F411037
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 223 | 296 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0008034|Ga0466961_0008034_3052_3942 |
| Length | 296 |
| Sequence | VTSTRGGATLADLLPTGTRDLLAGVGRRVGAVENSIRFLGDMVVFTARALAAIPLVLRRYRAEVMRQIGQLTLGTGLFITFTGTLMVVIAESLFIGIEVGVEGFQSLNIIGIAPLTGFVSAYGNTREIAPIIAAVAVASQIGCKFTSQLGAQRISEEIDALEVMAIPSIPYLVTTRIVGAFTVIIPLYLVGLFGSYIATRYTVTIFFGQSTGTYDHYFNQFLRNIDIFYSVVKVMVFTIFITIIHTYYGYNAAGGPAGVGRATARAIRATTVIIAASDVLMTMLFWGLHGVRLGGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 5 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 6 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 7 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 8 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 9 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 10 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 11 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 12 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 13 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 14 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 15 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 16 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 17 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 18 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 19 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 20 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 21 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 22 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 23 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 24 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 25 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 26 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 27 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 28 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 29 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 127 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 128 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 138 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 139 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 144 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 145 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 146 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 179 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 180 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 181 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 182 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 183 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 184 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 212 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 217 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 219 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 222 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 223 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.16 |
| Metatranscriptomes | 0 |
| Isolates | 10.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.64 |
| Nodule | 0.6 |
| Rhizoplane | 5.42 |
| Rhizosphere | 71.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10034565 | 3300001989 | Bacteria | 1722 |
| 2 | JGI24738J21930_10002723 | 3300002075 | Bacteria | 4548 |
| 3 | Ga0070658_10156659 | 3300005327 | Bacteria | 1910 |
| 4 | Ga0070676_10202792 | 3300005328 | Bacteria | 1301 |
| 5 | Ga0070670_100057222 | 3300005331 | Bacteria | 3347 |
| 6 | Ga0068869_100138684 | 3300005334 | Bacteria | 1876 |
| 7 | Ga0070682_100017488 | 3300005337 | Bacteria | 4180 |
| 8 | Ga0070682_100250641 | 3300005337 | Bacteria | 1276 |
| 9 | Ga0070660_100077431 | 3300005339 | Bacteria | 2606 |
| 10 | Ga0070689_100582558 | 3300005340 | Bacteria | 967 |
| 11 | Ga0070661_100468101 | 3300005344 | Bacteria | 1005 |
| 12 | Ga0070668_100107325 | 3300005347 | Bacteria | 2219 |
| 13 | Ga0070668_100177074 | 3300005347 | Bacteria | 1740 |
| 14 | Ga0070669_100300354 | 3300005353 | Bacteria | 1291 |
| 15 | Ga0070671_100001106 | 3300005355 | Bacteria | 19978 |
| 16 | Ga0070671_100020036 | 3300005355 | Bacteria | 5449 |
| 17 | Ga0070671_100079274 | 3300005355 | Bacteria | 2745 |
| 18 | Ga0070667_100024306 | 3300005367 | Bacteria | 5032 |
| 19 | Ga0070667_100087698 | 3300005367 | Bacteria | 2671 |
| 20 | Ga0070713_100416708 | 3300005436 | Bacteria | 1257 |
| 21 | Ga0070663_100058715 | 3300005455 | Bacteria | 2763 |
| 22 | Ga0070663_100393017 | 3300005455 | Bacteria | 1132 |
| 23 | Ga0070685_10021409 | 3300005466 | Bacteria | 3514 |
| 24 | Ga0068853_100205844 | 3300005539 | Bacteria | 1792 |
| 25 | Ga0070686_100037743 | 3300005544 | Bacteria | 2998 |
| 26 | Ga0070665_100001212 | 3300005548 | Bacteria | 31450 |
| 27 | Ga0070665_100001291 | 3300005548 | Bacteria | 29963 |
| 28 | Ga0070665_100017616 | 3300005548 | Bacteria | 7175 |
| 29 | Ga0070665_100128245 | 3300005548 | Bacteria | 2539 |
| 30 | Ga0068855_100097844 | 3300005563 | Bacteria | 3380 |
| 31 | Ga0068855_100617454 | 3300005563 | Bacteria | 1168 |
| 32 | Ga0068852_100006783 | 3300005616 | Bacteria | 8308 |
| 33 | Ga0068859_100127727 | 3300005617 | Bacteria | 2613 |
| 34 | Ga0068859_100217744 | 3300005617 | Bacteria | 1997 |
| 35 | Ga0068864_100072007 | 3300005618 | Bacteria | 3011 |
| 36 | Ga0068861_100045108 | 3300005719 | Bacteria | 3317 |
| 37 | Ga0068851_10078913 | 3300005834 | Bacteria | 1716 |
| 38 | Ga0068863_100002702 | 3300005841 | Bacteria | 17515 |
| 39 | Ga0068863_100377962 | 3300005841 | Bacteria | 1383 |
| 40 | Ga0068858_100089332 | 3300005842 | Bacteria | 2867 |
| 41 | Ga0068858_100172202 | 3300005842 | Bacteria | 2041 |
| 42 | Ga0068860_100005801 | 3300005843 | Bacteria | 12434 |
| 43 | Ga0068860_100101678 | 3300005843 | Bacteria | 2742 |
| 44 | Ga0081455_10000360 | 3300005937 | Bacteria | 59979 |
| 45 | Ga0081455_10255589 | 3300005937 | Bacteria | 1279 |
| 46 | Ga0070717_10235836 | 3300006028 | Bacteria | 1612 |
| 47 | Ga0075365_10104930 | 3300006038 | Bacteria | 1938 |
| 48 | Ga0075365_10242501 | 3300006038 | Bacteria | 1266 |
| 49 | Ga0075368_10060664 | 3300006042 | Bacteria | 1514 |
| 50 | Ga0075363_100014524 | 3300006048 | Bacteria | 3851 |
| 51 | Ga0075363_100036179 | 3300006048 | Bacteria | 2588 |
| 52 | Ga0075363_100105228 | 3300006048 | Bacteria | 1565 |
| 53 | Ga0075364_10010245 | 3300006051 | Bacteria | 5656 |
| 54 | Ga0075364_10058728 | 3300006051 | Bacteria | 2521 |
| 55 | Ga0075364_10076930 | 3300006051 | Bacteria | 2203 |
| 56 | Ga0075364_10099942 | 3300006051 | Bacteria | 1931 |
| 57 | Ga0075364_10169661 | 3300006051 | Bacteria | 1475 |
| 58 | Ga0075367_10019261 | 3300006178 | Bacteria | 3782 |
| 59 | Ga0075367_10047260 | 3300006178 | Bacteria | 2532 |
| 60 | Ga0075369_10034046 | 3300006186 | Bacteria | 2161 |
| 61 | Ga0097621_100143139 | 3300006237 | Bacteria | 2044 |
| 62 | Ga0075370_10006102 | 3300006353 | Bacteria | 6042 |
| 63 | Ga0075370_10023446 | 3300006353 | Bacteria | 3399 |
| 64 | Ga0075370_10042323 | 3300006353 | Bacteria | 2573 |
| 65 | Ga0075370_10155914 | 3300006353 | Bacteria | 1339 |
| 66 | Ga0097620_100127727 | 3300006931 | Bacteria | 2613 |
| 67 | Ga0097620_100217754 | 3300006931 | Bacteria | 1997 |
| 68 | Ga0099795_10065273 | 3300007788 | Bacteria | 1361 |
| 69 | Ga0105250_10023924 | 3300009092 | Bacteria | 2462 |
| 70 | Ga0111539_10222413 | 3300009094 | Bacteria | 2199 |
| 71 | Ga0105245_10026353 | 3300009098 | Bacteria | 5116 |
| 72 | Ga0105245_10707245 | 3300009098 | Bacteria | 1041 |
| 73 | Ga0105247_10036309 | 3300009101 | Bacteria | 3004 |
| 74 | Ga0114129_10260952 | 3300009147 | Bacteria | 2322 |
| 75 | Ga0105243_10073886 | 3300009148 | Bacteria | 2764 |
| 76 | Ga0105241_10107312 | 3300009174 | Bacteria | 2230 |
| 77 | Ga0105248_10088940 | 3300009177 | Bacteria | 3476 |
| 78 | Ga0105237_10227721 | 3300009545 | Bacteria | 1865 |
| 79 | Ga0105237_10450685 | 3300009545 | Bacteria | 1293 |
| 80 | Ga0105238_10047092 | 3300009551 | Bacteria | 4349 |
| 81 | Ga0105249_10260852 | 3300009553 | Bacteria | 1722 |
| 82 | Ga0099796_10010379 | 3300010159 | Bacteria | 2559 |
| 83 | Ga0105239_10344089 | 3300010375 | Bacteria | 1683 |
| 84 | Ga0105246_10090213 | 3300011119 | Bacteria | 2207 |
| 85 | Ga0157371_10218855 | 3300013102 | Bacteria | 1367 |
| 86 | Ga0157369_10206698 | 3300013105 | Bacteria | 2059 |
| 87 | Ga0157369_10446638 | 3300013105 | Bacteria | 1339 |
| 88 | Ga0157369_10678195 | 3300013105 | Bacteria | 1062 |
| 89 | Ga0157378_10366588 | 3300013297 | Bacteria | 1411 |
| 90 | Ga0163162_10106359 | 3300013306 | Bacteria | 2901 |
| 91 | Ga0163162_10408076 | 3300013306 | Bacteria | 1491 |
| 92 | Ga0157375_10092916 | 3300013308 | Bacteria | 3082 |
| 93 | Ga0163163_10151187 | 3300014325 | Bacteria | 2365 |
| 94 | Ga0163163_10379167 | 3300014325 | Bacteria | 1472 |
| 95 | Ga0163163_10901103 | 3300014325 | Bacteria | 948 |
| 96 | Ga0157379_10059550 | 3300014968 | Bacteria | 3414 |
| 97 | Ga0157379_10440577 | 3300014968 | Bacteria | 1201 |
| 98 | Ga0207656_10048919 | 3300025321 | Bacteria | 1822 |
| 99 | Ga0207645_10207055 | 3300025907 | Bacteria | 1291 |
| 100 | Ga0207643_10013684 | 3300025908 | Bacteria | 4398 |
| 101 | Ga0207705_10170698 | 3300025909 | Bacteria | 1637 |
| 102 | Ga0207654_10080243 | 3300025911 | Bacteria | 1961 |
| 103 | Ga0207671_10310014 | 3300025914 | Bacteria | 1247 |
| 104 | Ga0207657_10019728 | 3300025919 | Bacteria | 6392 |
| 105 | Ga0207681_10332401 | 3300025923 | Bacteria | 1212 |
| 106 | Ga0207694_10114545 | 3300025924 | Bacteria | 2147 |
| 107 | Ga0207687_10015620 | 3300025927 | Bacteria | 4980 |
| 108 | Ga0207700_10440344 | 3300025928 | Bacteria | 1147 |
| 109 | Ga0207664_10174496 | 3300025929 | Bacteria | 1842 |
| 110 | Ga0207644_10003632 | 3300025931 | Bacteria | 10005 |
| 111 | Ga0207644_10077901 | 3300025931 | Bacteria | 2442 |
| 112 | Ga0207690_10062603 | 3300025932 | Bacteria | 2534 |
| 113 | Ga0207689_10043631 | 3300025942 | Bacteria | 3707 |
| 114 | Ga0207679_10098252 | 3300025945 | Bacteria | 2282 |
| 115 | Ga0207712_10155169 | 3300025961 | Bacteria | 1773 |
| 116 | Ga0207668_10199566 | 3300025972 | Bacteria | 1592 |
| 117 | Ga0207658_10151930 | 3300025986 | Bacteria | 1887 |
| 118 | Ga0207677_10095133 | 3300026023 | Bacteria | 2176 |
| 119 | Ga0207703_10226920 | 3300026035 | Bacteria | 1672 |
| 120 | Ga0207678_10018777 | 3300026067 | Bacteria | 6073 |
| 121 | Ga0207678_10151556 | 3300026067 | Bacteria | 1980 |
| 122 | Ga0207702_10054600 | 3300026078 | Bacteria | 3386 |
| 123 | Ga0207641_10025067 | 3300026088 | Bacteria | 4917 |
| 124 | Ga0207641_10036172 | 3300026088 | Bacteria | 4120 |
| 125 | Ga0207641_10352339 | 3300026088 | Bacteria | 1403 |
| 126 | Ga0207648_10100959 | 3300026089 | Bacteria | 2528 |
| 127 | Ga0207676_10102077 | 3300026095 | Bacteria | 2380 |
| 128 | Ga0207675_100014006 | 3300026118 | Bacteria | 7477 |
| 129 | Ga0207698_10006374 | 3300026142 | Bacteria | 7354 |
| 130 | Ga0209179_1045866 | 3300027512 | Bacteria | 928 |
| 131 | Ga0268266_10002730 | 3300028379 | Bacteria | 18484 |
| 132 | Ga0268266_10004062 | 3300028379 | Bacteria | 14146 |
| 133 | Ga0268265_10049435 | 3300028380 | Bacteria | 3163 |
| 134 | Ga0268264_10088563 | 3300028381 | Bacteria | 2664 |
| 135 | Ga0268264_10371506 | 3300028381 | Bacteria | 1367 |
| 136 | Ga0265336_10005477 | 3300028666 | Bacteria | 4678 |
| 137 | Ga0307515_10458601 | 3300028794 | Bacteria | 889 |
| 138 | Ga0316181_1286488 | 3300030744 | Bacteria | 5901 |
| 139 | Ga0316182_1072268 | 3300030745 | Bacteria | 4773 |
| 140 | Ga0307513_10008553 | 3300031456 | Bacteria | 13083 |
| 141 | Ga0307405_10230399 | 3300031731 | Bacteria | 1365 |
| 142 | Ga0307407_10149347 | 3300031903 | Bacteria | 1517 |
| 143 | Ga0307412_10195638 | 3300031911 | Bacteria | 1532 |
| 144 | Ga0307409_100177881 | 3300031995 | Bacteria | 1880 |
| 145 | Ga0307416_100163216 | 3300032002 | Bacteria | 2063 |
| 146 | Ga0395900_0095466 | 3300037418 | Bacteria | 3055 |
| 147 | Ga0395898_0343694 | 3300037466 | Bacteria | 1423 |
| 148 | Ga0395901_0799292 | 3300038443 | Bacteria | 932 |
| 149 | Ga0439466_0053797 | 3300041411 | Bacteria | 1312 |
| 150 | Ga0439465_0002711 | 3300041413 | Bacteria | 5788 |
| 151 | Ga0439465_0033468 | 3300041413 | Bacteria | 1643 |
| 152 | Ga0451793_1470662 | 3300041452 | Bacteria | 2283 |
| 153 | Ga0451795_0595851 | 3300041456 | Bacteria | 1911 |
| 154 | Ga0451833_0349589 | 3300041491 | Bacteria | 2775 |
| 155 | Ga0451853_0505843 | 3300041512 | Bacteria | 1623 |
| 156 | Ga0439442_007529 | 3300042002 | Bacteria | 2191 |
| 157 | Ga0439445_0015489 | 3300042004 | Bacteria | 1868 |
| 158 | Ga0439445_0083329 | 3300042004 | Bacteria | 895 |
| 159 | Ga0439458_0019318 | 3300042157 | Bacteria | 1568 |
| 160 | Ga0439459_0002990 | 3300042438 | Bacteria | 2652 |
| 161 | Ga0466969_0029710 | 3300044656 | Bacteria | 2790 |
| 162 | Ga0466972_0000932 | 3300044658 | Bacteria | 14072 |
| 163 | Ga0466972_0008655 | 3300044658 | Bacteria | 5105 |
| 164 | Ga0466972_0110244 | 3300044658 | Bacteria | 1301 |
| 165 | Ga0466972_0120062 | 3300044658 | Bacteria | 1240 |
| 166 | Ga0466965_0013484 | 3300044683 | Bacteria | 3857 |
| 167 | Ga0466965_0016440 | 3300044683 | Bacteria | 3522 |
| 168 | Ga0466966_0000562 | 3300044684 | Bacteria | 23668 |
| 169 | Ga0466966_0016556 | 3300044684 | Bacteria | 4868 |
| 170 | Ga0466961_0006272 | 3300044693 | Bacteria | 7551 |
| 171 | Ga0466961_0008034 | 3300044693 | Bacteria | 6724 |
| 172 | Ga0466961_0008893 | 3300044693 | Bacteria | 6405 |
| 173 | Ga0466961_0022980 | 3300044693 | Bacteria | 4011 |
| 174 | Ga0466961_0034897 | 3300044693 | Bacteria | 3230 |
| 175 | Ga0466961_0108464 | 3300044693 | Bacteria | 1748 |
| 176 | Ga0466961_0115382 | 3300044693 | Bacteria | 1688 |
| 177 | Ga0466961_0169746 | 3300044693 | Bacteria | 1357 |
| 178 | Ga0466963_0002108 | 3300044694 | Bacteria | 11000 |
| 179 | Ga0466963_0023604 | 3300044694 | Bacteria | 3908 |
| 180 | Ga0466963_0031067 | 3300044694 | Bacteria | 3450 |
| 181 | Ga0466963_0086223 | 3300044694 | Bacteria | 2133 |
| 182 | Ga0466964_0039708 | 3300044706 | Bacteria | 1898 |
| 183 | Ga0466971_0039767 | 3300044719 | Bacteria | 2111 |
| 184 | Ga0466968_0000286 | 3300044735 | Bacteria | 16083 |
| 185 | Ga0466968_0125373 | 3300044735 | Bacteria | 1165 |
| 186 | Ga0466970_0003750 | 3300044765 | Bacteria | 7432 |
| 187 | Ga0466970_0033479 | 3300044765 | Bacteria | 2716 |
| 188 | Ga0466957_0105731 | 3300044842 | Bacteria | 1779 |
| 189 | Ga0466957_0170055 | 3300044842 | Bacteria | 1419 |
| 190 | Ga0466957_0285666 | 3300044842 | Bacteria | 1105 |
| 191 | Ga0466960_0005088 | 3300044901 | Bacteria | 5195 |
| 192 | Ga0466960_0174227 | 3300044901 | Bacteria | 1163 |
| 193 | Ga0466959_0028762 | 3300045049 | Bacteria | 4119 |
| 194 | Ga0466959_0044748 | 3300045049 | Bacteria | 3261 |
| 195 | Ga0466959_0343509 | 3300045049 | Bacteria | 1018 |
| 196 | Ga0466958_0019629 | 3300045836 | Bacteria | 3934 |
| 197 | Ga0466958_0043868 | 3300045836 | Bacteria | 2694 |
| 198 | Ga0466958_0084595 | 3300045836 | Bacteria | 1956 |
| 199 | Ga0466958_0173638 | 3300045836 | Bacteria | 1365 |
| 200 | Ga0466967_0002628 | 3300045976 | Bacteria | 11311 |
| 201 | Ga0466967_0003302 | 3300045976 | Bacteria | 10475 |
| 202 | Ga0466967_0013778 | 3300045976 | Bacteria | 6266 |
| 203 | Ga0466967_0018345 | 3300045976 | Bacteria | 5589 |
| 204 | Ga0466967_0056929 | 3300045976 | Bacteria | 3449 |
| 205 | Ga0466967_0057017 | 3300045976 | Bacteria | 3447 |
| 206 | Ga0466967_0146205 | 3300045976 | Bacteria | 2205 |
| 207 | Ga0495653_0153225 | 3300046463 | Bacteria | 1608 |
| 208 | Ga0495653_0206435 | 3300046463 | Bacteria | 1330 |
| 209 | Ga0495650_0030282 | 3300046471 | Bacteria | 2454 |
| 210 | Ga0495580_0205207 | 3300046472 | Bacteria | 1357 |
| 211 | Ga0495668_0000407 | 3300046616 | Bacteria | 56229 |
| 212 | Ga0495668_0048927 | 3300046616 | Bacteria | 2344 |
| 213 | Ga0495581_0015476 | 3300047315 | Bacteria | 4429 |
| 214 | Ga0495683_0000314 | 3300047323 | Bacteria | 40788 |
| 215 | Ga0496100_0006244 | 3300048903 | Bacteria | 6487 |
| 216 | Ga0496101_0006973 | 3300048904 | Bacteria | 7295 |
| 217 | Ga0496101_0045694 | 3300048904 | Bacteria | 3138 |
| 218 | Ga0496102_0000772 | 3300048905 | Bacteria | 31172 |
| 219 | Ga0496102_0409212 | 3300048905 | Bacteria | 1274 |
| 220 | Ga0496103_0000018 | 3300048906 | Bacteria | 239585 |
| 221 | Ga0496104_0029902 | 3300048907 | Bacteria | 5058 |
| 222 | Ga0496105_0013729 | 3300048908 | Bacteria | 6432 |
| 223 | Ga0496105_0042390 | 3300048908 | Bacteria | 3752 |
| 224 | Ga0496105_0680822 | 3300048908 | Bacteria | 791 |
| 225 | Ga0496108_0029153 | 3300048911 | Bacteria | 4569 |
| 226 | Ga0496108_0078849 | 3300048911 | Bacteria | 2788 |
| 227 | Ga0496109_0108237 | 3300048912 | Bacteria | 2583 |
| 228 | Ga0496109_0214456 | 3300048912 | Bacteria | 1810 |
| 229 | Ga0496110_0052506 | 3300048913 | Bacteria | 3582 |
| 230 | Ga0496114_0135329 | 3300048917 | Bacteria | 2131 |
| 231 | Ga0496116_0000173 | 3300048919 | Bacteria | 129928 |
| 232 | Ga0496117_0000144 | 3300048920 | Bacteria | 153831 |
| 233 | Ga0496118_0000096 | 3300048921 | Bacteria | 163988 |
| 234 | Ga0496119_0001793 | 3300048922 | Bacteria | 25009 |
| 235 | Ga0496119_0167966 | 3300048922 | Bacteria | 1161 |
| 236 | Ga0496120_0034752 | 3300048923 | Bacteria | 3016 |
| 237 | Ga0496121_0026060 | 3300048924 | Bacteria | 5526 |
| 238 | Ga0496124_0012327 | 3300048927 | Bacteria | 8443 |
| 239 | Ga0496125_0032164 | 3300048928 | Bacteria | 4663 |
| 240 | Ga0496125_0037356 | 3300048928 | Bacteria | 4223 |
| 241 | Ga0496125_0084204 | 3300048928 | Bacteria | 2415 |
| 242 | Ga0496126_0000330 | 3300048929 | Bacteria | 101064 |
| 243 | Ga0496126_0288471 | 3300048929 | Bacteria | 1358 |
| 244 | Ga0501031_0206513 | 3300049568 | Bacteria | 1281 |
| 245 | Ga0501032_0006037 | 3300049569 | Bacteria | 8937 |
| 246 | Ga0501033_0224123 | 3300049570 | Bacteria | 1337 |
| 247 | Ga0501034_0131518 | 3300049571 | Bacteria | 2485 |
| 248 | Ga0501036_0002686 | 3300049572 | Bacteria | 14031 |
| 249 | Ga0501037_0037803 | 3300049573 | Bacteria | 3559 |
| 250 | Ga0501038_0000987 | 3300049574 | Bacteria | 25574 |
| 251 | Ga0501038_0008702 | 3300049574 | Bacteria | 9317 |
| 252 | Ga0501039_0027681 | 3300049575 | Bacteria | 4359 |
| 253 | Ga0501039_0038886 | 3300049575 | Bacteria | 3674 |
| 254 | Ga0501039_0069236 | 3300049575 | Bacteria | 2740 |
| 255 | Ga0501039_0331485 | 3300049575 | Bacteria | 1196 |
| 256 | Ga0501040_0202444 | 3300049576 | Bacteria | 1410 |
| 257 | Ga0501041_0134953 | 3300049577 | Bacteria | 1538 |
| 258 | Ga0501041_0181855 | 3300049577 | Bacteria | 1316 |
| 259 | Ga0501042_0018782 | 3300049578 | Bacteria | 4791 |
| 260 | Ga0501043_0005783 | 3300049579 | Bacteria | 9952 |
| 261 | Ga0501043_0044559 | 3300049579 | Bacteria | 3488 |
| 262 | Ga0501046_0020411 | 3300049580 | Bacteria | 5480 |
| 263 | Ga0501047_0000660 | 3300049581 | Bacteria | 36046 |
| 264 | Ga0501047_0023978 | 3300049581 | Bacteria | 5859 |
| 265 | Ga0501047_0113581 | 3300049581 | Bacteria | 2591 |
| 266 | Ga0501048_0000630 | 3300049582 | Bacteria | 25188 |
| 267 | Ga0501048_0033085 | 3300049582 | Bacteria | 3736 |
| 268 | Ga0501070_0004851 | 3300049586 | Bacteria | 11492 |
| 269 | Ga0501071_0310650 | 3300049587 | Bacteria | 1196 |
| 270 | Ga0501073_0010268 | 3300049589 | Bacteria | 6876 |
| 271 | Ga0501074_0011102 | 3300049590 | Bacteria | 6541 |
| 272 | Ga0501075_0132914 | 3300049591 | Bacteria | 1896 |
| 273 | Ga0501075_0190342 | 3300049591 | Bacteria | 1565 |
| 274 | Ga0501076_0573144 | 3300049592 | Bacteria | 931 |
| 275 | Ga0501035_0012627 | 3300049822 | Bacteria | 7805 |
| 276 | Ga0501044_0089207 | 3300049823 | Bacteria | 3112 |
| 277 | Ga0501044_0656787 | 3300049823 | Bacteria | 937 |
| 278 | Ga0501045_0172098 | 3300049824 | Bacteria | 1613 |
| 279 | nmdc:mga03683_61029_c1 | 3300050489 | Bacteria | 1593 |
| 280 | nmdc:mga03683_9132_c1 | 3300050489 | Bacteria | 3512 |
| 281 | nmdc:mga03n38_23470_c1 | 3300050490 | Bacteria | 2510 |
| 282 | nmdc:mga03n38_72608_c1 | 3300050490 | Bacteria | 1596 |
| 283 | nmdc:mga00v17_18812_c1 | 3300050491 | Bacteria | 3931 |
| 284 | nmdc:mga00v17_237187_c1 | 3300050491 | Bacteria | 1182 |
| 285 | nmdc:mga00v17_277026_c1 | 3300050491 | Bacteria | 1089 |
| 286 | nmdc:mga0yw44_241619_c1 | 3300050492 | Bacteria | 1200 |
| 287 | nmdc:mga0yw44_24421_c1 | 3300050492 | Bacteria | 3420 |
| 288 | nmdc:mga06z11_22325_c1 | 3300050494 | Bacteria | 2954 |
| 289 | nmdc:mga07m45_143516_c1 | 3300050496 | Bacteria | 1383 |
| 290 | nmdc:mga07m45_220156_c1 | 3300050496 | Bacteria | 1104 |
| 291 | nmdc:mga05p37_449722_c1 | 3300050507 | Bacteria | 1491 |
| 292 | nmdc:mga0sz30_54031_c1 | 3300050516 | Bacteria | 1708 |
| 293 | Ga0500641_0002983 | 3300053096 | Bacteria | 5992 |
| 294 | Ga0501084_0453512 | 3300054114 | Bacteria | 1084 |
| 295 | Ga0466962_0022722 | 3300061719 | Bacteria | 3014 |
| 296 | Ga0466962_0046956 | 3300061719 | Bacteria | 2063 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007788 | Ga0099795_10065273 | Ga0099795_100652731 | 222 |
| 2 | 3300027512 | Ga0209179_1045866 | Ga0209179_10458661 | 230 |
| 3 | 3300049577 | Ga0501041_0134953 | Ga0501041_0134953_44_742 | 232 |
| 4 | 3300049591 | Ga0501075_0132914 | Ga0501075_0132914_1183_1881 | 232 |
| 5 | 3300005355 | Ga0070671_100079274 | Ga0070671_1000792742 | 239 |
| 6 | 3300025928 | Ga0207700_10440344 | Ga0207700_104403442 | 240 |
| 7 | 3300048908 | Ga0496105_0680822 | Ga0496105_0680822_34_756 | 240 |
| 8 | 3300006048 | Ga0075363_100014524 | Ga0075363_1000145243 | 241 |
| 9 | 3300006051 | Ga0075364_10010245 | Ga0075364_100102454 | 241 |
| 10 | 3300006353 | Ga0075370_10042323 | Ga0075370_100423233 | 241 |
| 11 | 3300046616 | Ga0495668_0048927 | Ga0495668_0048927_832_1704 | 241 |
| 12 | 3300048928 | Ga0496125_0084204 | Ga0496125_0084204_276_1148 | 241 |
| 13 | 3300050490 | nmdc:mga03n38_72608_c1 | nmdc:mga03n38_72608_c1_178_1050 | 241 |
| 14 | 3300009092 | Ga0105250_10023924 | Ga0105250_100239242 | 243 |
| 15 | 3300009098 | Ga0105245_10707245 | Ga0105245_107072452 | 243 |
| 16 | 3300009147 | Ga0114129_10260952 | Ga0114129_102609522 | 243 |
| 17 | 3300009177 | Ga0105248_10088940 | Ga0105248_100889403 | 243 |
| 18 | 3300013105 | Ga0157369_10678195 | Ga0157369_106781952 | 243 |
| 19 | 3300013306 | Ga0163162_10408076 | Ga0163162_104080762 | 243 |
| 20 | 3300014325 | Ga0163163_10379167 | Ga0163163_103791672 | 243 |
| 21 | 3300042157 | Ga0439458_0019318 | Ga0439458_0019318_466_1260 | 243 |
| 22 | 3300042438 | Ga0439459_0002990 | Ga0439459_0002990_1081_1875 | 243 |
| 23 | 3300048904 | Ga0496101_0045694 | Ga0496101_0045694_1231_2025 | 243 |
| 24 | 3300048905 | Ga0496102_0409212 | Ga0496102_0409212_193_987 | 243 |
| 25 | 3300048907 | Ga0496104_0029902 | Ga0496104_0029902_3662_4456 | 243 |
| 26 | 3300048908 | Ga0496105_0042390 | Ga0496105_0042390_1962_2756 | 243 |
| 27 | 3300048911 | Ga0496108_0078849 | Ga0496108_0078849_1312_2106 | 243 |
| 28 | 3300048912 | Ga0496109_0108237 | Ga0496109_0108237_24_818 | 243 |
| 29 | 3300050489 | nmdc:mga03683_9132_c1 | nmdc:mga03683_9132_c1_1848_2642 | 243 |
| 30 | 3300050491 | nmdc:mga00v17_18812_c1 | nmdc:mga00v17_18812_c1_592_1386 | 243 |
| 31 | 3300050492 | nmdc:mga0yw44_24421_c1 | nmdc:mga0yw44_24421_c1_130_924 | 243 |
| 32 | 3300050507 | nmdc:mga05p37_449722_c1 | nmdc:mga05p37_449722_c1_211_1005 | 243 |
| 33 | 3300050516 | nmdc:mga0sz30_54031_c1 | nmdc:mga0sz30_54031_c1_470_1264 | 243 |
| 34 | 3300005340 | Ga0070689_100582558 | Ga0070689_1005825581 | 249 |
| 35 | 3300028666 | Ga0265336_10005477 | Ga0265336_100054772 | 249 |
| 36 | 3300010159 | Ga0099796_10010379 | Ga0099796_100103792 | 250 |
| 37 | 3300046463 | Ga0495653_0206435 | Ga0495653_0206435_209_1135 | 250 |
| 38 | 3300005331 | Ga0070670_100057222 | Ga0070670_1000572222 | 252 |
| 39 | 3300005347 | Ga0070668_100107325 | Ga0070668_1001073252 | 252 |
| 40 | 3300005355 | Ga0070671_100020036 | Ga0070671_1000200363 | 252 |
| 41 | 3300005367 | Ga0070667_100024306 | Ga0070667_1000243062 | 252 |
| 42 | 3300005544 | Ga0070686_100037743 | Ga0070686_1000377432 | 252 |
| 43 | 3300005548 | Ga0070665_100017616 | Ga0070665_1000176164 | 252 |
| 44 | 3300005617 | Ga0068859_100127727 | Ga0068859_1001277272 | 252 |
| 45 | 3300005719 | Ga0068861_100045108 | Ga0068861_1000451082 | 252 |
| 46 | 3300005842 | Ga0068858_100089332 | Ga0068858_1000893323 | 252 |
| 47 | 3300005843 | Ga0068860_100101678 | Ga0068860_1001016783 | 252 |
| 48 | 3300006038 | Ga0075365_10104930 | Ga0075365_101049302 | 252 |
| 49 | 3300006048 | Ga0075363_100036179 | Ga0075363_1000361792 | 252 |
| 50 | 3300006051 | Ga0075364_10058728 | Ga0075364_100587282 | 252 |
| 51 | 3300006051 | Ga0075364_10099942 | Ga0075364_100999422 | 252 |
| 52 | 3300006186 | Ga0075369_10034046 | Ga0075369_100340462 | 252 |
| 53 | 3300006353 | Ga0075370_10155914 | Ga0075370_101559142 | 252 |
| 54 | 3300006931 | Ga0097620_100127727 | Ga0097620_1001277273 | 252 |
| 55 | 3300025931 | Ga0207644_10077901 | Ga0207644_100779012 | 252 |
| 56 | 3300025961 | Ga0207712_10155169 | Ga0207712_101551692 | 252 |
| 57 | 3300025986 | Ga0207658_10151930 | Ga0207658_101519302 | 252 |
| 58 | 3300026035 | Ga0207703_10226920 | Ga0207703_102269202 | 252 |
| 59 | 3300026088 | Ga0207641_10025067 | Ga0207641_100250674 | 252 |
| 60 | 3300026118 | Ga0207675_100014006 | Ga0207675_1000140064 | 252 |
| 61 | 3300028379 | Ga0268266_10004062 | Ga0268266_100040623 | 252 |
| 62 | 3300028380 | Ga0268265_10049435 | Ga0268265_100494352 | 252 |
| 63 | 3300028381 | Ga0268264_10088563 | Ga0268264_100885632 | 252 |
| 64 | 3300050489 | nmdc:mga03683_61029_c1 | nmdc:mga03683_61029_c1_327_1187 | 252 |
| 65 | 3300050490 | nmdc:mga03n38_23470_c1 | nmdc:mga03n38_23470_c1_104_964 | 252 |
| 66 | 3300050496 | nmdc:mga07m45_143516_c1 | nmdc:mga07m45_143516_c1_498_1358 | 252 |
| 67 | 3300006028 | Ga0070717_10235836 | Ga0070717_102358361 | 253 |
| 68 | 3300041411 | Ga0439466_0053797 | Ga0439466_0053797_432_1289 | 253 |
| 69 | 3300041413 | Ga0439465_0002711 | Ga0439465_0002711_1873_2730 | 253 |
| 70 | 3300042002 | Ga0439442_007529 | Ga0439442_007529_742_1599 | 253 |
| 71 | 3300005436 | Ga0070713_100416708 | Ga0070713_1004167082 | 254 |
| 72 | 3300045836 | Ga0466958_0084595 | Ga0466958_0084595_1179_1946 | 254 |
| 73 | 3300006353 | Ga0075370_10006102 | Ga0075370_100061024 | 255 |
| 74 | 3300041512 | Ga0451853_0505843 | Ga0451853_0505843_429_1289 | 255 |
| 75 | 3300046472 | Ga0495580_0205207 | Ga0495580_0205207_130_990 | 255 |
| 76 | 3300046616 | Ga0495668_0000407 | Ga0495668_0000407_11013_11873 | 255 |
| 77 | 3300047315 | Ga0495581_0015476 | Ga0495581_0015476_1737_2597 | 255 |
| 78 | 3300048911 | Ga0496108_0029153 | Ga0496108_0029153_1117_1977 | 255 |
| 79 | 3300048928 | Ga0496125_0032164 | Ga0496125_0032164_167_1027 | 255 |
| 80 | 3300048929 | Ga0496126_0288471 | Ga0496126_0288471_430_1290 | 255 |
| 81 | 3300050491 | nmdc:mga00v17_237187_c1 | nmdc:mga00v17_237187_c1_184_1044 | 255 |
| 82 | 3300050496 | nmdc:mga07m45_220156_c1 | nmdc:mga07m45_220156_c1_150_1010 | 255 |
| 83 | 3300006048 | Ga0075363_100105228 | Ga0075363_1001052282 | 258 |
| 84 | 3300006353 | Ga0075370_10023446 | Ga0075370_100234463 | 258 |
| 85 | 3300042004 | Ga0439445_0083329 | Ga0439445_0083329_25_801 | 258 |
| 86 | 3300005937 | Ga0081455_10255589 | Ga0081455_102555892 | 260 |
| 87 | iso_pu_bacteria | 2919713450 | 2919717152 | 260 |
| 88 | 3300044658 | Ga0466972_0008655 | Ga0466972_0008655_3265_4128 | 263 |
| 89 | 3300044735 | Ga0466968_0125373 | Ga0466968_0125373_252_1115 | 263 |
| 90 | 3300047323 | Ga0495683_0000314 | Ga0495683_0000314_30575_31432 | 263 |
| 91 | 3300049823 | Ga0501044_0656787 | Ga0501044_0656787_34_891 | 263 |
| 92 | 3300005328 | Ga0070676_10202792 | Ga0070676_102027922 | 264 |
| 93 | 3300005334 | Ga0068869_100138684 | Ga0068869_1001386842 | 264 |
| 94 | 3300005337 | Ga0070682_100017488 | Ga0070682_1000174884 | 264 |
| 95 | 3300005339 | Ga0070660_100077431 | Ga0070660_1000774313 | 264 |
| 96 | 3300005344 | Ga0070661_100468101 | Ga0070661_1004681011 | 264 |
| 97 | 3300005347 | Ga0070668_100177074 | Ga0070668_1001770742 | 264 |
| 98 | 3300005455 | Ga0070663_100058715 | Ga0070663_1000587152 | 264 |
| 99 | 3300005466 | Ga0070685_10021409 | Ga0070685_100214093 | 264 |
| 100 | 3300005539 | Ga0068853_100205844 | Ga0068853_1002058442 | 264 |
| 101 | 3300005548 | Ga0070665_100128245 | Ga0070665_1001282452 | 264 |
| 102 | 3300005617 | Ga0068859_100217744 | Ga0068859_1002177443 | 264 |
| 103 | 3300005618 | Ga0068864_100072007 | Ga0068864_1000720073 | 264 |
| 104 | 3300005834 | Ga0068851_10078913 | Ga0068851_100789132 | 264 |
| 105 | 3300005842 | Ga0068858_100172202 | Ga0068858_1001722022 | 264 |
| 106 | 3300006237 | Ga0097621_100143139 | Ga0097621_1001431392 | 264 |
| 107 | 3300006931 | Ga0097620_100217754 | Ga0097620_1002177543 | 264 |
| 108 | 3300009094 | Ga0111539_10222413 | Ga0111539_102224133 | 264 |
| 109 | 3300009148 | Ga0105243_10073886 | Ga0105243_100738863 | 264 |
| 110 | 3300009174 | Ga0105241_10107312 | Ga0105241_101073122 | 264 |
| 111 | 3300009545 | Ga0105237_10227721 | Ga0105237_102277212 | 264 |
| 112 | 3300009551 | Ga0105238_10047092 | Ga0105238_100470922 | 264 |
| 113 | 3300009553 | Ga0105249_10260852 | Ga0105249_102608522 | 264 |
| 114 | 3300011119 | Ga0105246_10090213 | Ga0105246_100902132 | 264 |
| 115 | 3300013102 | Ga0157371_10218855 | Ga0157371_102188552 | 264 |
| 116 | 3300013105 | Ga0157369_10206698 | Ga0157369_102066982 | 264 |
| 117 | 3300013297 | Ga0157378_10366588 | Ga0157378_103665882 | 264 |
| 118 | 3300013306 | Ga0163162_10106359 | Ga0163162_101063594 | 264 |
| 119 | 3300013308 | Ga0157375_10092916 | Ga0157375_100929163 | 264 |
| 120 | 3300014325 | Ga0163163_10151187 | Ga0163163_101511872 | 264 |
| 121 | 3300014968 | Ga0157379_10440577 | Ga0157379_104405772 | 264 |
| 122 | 3300025321 | Ga0207656_10048919 | Ga0207656_100489192 | 264 |
| 123 | 3300025907 | Ga0207645_10207055 | Ga0207645_102070552 | 264 |
| 124 | 3300025908 | Ga0207643_10013684 | Ga0207643_100136843 | 264 |
| 125 | 3300025909 | Ga0207705_10170698 | Ga0207705_101706982 | 264 |
| 126 | 3300025919 | Ga0207657_10019728 | Ga0207657_100197285 | 264 |
| 127 | 3300025924 | Ga0207694_10114545 | Ga0207694_101145452 | 264 |
| 128 | 3300025929 | Ga0207664_10174496 | Ga0207664_101744962 | 264 |
| 129 | 3300025932 | Ga0207690_10062603 | Ga0207690_100626033 | 264 |
| 130 | 3300025942 | Ga0207689_10043631 | Ga0207689_100436314 | 264 |
| 131 | 3300025945 | Ga0207679_10098252 | Ga0207679_100982521 | 264 |
| 132 | 3300025972 | Ga0207668_10199566 | Ga0207668_101995662 | 264 |
| 133 | 3300026023 | Ga0207677_10095133 | Ga0207677_100951332 | 264 |
| 134 | 3300026067 | Ga0207678_10018777 | Ga0207678_100187775 | 264 |
| 135 | 3300026078 | Ga0207702_10054600 | Ga0207702_100546003 | 264 |
| 136 | 3300026089 | Ga0207648_10100959 | Ga0207648_101009591 | 264 |
| 137 | 3300048912 | Ga0496109_0214456 | Ga0496109_0214456_810_1604 | 264 |
| 138 | 3300048917 | Ga0496114_0135329 | Ga0496114_0135329_353_1147 | 264 |
| 139 | iso_pu_bacteria | 2866612099 | 2866614717 | 265 |
| 140 | 3300005563 | Ga0068855_100097844 | Ga0068855_1000978443 | 266 |
| 141 | 3300005616 | Ga0068852_100006783 | Ga0068852_1000067837 | 266 |
| 142 | 3300005937 | Ga0081455_10000360 | Ga0081455_1000036024 | 266 |
| 143 | 3300006051 | Ga0075364_10076930 | Ga0075364_100769302 | 266 |
| 144 | 3300009098 | Ga0105245_10026353 | Ga0105245_100263535 | 266 |
| 145 | 3300010375 | Ga0105239_10344089 | Ga0105239_103440892 | 266 |
| 146 | 3300025911 | Ga0207654_10080243 | Ga0207654_100802432 | 266 |
| 147 | 3300025927 | Ga0207687_10015620 | Ga0207687_100156202 | 266 |
| 148 | 3300026142 | Ga0207698_10006374 | Ga0207698_100063743 | 266 |
| 149 | 3300044735 | Ga0466968_0000286 | Ga0466968_0000286_4917_5717 | 266 |
| 150 | 3300050491 | nmdc:mga00v17_277026_c1 | nmdc:mga00v17_277026_c1_240_1064 | 266 |
| 151 | 3300005563 | Ga0068855_100617454 | Ga0068855_1006174541 | 267 |
| 152 | iso_pu_bacteria | 2643221961 | 2645720384 | 267 |
| 153 | 3300006042 | Ga0075368_10060664 | Ga0075368_100606642 | 268 |
| 154 | 3300006178 | Ga0075367_10019261 | Ga0075367_100192613 | 268 |
| 155 | 3300044765 | Ga0466970_0003750 | Ga0466970_0003750_3451_4257 | 268 |
| 156 | 3300044842 | Ga0466957_0285666 | Ga0466957_0285666_218_1024 | 268 |
| 157 | 3300046463 | Ga0495653_0153225 | Ga0495653_0153225_557_1447 | 268 |
| 158 | 3300048922 | Ga0496119_0167966 | Ga0496119_0167966_247_1107 | 268 |
| 159 | iso_pu_bacteria | 2643221962 | 2645723325 | 268 |
| 160 | iso_pu_bacteria | 2929212328 | 2929213883 | 268 |
| 161 | 3300044693 | Ga0466961_0115382 | Ga0466961_0115382_145_1008 | 269 |
| 162 | iso_pu_bacteria | 2915358134 | 2915358555 | 269 |
| 163 | iso_pu_bacteria | 2643221641 | 2644229778 | 270 |
| 164 | iso_pu_bacteria | 2739367898 | 2740168209 | 270 |
| 165 | iso_pu_bacteria | 8054609563 | 8054613600 | 270 |
| 166 | 3300030744 | Ga0316181_1286488 | Ga0316181_12864883 | 271 |
| 167 | 3300030745 | Ga0316182_1072268 | Ga0316182_10722682 | 271 |
| 168 | 3300044684 | Ga0466966_0016556 | Ga0466966_0016556_2607_3425 | 271 |
| 169 | 3300049592 | Ga0501076_0573144 | Ga0501076_0573144_49_864 | 271 |
| 170 | iso_pu_bacteria | 2643221576 | 2643891876 | 271 |
| 171 | iso_pu_bacteria | 2643221590 | 2643960928 | 271 |
| 172 | iso_pu_bacteria | 2643221604 | 2644031988 | 271 |
| 173 | iso_pu_bacteria | 2811994874 | 2812334756 | 271 |
| 174 | iso_pu_bacteria | 2855386786 | 2855388205 | 271 |
| 175 | iso_pu_bacteria | 2855386786 | 2855391202 | 271 |
| 176 | iso_pu_bacteria | 8054472261 | 8054473563 | 271 |
| 177 | 3300041456 | Ga0451795_0595851 | Ga0451795_0595851_848_1666 | 272 |
| 178 | 3300045976 | Ga0466967_0013778 | Ga0466967_0013778_648_1481 | 272 |
| 179 | 3300046471 | Ga0495650_0030282 | Ga0495650_0030282_627_1445 | 272 |
| 180 | 3300005548 | Ga0070665_100001212 | Ga0070665_10000121225 | 273 |
| 181 | 3300028379 | Ga0268266_10002730 | Ga0268266_100027306 | 273 |
| 182 | 3300041413 | Ga0439465_0033468 | Ga0439465_0033468_562_1419 | 273 |
| 183 | iso_pu_bacteria | 2842134933 | 2842138914 | 273 |
| 184 | 3300006038 | Ga0075365_10242501 | Ga0075365_102425012 | 274 |
| 185 | 3300031731 | Ga0307405_10230399 | Ga0307405_102303992 | 274 |
| 186 | 3300031903 | Ga0307407_10149347 | Ga0307407_101493472 | 274 |
| 187 | 3300031911 | Ga0307412_10195638 | Ga0307412_101956382 | 274 |
| 188 | 3300031995 | Ga0307409_100177881 | Ga0307409_1001778812 | 274 |
| 189 | 3300032002 | Ga0307416_100163216 | Ga0307416_1001632162 | 274 |
| 190 | 3300044658 | Ga0466972_0110244 | Ga0466972_0110244_264_1109 | 274 |
| 191 | 3300049575 | Ga0501039_0027681 | Ga0501039_0027681_558_1382 | 274 |
| 192 | 3300049575 | Ga0501039_0069236 | Ga0501039_0069236_923_1747 | 274 |
| 193 | 3300049576 | Ga0501040_0202444 | Ga0501040_0202444_267_1091 | 274 |
| 194 | 3300049577 | Ga0501041_0181855 | Ga0501041_0181855_57_881 | 274 |
| 195 | 3300049591 | Ga0501075_0190342 | Ga0501075_0190342_183_1007 | 274 |
| 196 | 3300049824 | Ga0501045_0172098 | Ga0501045_0172098_478_1302 | 274 |
| 197 | 3300054114 | Ga0501084_0453512 | Ga0501084_0453512_146_970 | 274 |
| 198 | 3300005355 | Ga0070671_100001106 | Ga0070671_1000011062 | 275 |
| 199 | 3300005548 | Ga0070665_100001291 | Ga0070665_10000129113 | 275 |
| 200 | 3300005841 | Ga0068863_100002702 | Ga0068863_1000027027 | 275 |
| 201 | 3300005841 | Ga0068863_100377962 | Ga0068863_1003779622 | 275 |
| 202 | 3300005843 | Ga0068860_100005801 | Ga0068860_10000580111 | 275 |
| 203 | 3300006051 | Ga0075364_10169661 | Ga0075364_101696612 | 275 |
| 204 | 3300006178 | Ga0075367_10047260 | Ga0075367_100472603 | 275 |
| 205 | 3300009101 | Ga0105247_10036309 | Ga0105247_100363092 | 275 |
| 206 | 3300013105 | Ga0157369_10446638 | Ga0157369_104466382 | 275 |
| 207 | 3300014325 | Ga0163163_10901103 | Ga0163163_109011031 | 275 |
| 208 | 3300014968 | Ga0157379_10059550 | Ga0157379_100595502 | 275 |
| 209 | 3300025931 | Ga0207644_10003632 | Ga0207644_100036322 | 275 |
| 210 | 3300026088 | Ga0207641_10036172 | Ga0207641_100361723 | 275 |
| 211 | 3300026088 | Ga0207641_10352339 | Ga0207641_103523392 | 275 |
| 212 | 3300026095 | Ga0207676_10102077 | Ga0207676_101020772 | 275 |
| 213 | 3300037418 | Ga0395900_0095466 | Ga0395900_0095466_231_1058 | 275 |
| 214 | 3300037466 | Ga0395898_0343694 | Ga0395898_0343694_440_1267 | 275 |
| 215 | 3300038443 | Ga0395901_0799292 | Ga0395901_0799292_79_906 | 275 |
| 216 | 3300044658 | Ga0466972_0000932 | Ga0466972_0000932_8282_9109 | 275 |
| 217 | 3300044683 | Ga0466965_0013484 | Ga0466965_0013484_878_1705 | 275 |
| 218 | 3300044683 | Ga0466965_0016440 | Ga0466965_0016440_1888_2715 | 275 |
| 219 | 3300044765 | Ga0466970_0033479 | Ga0466970_0033479_1416_2243 | 275 |
| 220 | 3300044842 | Ga0466957_0170055 | Ga0466957_0170055_480_1307 | 275 |
| 221 | 3300044901 | Ga0466960_0005088 | Ga0466960_0005088_1901_2728 | 275 |
| 222 | 3300045049 | Ga0466959_0343509 | Ga0466959_0343509_153_980 | 275 |
| 223 | 3300048903 | Ga0496100_0006244 | Ga0496100_0006244_2261_3091 | 275 |
| 224 | 3300048904 | Ga0496101_0006973 | Ga0496101_0006973_5362_6192 | 275 |
| 225 | 3300048905 | Ga0496102_0000772 | Ga0496102_0000772_16146_16976 | 275 |
| 226 | 3300048906 | Ga0496103_0000018 | Ga0496103_0000018_10868_11698 | 275 |
| 227 | 3300048908 | Ga0496105_0013729 | Ga0496105_0013729_1795_2625 | 275 |
| 228 | 3300048913 | Ga0496110_0052506 | Ga0496110_0052506_1469_2299 | 275 |
| 229 | 3300048919 | Ga0496116_0000173 | Ga0496116_0000173_55494_56324 | 275 |
| 230 | 3300048920 | Ga0496117_0000144 | Ga0496117_0000144_107257_108087 | 275 |
| 231 | 3300048921 | Ga0496118_0000096 | Ga0496118_0000096_118403_119233 | 275 |
| 232 | 3300048922 | Ga0496119_0001793 | Ga0496119_0001793_23975_24805 | 275 |
| 233 | 3300048923 | Ga0496120_0034752 | Ga0496120_0034752_443_1273 | 275 |
| 234 | 3300048924 | Ga0496121_0026060 | Ga0496121_0026060_2070_2900 | 275 |
| 235 | 3300048927 | Ga0496124_0012327 | Ga0496124_0012327_1540_2370 | 275 |
| 236 | 3300048928 | Ga0496125_0037356 | Ga0496125_0037356_2359_3189 | 275 |
| 237 | 3300048929 | Ga0496126_0000330 | Ga0496126_0000330_44750_45580 | 275 |
| 238 | 3300049568 | Ga0501031_0206513 | Ga0501031_0206513_100_927 | 275 |
| 239 | 3300049575 | Ga0501039_0331485 | Ga0501039_0331485_86_913 | 275 |
| 240 | 3300049581 | Ga0501047_0113581 | Ga0501047_0113581_1425_2273 | 275 |
| 241 | 3300050492 | nmdc:mga0yw44_241619_c1 | nmdc:mga0yw44_241619_c1_35_862 | 275 |
| 242 | 3300050494 | nmdc:mga06z11_22325_c1 | nmdc:mga06z11_22325_c1_1205_2032 | 275 |
| 243 | 3300053096 | Ga0500641_0002983 | Ga0500641_0002983_3588_4415 | 275 |
| 244 | iso_pu_bacteria | 2816332139 | 2816505601 | 275 |
| 245 | 3300002075 | JGI24738J21930_10002723 | JGI24738J21930_100027234 | 276 |
| 246 | 3300005337 | Ga0070682_100250641 | Ga0070682_1002506412 | 276 |
| 247 | 3300044693 | Ga0466961_0108464 | Ga0466961_0108464_706_1557 | 276 |
| 248 | 3300044694 | Ga0466963_0023604 | Ga0466963_0023604_1152_1988 | 276 |
| 249 | 3300049571 | Ga0501034_0131518 | Ga0501034_0131518_109_960 | 276 |
| 250 | 3300049572 | Ga0501036_0002686 | Ga0501036_0002686_9305_10156 | 276 |
| 251 | 3300049573 | Ga0501037_0037803 | Ga0501037_0037803_2105_2956 | 276 |
| 252 | 3300049574 | Ga0501038_0008702 | Ga0501038_0008702_6704_7555 | 276 |
| 253 | 3300049575 | Ga0501039_0038886 | Ga0501039_0038886_1340_2191 | 276 |
| 254 | 3300049578 | Ga0501042_0018782 | Ga0501042_0018782_1988_2839 | 276 |
| 255 | 3300049579 | Ga0501043_0005783 | Ga0501043_0005783_5306_6157 | 276 |
| 256 | 3300049581 | Ga0501047_0023978 | Ga0501047_0023978_3104_3955 | 276 |
| 257 | 3300049582 | Ga0501048_0033085 | Ga0501048_0033085_2190_3041 | 276 |
| 258 | 3300049589 | Ga0501073_0010268 | Ga0501073_0010268_2738_3589 | 276 |
| 259 | 3300049590 | Ga0501074_0011102 | Ga0501074_0011102_3288_4139 | 276 |
| 260 | 3300049823 | Ga0501044_0089207 | Ga0501044_0089207_424_1275 | 276 |
| 261 | iso_pu_bacteria | 2565956761 | 2566992748 | 276 |
| 262 | iso_pu_bacteria | 2904535858 | 2904540264 | 276 |
| 263 | iso_pu_bacteria | 2922554459 | 2922556294 | 276 |
| 264 | 3300005353 | Ga0070669_100300354 | Ga0070669_1003003542 | 277 |
| 265 | 3300025923 | Ga0207681_10332401 | Ga0207681_103324011 | 277 |
| 266 | 3300005367 | Ga0070667_100087698 | Ga0070667_1000876983 | 278 |
| 267 | 3300041452 | Ga0451793_1470662 | Ga0451793_1470662_259_1098 | 278 |
| 268 | 3300041491 | Ga0451833_0349589 | Ga0451833_0349589_1489_2328 | 278 |
| 269 | 3300042004 | Ga0439445_0015489 | Ga0439445_0015489_333_1169 | 278 |
| 270 | 3300049587 | Ga0501071_0310650 | Ga0501071_0310650_220_1056 | 278 |
| 271 | iso_pu_bacteria | 2565956761 | 2566992588 | 278 |
| 272 | iso_pu_bacteria | 2643221576 | 2643890756 | 278 |
| 273 | iso_pu_bacteria | 2738541308 | 2738887594 | 278 |
| 274 | iso_pu_bacteria | 2738543034 | 2739366614 | 278 |
| 275 | iso_pu_bacteria | 2744054611 | 2744957445 | 278 |
| 276 | iso_pu_bacteria | 2904535858 | 2904541550 | 278 |
| 277 | iso_pu_bacteria | 2904765812 | 2904767495 | 278 |
| 278 | iso_pu_bacteria | 2904770941 | 2904774840 | 278 |
| 279 | iso_pu_bacteria | 2908811453 | 2908813142 | 278 |
| 280 | iso_pu_bacteria | 2919420072 | 2919423885 | 278 |
| 281 | iso_pu_bacteria | 2919432681 | 2919436663 | 278 |
| 282 | iso_pu_bacteria | 2922554459 | 2922560074 | 278 |
| 283 | 3300005327 | Ga0070658_10156659 | Ga0070658_101566592 | 279 |
| 284 | 3300005455 | Ga0070663_100393017 | Ga0070663_1003930171 | 279 |
| 285 | 3300009545 | Ga0105237_10450685 | Ga0105237_104506852 | 279 |
| 286 | 3300025914 | Ga0207671_10310014 | Ga0207671_103100142 | 279 |
| 287 | 3300026067 | Ga0207678_10151556 | Ga0207678_101515562 | 279 |
| 288 | 3300044656 | Ga0466969_0029710 | Ga0466969_0029710_1490_2377 | 279 |
| 289 | 3300044658 | Ga0466972_0120062 | Ga0466972_0120062_285_1142 | 279 |
| 290 | 3300044684 | Ga0466966_0000562 | Ga0466966_0000562_6680_7567 | 279 |
| 291 | 3300044693 | Ga0466961_0006272 | Ga0466961_0006272_3955_4836 | 279 |
| 292 | 3300044693 | Ga0466961_0008034 | Ga0466961_0008034_3052_3942 | 279 |
| 293 | 3300044693 | Ga0466961_0008893 | Ga0466961_0008893_959_1846 | 279 |
| 294 | 3300044693 | Ga0466961_0022980 | Ga0466961_0022980_1690_2556 | 279 |
| 295 | 3300044693 | Ga0466961_0034897 | Ga0466961_0034897_1439_2311 | 279 |
| 296 | 3300044693 | Ga0466961_0169746 | Ga0466961_0169746_100_966 | 279 |
| 297 | 3300044694 | Ga0466963_0002108 | Ga0466963_0002108_3398_4264 | 279 |
| 298 | 3300044694 | Ga0466963_0031067 | Ga0466963_0031067_2366_3238 | 279 |
| 299 | 3300044694 | Ga0466963_0086223 | Ga0466963_0086223_935_1819 | 279 |
| 300 | 3300044706 | Ga0466964_0039708 | Ga0466964_0039708_99_989 | 279 |
| 301 | 3300044719 | Ga0466971_0039767 | Ga0466971_0039767_426_1316 | 279 |
| 302 | 3300044842 | Ga0466957_0105731 | Ga0466957_0105731_176_1066 | 279 |
| 303 | 3300044901 | Ga0466960_0174227 | Ga0466960_0174227_297_1148 | 279 |
| 304 | 3300045049 | Ga0466959_0028762 | Ga0466959_0028762_1593_2483 | 279 |
| 305 | 3300045049 | Ga0466959_0044748 | Ga0466959_0044748_121_1008 | 279 |
| 306 | 3300045836 | Ga0466958_0019629 | Ga0466958_0019629_2584_3474 | 279 |
| 307 | 3300045836 | Ga0466958_0043868 | Ga0466958_0043868_118_984 | 279 |
| 308 | 3300045836 | Ga0466958_0173638 | Ga0466958_0173638_101_973 | 279 |
| 309 | 3300045976 | Ga0466967_0002628 | Ga0466967_0002628_1797_2669 | 279 |
| 310 | 3300045976 | Ga0466967_0003302 | Ga0466967_0003302_66_932 | 279 |
| 311 | 3300045976 | Ga0466967_0018345 | Ga0466967_0018345_2002_2874 | 279 |
| 312 | 3300045976 | Ga0466967_0056929 | Ga0466967_0056929_1410_2282 | 279 |
| 313 | 3300045976 | Ga0466967_0057017 | Ga0466967_0057017_993_1856 | 279 |
| 314 | 3300045976 | Ga0466967_0146205 | Ga0466967_0146205_729_1601 | 279 |
| 315 | 3300049569 | Ga0501032_0006037 | Ga0501032_0006037_807_1682 | 279 |
| 316 | 3300049570 | Ga0501033_0224123 | Ga0501033_0224123_151_1026 | 279 |
| 317 | 3300049574 | Ga0501038_0000987 | Ga0501038_0000987_7358_8233 | 279 |
| 318 | 3300049579 | Ga0501043_0044559 | Ga0501043_0044559_1278_2153 | 279 |
| 319 | 3300049580 | Ga0501046_0020411 | Ga0501046_0020411_4114_4989 | 279 |
| 320 | 3300049581 | Ga0501047_0000660 | Ga0501047_0000660_103_978 | 279 |
| 321 | 3300049582 | Ga0501048_0000630 | Ga0501048_0000630_22101_22976 | 279 |
| 322 | 3300049586 | Ga0501070_0004851 | Ga0501070_0004851_8368_9243 | 279 |
| 323 | 3300049822 | Ga0501035_0012627 | Ga0501035_0012627_2493_3368 | 279 |
| 324 | 3300061719 | Ga0466962_0022722 | Ga0466962_0022722_29_895 | 279 |
| 325 | 3300061719 | Ga0466962_0046956 | Ga0466962_0046956_1140_2012 | 279 |
| 326 | iso_pu_bacteria | 2547132424 | 2548699204 | 279 |
| 327 | iso_pu_bacteria | 2551306166 | 2552111001 | 279 |
| 328 | iso_pu_bacteria | 2643221692 | 2644517763 | 279 |
| 329 | 3300001989 | JGI24739J22299_10034565 | JGI24739J22299_100345652 | 280 |
| 330 | 3300028381 | Ga0268264_10371506 | Ga0268264_103715061 | 280 |
| 331 | 3300028794 | Ga0307515_10458601 | Ga0307515_104586011 | 280 |
| 332 | 3300031456 | Ga0307513_10008553 | Ga0307513_100085535 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fef-assembly1.cif.gz_J | structure of mce1 transporter from mycobacterium smegmatis (map0) | 0.8732 | 20 | 276 |
| 6z5u-assembly1.cif.gz_B | cryo-em structure of the a. baumannii mlabdef complex bound to appnhp | 0.859 | 9 | 271 |
| 6z5u-assembly1.cif.gz_B | cryo-em structure of the a. baumannii mlabdef complex bound to appnhp | 0.8527 | 9 | 271 |
| 8fef-assembly1.cif.gz_J | structure of mce1 transporter from mycobacterium smegmatis (map0) | 0.8516 | 20 | 276 |
| 7ch9-assembly1.cif.gz_H | cryo-em structure of p.aeruginosa mlafebd | 0.8295 | 7 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4937 | 106 | 267 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.489 | 107 | 267 | 3.40.1710.10 |
| af_Q96JW4_154_338_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.4661 | 58 | 266 | 1.10.357.20 |
| af_Q96JW4_154_338_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.4574 | 58 | 266 | 1.10.357.20 |
| af_Q3V050_53_213_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.403 | 66 | 265 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Q2MMZ6-F1-model_v4 | ABC transporter permease | 0.9465 | 44 | 273 |
GO:0005548
GO:0043190 |
| AF-A0A3D4R162-F1-model_v4 | ABC transporter permease | 0.9359 | 43 | 274 |
GO:0005548
GO:0043190 |
| AF-A0A0Q8WYY5-F1-model_v4 | ABC transporter permease | 0.9357 | 11 | 273 |
GO:0005548
GO:0043190 |
| AF-A0A7C7ZVU2-F1-model_v4 | ABC transporter permease | 0.9326 | 44 | 273 |
GO:0005548
GO:0043190 |
| AF-A0A6M1YHF2-F1-model_v4 | Putative phospholipid ABC transporter permease protein MlaE | 0.9306 | 17 | 270 |
GO:0005548
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar