ga0070665_100128245 Ga0070665_1001282452 264
102 3300005617 Ga0068859_100217744 Ga0068859_1002177443 264
103 3300005618 Ga0068864_100072007 Ga0068864_1000720073 264
104 3300005834 Ga0068851_10078913 Ga0068851_100789132 264
105 3300005842 Ga0068858_100172202 Ga0068858_1001722022 264
106 3300006237 Ga0097621_100143139 Ga0097621_1001431392 264
107 3300006931 Ga0097620_100217754 Ga0097620_1002177543 264
108 3300009094 Ga0111539_10222413 Ga0111539_102224133 264
109 3300009148 Ga0105243_10073886 Ga0105243_100738863 264
110 3300009174 Ga0105241_10107312 Ga0105241_101073122 264
111 3300009545 Ga0105237_10227721 Ga0105237_102277212 264
112 3300009551 Ga0105238_10047092 Ga0105238_100470922 264
113 3300009553 Ga0105249_10260852 Ga0105249_102608522 264
114 3300011119 Ga0105246_10090213 Ga0105246_100902132 264
115 3300013102 Ga0157371_10218855 Ga0157371_102188552 264
116 3300013105 Ga0157369_10206698 Ga0157369_102066982 264
117 3300013297 Ga0157378_10366588 Ga0157378_103665882 264
118 3300013306 Ga0163162_10106359 Ga0163162_101063594 264
119 3300013308 Ga0157375_10092916 Ga0157375_100929163 264
120 3300014325 Ga0163163_10151187 Ga0163163_101511872 264
121 3300014968 Ga0157379_10440577 Ga0157379_104405772 264
122 3300025321 Ga0207656_10048919 Ga0207656_100489192 264
123 3300025907 Ga0207645_10207055 Ga0207645_102070552 264
124 3300025908 Ga0207643_10013684 Ga0207643_100136843 264
125 3300025909 Ga0207705_10170698 Ga0207705_101706982 264
126 3300025919 Ga0207657_10019728 Ga0207657_100197285 264
127 3300025924 Ga0207694_10114545 Ga0207694_101145452 264
128 3300025929 Ga0207664_10174496 Ga0207664_101744962 264
129 3300025932 Ga0207690_10062603 Ga0207690_100626033 264
130 3300025942 Ga0207689_10043631 Ga0207689_100436314 264
131 3300025945 Ga0207679_10098252 Ga0207679_100982521 264
132 3300025972 Ga0207668_10199566 Ga0207668_101995662 264
133 3300026023 Ga0207677_10095133 Ga0207677_100951332 264
134 3300026067 Ga0207678_10018777 Ga0207678_100187775 264
135 3300026078 Ga0207702_10054600 Ga0207702_100546003 264
136 3300026089 Ga0207648_10100959 Ga0207648_101009591 264
137 3300048912 Ga0496109_0214456 Ga0496109_0214456_810_1604 264
138 3300048917 Ga0496114_0135329 Ga0496114_0135329_353_1147 264
139 iso_pu_bacteria 2866612099 2866614717 265
140 3300005563 Ga0068855_100097844 Ga0068855_1000978443 266
141 3300005616 Ga0068852_100006783 Ga0068852_1000067837 266
142 3300005937 Ga0081455_10000360 Ga0081455_1000036024 266
143 3300006051 Ga0075364_10076930 Ga0075364_100769302 266
144 3300009098 Ga0105245_10026353 Ga0105245_100263535 266
145 3300010375 Ga0105239_10344089 Ga0105239_103440892 266
146 3300025911 Ga0207654_10080243 Ga0207654_100802432 266
147 3300025927 Ga0207687_10015620 Ga0207687_100156202 266
148 3300026142 Ga0207698_10006374 Ga0207698_100063743 266
149 3300044735 Ga0466968_0000286 Ga0466968_0000286_4917_5717 266
150 3300050491 nmdc:mga00v17_277026_c1 nmdc:mga00v17_277026_c1_240_1064 266
151 3300005563 Ga0068855_100617454 Ga0068855_1006174541 267
152 iso_pu_bacteria 2643221961 2645720384 267
153 3300006042 Ga0075368_10060664 Ga0075368_100606642 268
154 3300006178 Ga0075367_10019261 Ga0075367_100192613 268
155 3300044765 Ga0466970_0003750 Ga0466970_0003750_3451_4257 268
156 3300044842 Ga0466957_0285666 Ga0466957_0285666_218_1024 268
157 3300046463 Ga0495653_0153225 Ga0495653_0153225_557_1447 268
158 3300048922 Ga0496119_0167966 Ga0496119_0167966_247_1107 268
159 iso_pu_bacteria 2643221962 2645723325 268
160 iso_pu_bacteria 2929212328 2929213883 268
161 3300044693 Ga0466961_0115382 Ga0466961_0115382_145_1008 269
162 iso_pu_bacteria 2915358134 2915358555 269
163 iso_pu_bacteria 2643221641 2644229778 270
164 iso_pu_bacteria 2739367898 2740168209 270
165 iso_pu_bacteria 8054609563 8054613600 270
166 3300030744 Ga0316181_1286488 Ga0316181_12864883 271
167 3300030745 Ga0316182_1072268 Ga0316182_10722682 271
168 3300044684 Ga0466966_0016556 Ga0466966_0016556_2607_3425 271
169 3300049592 Ga0501076_0573144 Ga0501076_0573144_49_864 271
170 iso_pu_bacteria 2643221576 2643891876 271
171 iso_pu_bacteria 2643221590 2643960928 271
172 iso_pu_bacteria 2643221604 2644031988 271
173 iso_pu_bacteria 2811994874 2812334756 271
174 iso_pu_bacteria 2855386786 2855388205 271
175 iso_pu_bacteria 2855386786 2855391202 271
176 iso_pu_bacteria 8054472261 8054473563 271
177 3300041456 Ga0451795_0595851 Ga0451795_0595851_848_1666 272
178 3300045976 Ga0466967_0013778 Ga0466967_0013778_648_1481 272
179 3300046471 Ga0495650_0030282 Ga0495650_0030282_627_1445 272
180 3300005548 Ga0070665_100001212 Ga0070665_10000121225 273
181 3300028379 Ga0268266_10002730 Ga0268266_100027306 273
182 3300041413 Ga0439465_0033468 Ga0439465_0033468_562_1419 273
183 iso_pu_bacteria 2842134933 2842138914 273
184 3300006038 Ga0075365_10242501 Ga0075365_102425012 274
185 3300031731 Ga0307405_10230399 Ga0307405_102303992 274
186 3300031903 Ga0307407_10149347 Ga0307407_101493472 274
187 3300031911 Ga0307412_10195638 Ga0307412_101956382 274
188 3300031995 Ga0307409_100177881 Ga0307409_1001778812 274
189 3300032002 Ga0307416_100163216 Ga0307416_1001632162 274
190 3300044658 Ga0466972_0110244 Ga0466972_0110244_264_1109 274
191 3300049575 Ga0501039_0027681 Ga0501039_0027681_558_1382 274
192 3300049575 Ga0501039_0069236 Ga0501039_0069236_923_1747 274
193 3300049576 Ga0501040_0202444 Ga0501040_0202444_267_1091 274
194 3300049577 Ga0501041_0181855 Ga0501041_0181855_57_881 274
195 3300049591 Ga0501075_0190342 Ga0501075_0190342_183_1007 274
196 3300049824 Ga0501045_0172098 Ga0501045_0172098_478_1302 274
197 3300054114 Ga0501084_0453512 Ga0501084_0453512_146_970 274
198 3300005355 Ga0070671_100001106 Ga0070671_1000011062 275
199 3300005548 Ga0070665_100001291 Ga0070665_10000129113 275
200 3300005841 Ga0068863_100002702 Ga0068863_1000027027 275
201 3300005841 Ga0068863_100377962 Ga0068863_1003779622 275
202 3300005843 Ga0068860_100005801 Ga0068860_10000580111 275
203 3300006051 Ga0075364_10169661 Ga0075364_101696612 275
204 3300006178 Ga0075367_10047260 Ga0075367_100472603 275
205 3300009101 Ga0105247_10036309 Ga0105247_100363092 275
206 3300013105 Ga0157369_10446638 Ga0157369_104466382 275
207 3300014325 Ga0163163_10901103 Ga0163163_109011031 275
208 3300014968 Ga0157379_10059550 Ga0157379_100595502 275
209 3300025931 Ga0207644_10003632 Ga0207644_100036322 275
210 3300026088 Ga0207641_10036172 Ga0207641_100361723 275
211 3300026088 Ga0207641_10352339 Ga0207641_103523392 275
212 3300026095 Ga0207676_10102077 Ga0207676_101020772 275
213 3300037418 Ga0395900_0095466 Ga0395900_0095466_231_1058 275
214 3300037466 Ga0395898_0343694 Ga0395898_0343694_440_1267 275
215 3300038443 Ga0395901_0799292 Ga0395901_0799292_79_906 275
216 3300044658 Ga0466972_0000932 Ga0466972_0000932_8282_9109 275
217 3300044683 Ga0466965_0013484 Ga0466965_0013484_878_1705 275
218 3300044683 Ga0466965_0016440 Ga0466965_0016440_1888_2715 275
219 3300044765 Ga0466970_0033479 Ga0466970_0033479_1416_2243 275
220 3300044842 Ga0466957_0170055 Ga0466957_0170055_480_1307 275
221 3300044901 Ga0466960_0005088 Ga0466960_0005088_1901_2728 275
222 3300045049 Ga0466959_0343509 Ga0466959_0343509_153_980 275
223 3300048903 Ga0496100_0006244 Ga0496100_0006244_2261_3091 275
224 3300048904 Ga0496101_0006973 Ga0496101_0006973_5362_6192 275
225 3300048905 Ga0496102_0000772 Ga0496102_0000772_16146_16976 275
226 3300048906 Ga0496103_0000018 Ga0496103_0000018_10868_11698 275
227 3300048908 Ga0496105_0013729 Ga0496105_0013729_1795_2625 275
228 3300048913 Ga0496110_0052506 Ga0496110_0052506_1469_2299 275
229 3300048919 Ga0496116_0000173 Ga0496116_0000173_55494_56324 275
230 3300048920 Ga0496117_0000144 Ga0496117_0000144_107257_108087 275
231 3300048921 Ga0496118_0000096 Ga0496118_0000096_118403_119233 275
232 3300048922 Ga0496119_0001793 Ga0496119_0001793_23975_24805 275
233 3300048923 Ga0496120_0034752 Ga0496120_0034752_443_1273 275
234 3300048924 Ga0496121_0026060 Ga0496121_0026060_2070_2900 275
235 3300048927 Ga0496124_0012327 Ga0496124_0012327_1540_2370 275
236 3300048928 Ga0496125_0037356 Ga0496125_0037356_2359_3189 275
237 3300048929 Ga0496126_0000330 Ga0496126_0000330_44750_45580 275
238 3300049568 Ga0501031_0206513 Ga0501031_0206513_100_927 275
239 3300049575 Ga0501039_0331485 Ga0501039_0331485_86_913 275
240 3300049581 Ga0501047_0113581 Ga0501047_0113581_1425_2273 275
241 3300050492 nmdc:mga0yw44_241619_c1 nmdc:mga0yw44_241619_c1_35_862 275
242 3300050494 nmdc:mga06z11_22325_c1 nmdc:mga06z11_22325_c1_1205_2032 275
243 3300053096 Ga0500641_0002983 Ga0500641_0002983_3588_4415 275
244 iso_pu_bacteria 2816332139 2816505601 275
245 3300002075 JGI24738J21930_10002723 JGI24738J21930_100027234 276
246 3300005337 Ga0070682_100250641 Ga0070682_1002506412 276
247 3300044693 Ga0466961_0108464 Ga0466961_0108464_706_1557 276
248 3300044694 Ga0466963_0023604 Ga0466963_0023604_1152_1988 276
249 3300049571 Ga0501034_0131518 Ga0501034_0131518_109_960 276
250 3300049572 Ga0501036_0002686 Ga0501036_0002686_9305_10156 276
251 3300049573 Ga0501037_0037803 Ga0501037_0037803_2105_2956 276
252 3300049574 Ga0501038_0008702 Ga0501038_0008702_6704_7555 276
253 3300049575 Ga0501039_0038886 Ga0501039_0038886_1340_2191 276
254 3300049578 Ga0501042_0018782 Ga0501042_0018782_1988_2839 276
255 3300049579 Ga0501043_0005783 Ga0501043_0005783_5306_6157 276
256 3300049581 Ga0501047_0023978 Ga0501047_0023978_3104_3955 276
257 3300049582 Ga0501048_0033085 Ga0501048_0033085_2190_3041 276
258 3300049589 Ga0501073_0010268 Ga0501073_0010268_2738_3589 276
259 3300049590 Ga0501074_0011102 Ga0501074_0011102_3288_4139 276
260 3300049823 Ga0501044_0089207 Ga0501044_0089207_424_1275 276
261 iso_pu_bacteria 2565956761 2566992748 276
262 iso_pu_bacteria 2904535858 2904540264 276
263 iso_pu_bacteria 2922554459 2922556294 276
264 3300005353 Ga0070669_100300354 Ga0070669_1003003542 277
265 3300025923 Ga0207681_10332401 Ga0207681_103324011 277
266 3300005367 Ga0070667_100087698 Ga0070667_1000876983 278
267 3300041452 Ga0451793_1470662 Ga0451793_1470662_259_1098 278
268 3300041491 Ga0451833_0349589 Ga0451833_0349589_1489_2328 278
269 3300042004 Ga0439445_0015489 Ga0439445_0015489_333_1169 278
270 3300049587 Ga0501071_0310650 Ga0501071_0310650_220_1056 278
271 iso_pu_bacteria 2565956761 2566992588 278
272 iso_pu_bacteria 2643221576 2643890756 278
273 iso_pu_bacteria 2738541308 2738887594 278
274 iso_pu_bacteria 2738543034 2739366614 278
275 iso_pu_bacteria 2744054611 2744957445 278
276 iso_pu_bacteria 2904535858 2904541550 278
277 iso_pu_bacteria 2904765812 2904767495 278
278 iso_pu_bacteria 2904770941 2904774840 278
279 iso_pu_bacteria 2908811453 2908813142 278
280 iso_pu_bacteria 2919420072 2919423885 278
281 iso_pu_bacteria 2919432681 2919436663 278
282 iso_pu_bacteria 2922554459 2922560074 278
283 3300005327 Ga0070658_10156659 Ga0070658_101566592 279
284 3300005455 Ga0070663_100393017 Ga0070663_1003930171 279
285 3300009545 Ga0105237_10450685 Ga0105237_104506852 279
286 3300025914 Ga0207671_10310014 Ga0207671_103100142 279
287 3300026067 Ga0207678_10151556 Ga0207678_101515562 279
288 3300044656 Ga0466969_0029710 Ga0466969_0029710_1490_2377 279
289 3300044658 Ga0466972_0120062 Ga0466972_0120062_285_1142 279
290 3300044684 Ga0466966_0000562 Ga0466966_0000562_6680_7567 279
291 3300044693 Ga0466961_0006272 Ga0466961_0006272_3955_4836 279
292 3300044693 Ga0466961_0008034 Ga0466961_0008034_3052_3942 279
293 3300044693 Ga0466961_0008893 Ga0466961_0008893_959_1846 279
294 3300044693 Ga0466961_0022980 Ga0466961_0022980_1690_2556 279
295 3300044693 Ga0466961_0034897 Ga0466961_0034897_1439_2311 279
296 3300044693 Ga0466961_0169746 Ga0466961_0169746_100_966 279
297 3300044694 Ga0466963_0002108 Ga0466963_0002108_3398_4264 279
298 3300044694 Ga0466963_0031067 Ga0466963_0031067_2366_3238 279
299 3300044694 Ga0466963_0086223 Ga0466963_0086223_935_1819 279
300 3300044706 Ga0466964_0039708 Ga0466964_0039708_99_989 279
301 3300044719 Ga0466971_0039767 Ga0466971_0039767_426_1316 279
302 3300044842 Ga0466957_0105731 Ga0466957_0105731_176_1066 279
303 3300044901 Ga0466960_0174227 Ga0466960_0174227_297_1148 279
304 3300045049 Ga0466959_0028762 Ga0466959_0028762_1593_2483 279
305 3300045049 Ga0466959_0044748 Ga0466959_0044748_121_1008 279
306 3300045836 Ga0466958_0019629 Ga0466958_0019629_2584_3474 279
307 3300045836 Ga0466958_0043868 Ga0466958_0043868_118_984 279
308 3300045836 Ga0466958_0173638 Ga0466958_0173638_101_973 279
309 3300045976 Ga0466967_0002628 Ga0466967_0002628_1797_2669 279
310 3300045976 Ga0466967_0003302 Ga0466967_0003302_66_932 279
311 3300045976 Ga0466967_0018345 Ga0466967_0018345_2002_2874 279
312 3300045976 Ga0466967_0056929 Ga0466967_0056929_1410_2282 279
313 3300045976 Ga0466967_0057017 Ga0466967_0057017_993_1856 279
314 3300045976 Ga0466967_0146205 Ga0466967_0146205_729_1601 279
315 3300049569 Ga0501032_0006037 Ga0501032_0006037_807_1682 279
316 3300049570 Ga0501033_0224123 Ga0501033_0224123_151_1026 279
317 3300049574 Ga0501038_0000987 Ga0501038_0000987_7358_8233 279
318 3300049579 Ga0501043_0044559 Ga0501043_0044559_1278_2153 279
319 3300049580 Ga0501046_0020411 Ga0501046_0020411_4114_4989 279
320 3300049581 Ga0501047_0000660 Ga0501047_0000660_103_978 279
321 3300049582 Ga0501048_0000630 Ga0501048_0000630_22101_22976 279
322 3300049586 Ga0501070_0004851 Ga0501070_0004851_8368_9243 279
323 3300049822 Ga0501035_0012627 Ga0501035_0012627_2493_3368 279
324 3300061719 Ga0466962_0022722 Ga0466962_0022722_29_895 279
325 3300061719 Ga0466962_0046956 Ga0466962_0046956_1140_2012 279
326 iso_pu_bacteria 2547132424 2548699204 279
327 iso_pu_bacteria 2551306166 2552111001 279
328 iso_pu_bacteria 2643221692 2644517763 279
329 3300001989 JGI24739J22299_10034565 JGI24739J22299_100345652 280
330 3300028381 Ga0268264_10371506 Ga0268264_103715061 280
331 3300028794 Ga0307515_10458601 Ga0307515_104586011 280
332 3300031456 Ga0307513_10008553 Ga0307513_100085535 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

74

284

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.8732 20 276
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.859 9 271
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.8527 9 271
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.8516 20 276
7ch9-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd 0.8295 7 268
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4937 106 267 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.489 107 267 3.40.1710.10
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4661 58 266 1.10.357.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4574 58 266 1.10.357.20
af_Q3V050_53_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.403 66 265 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5Q2MMZ6-F1-model_v4 ABC transporter permease 0.9465 44 273 GO:0005548
GO:0043190
AF-A0A3D4R162-F1-model_v4 ABC transporter permease 0.9359 43 274 GO:0005548
GO:0043190
AF-A0A0Q8WYY5-F1-model_v4 ABC transporter permease 0.9357 11 273 GO:0005548
GO:0043190
AF-A0A7C7ZVU2-F1-model_v4 ABC transporter permease 0.9326 44 273 GO:0005548
GO:0043190
AF-A0A6M1YHF2-F1-model_v4 Putative phospholipid ABC transporter permease protein MlaE 0.9306 17 270 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
82.3 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map