F410868

General Info

Members Datasets Scaffolds Average Seq Length
332 223 332 102

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100129461|Ga0068857_1001294613
Length 124
Sequence MLRYGNLYDKVYMIPDHCNGGITTMAIDDKTRTELEAAAFRRLVGHLRERTDVQNIDLMNLAGFCRNCLSNWLKDAADEKGVALTKDESREEVYGMPYETWKAKHQGSATPEQMAAMKKVHPGH

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 2.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 0
Rhizoplane 3.92
Rhizosphere 79.22
Stem 0
Stem Tuber 0
Unclassified 8.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030061 3300001989 Bacteria 1884
2 JGI24737J22298_10059233 3300001990 Bacteria 1154
3 JGI24738J21930_10058259 3300002075 Bacteria 791
4 JGI25153J46596_10018903 3300003215 Bacteria 2657
5 JGI25404J52841_10088742 3300003659 Bacteria 646
6 Ga0055526_1027195 3300003771 Bacteria 1775
7 JGI25405J52794_10011686 3300003911 Bacteria 1682
8 Ga0058862_11878546 3300004803 Bacteria 598
9 Ga0065165_1117674 3300005262 Bacteria 648
10 Ga0070658_10243725 3300005327 Bacteria 1524
11 Ga0070680_100082707 3300005336 Bacteria 2650
12 Ga0070680_100281590 3300005336 Bacteria 1409
13 Ga0070661_100982520 3300005344 Bacteria 700
14 Ga0070671_100290172 3300005355 Bacteria 1392
15 Ga0070659_100068435 3300005366 Bacteria 2816
16 Ga0070659_101711647 3300005366 Bacteria 562
17 Ga0070709_10231308 3300005434 Bacteria 1323
18 Ga0070709_10232911 3300005434 Bacteria 1319
19 Ga0070714_100016681 3300005435 Bacteria 5936
20 Ga0070714_100067039 3300005435 Bacteria 3094
21 Ga0070713_100021481 3300005436 Bacteria 4968
22 Ga0070713_100033548 3300005436 Bacteria 4113
23 Ga0070713_100113328 3300005436 Bacteria 2367
24 Ga0070713_100331053 3300005436 Bacteria 1409
25 Ga0070713_100426876 3300005436 Bacteria 1242
26 Ga0070711_101554521 3300005439 Bacteria 578
27 Ga0070705_100014784 3300005440 Bacteria 4024
28 Ga0070700_100097753 3300005441 Bacteria 1929
29 Ga0070694_100272618 3300005444 Bacteria 1287
30 Ga0070708_100684531 3300005445 Bacteria 966
31 Ga0070663_101359672 3300005455 Bacteria 628
32 Ga0070662_100767071 3300005457 Bacteria 818
33 Ga0070681_10019896 3300005458 Bacteria 6726
34 Ga0070706_100452587 3300005467 Bacteria 1195
35 Ga0070698_102060591 3300005471 Bacteria 524
36 Ga0070699_100377164 3300005518 Bacteria 1280
37 Ga0070679_100203507 3300005530 Bacteria 1944
38 Ga0070679_100586828 3300005530 Bacteria 1058
39 Ga0070679_101950240 3300005530 Bacteria 536
40 Ga0070697_100480699 3300005536 Bacteria 1085
41 Ga0068853_100064464 3300005539 Bacteria 3177
42 Ga0070695_100115151 3300005545 Bacteria 1831
43 Ga0070696_100002378 3300005546 Bacteria 12450
44 Ga0070693_100195329 3300005547 Bacteria 1311
45 Ga0070665_100040655 3300005548 Bacteria 4673
46 Ga0070704_100000451 3300005549 Bacteria 19360
47 Ga0068855_101266551 3300005563 Bacteria 764
48 Ga0068857_100129461 3300005577 Bacteria 2276
49 Ga0068854_101260867 3300005578 Bacteria 664
50 Ga0068854_101595070 3300005578 Bacteria 594
51 Ga0068852_100392855 3300005616 Bacteria 1363
52 Ga0068861_102106901 3300005719 Bacteria 564
53 Ga0068862_100936764 3300005844 Bacteria 853
54 Ga0081455_10000774 3300005937 Bacteria 41248
55 Ga0081455_10020355 3300005937 Bacteria 6251
56 Ga0081455_10272218 3300005937 Bacteria 1227
57 Ga0081540_1005098 3300005983 Bacteria 9852
58 Ga0081540_1009328 3300005983 Bacteria 6768
59 Ga0070717_10002016 3300006028 Bacteria 14209
60 Ga0070717_10314643 3300006028 Bacteria 1394
61 Ga0070717_10681234 3300006028 Bacteria 934
62 Ga0075365_10555905 3300006038 Bacteria 812
63 Ga0075368_10291175 3300006042 Bacteria 703
64 Ga0075363_100263009 3300006048 Bacteria 995
65 Ga0075363_100495307 3300006048 Bacteria 725
66 Ga0070712_100164982 3300006175 Bacteria 1714
67 Ga0070712_100269979 3300006175 Bacteria 1366
68 Ga0070712_101015400 3300006175 Bacteria 718
69 Ga0075367_10364882 3300006178 Bacteria 912
70 Ga0075428_101330985 3300006844 Bacteria 755
71 Ga0075428_102230210 3300006844 Bacteria 564
72 Ga0075434_100011347 3300006871 Bacteria 8400
73 Ga0075434_100720071 3300006871 Bacteria 1015
74 Ga0075429_101582217 3300006880 Bacteria 570
75 Ga0075436_100142438 3300006914 Bacteria 1685
76 Ga0075435_100020491 3300007076 Bacteria 5068
77 Ga0105240_10024173 3300009093 Bacteria 8017
78 Ga0105240_11366460 3300009093 Bacteria 745
79 Ga0105240_12118111 3300009093 Bacteria 584
80 Ga0114129_10043032 3300009147 Bacteria 6357
81 Ga0105248_10028042 3300009177 Bacteria 6272
82 Ga0105237_10082386 3300009545 Bacteria 3208
83 Ga0105237_10092764 3300009545 Bacteria 3009
84 Ga0105237_10218923 3300009545 Bacteria 1904
85 Ga0105237_10994791 3300009545 Bacteria 845
86 Ga0105238_10045610 3300009551 Bacteria 4428
87 Ga0105238_11670321 3300009551 Bacteria 668
88 Ga0105249_10002317 3300009553 Bacteria 16530
89 Ga0157373_10027222 3300013100 Bacteria 4124
90 Ga0157373_11563266 3300013100 Bacteria 505
91 Ga0157370_10204278 3300013104 Bacteria 1832
92 Ga0157370_10517796 3300013104 Bacteria 1095
93 Ga0157370_10823860 3300013104 Bacteria 844
94 Ga0157370_11304454 3300013104 Bacteria 654
95 Ga0157370_11662578 3300013104 Bacteria 573
96 Ga0157369_10005391 3300013105 Bacteria 14886
97 Ga0157369_10048517 3300013105 Bacteria 4607
98 Ga0157369_11094195 3300013105 Bacteria 815
99 Ga0163162_10484911 3300013306 Bacteria 1367
100 Ga0157372_10692274 3300013307 Bacteria 1186
101 Ga0157372_11251203 3300013307 Bacteria 857
102 Ga0157372_12323592 3300013307 Bacteria 616
103 Ga0157375_10651601 3300013308 Bacteria 1209
104 Ga0163163_10006622 3300014325 Bacteria 10145
105 Ga0163163_11330277 3300014325 Bacteria 780
106 Ga0157376_11572843 3300014969 Bacteria 691
107 Ga0163161_10352078 3300017792 Bacteria 1171
108 Ga0206349_1050715 3300020075 Bacteria 761
109 Ga0206352_10211722 3300020078 Bacteria 552
110 Ga0213873_10188288 3300021358 Bacteria 636
111 Ga0213874_10024503 3300021377 Bacteria 1693
112 Ga0213876_10404873 3300021384 Bacteria 726
113 Ga0213875_10283905 3300021388 Bacteria 782
114 Ga0224712_10020049 3300022467 Bacteria 2264
115 Ga0224712_10129604 3300022467 Bacteria 1100
116 Ga0224712_10242863 3300022467 Bacteria 830
117 Ga0209564_1000946 3300025295 Bacteria 37393
118 Ga0209758_1000474 3300025297 Bacteria 66329
119 Ga0207692_10474490 3300025898 Bacteria 791
120 Ga0207699_10209958 3300025906 Bacteria 1324
121 Ga0207684_11174676 3300025910 Bacteria 636
122 Ga0207707_10377845 3300025912 Bacteria 1218
123 Ga0207695_10041564 3300025913 Bacteria 4920
124 Ga0207671_10089125 3300025914 Bacteria 2321
125 Ga0207671_10803299 3300025914 Bacteria 746
126 Ga0207693_10276239 3300025915 Bacteria 1316
127 Ga0207693_10569178 3300025915 Bacteria 883
128 Ga0207660_10297738 3300025917 Bacteria 1284
129 Ga0207660_11680650 3300025917 Bacteria 511
130 Ga0207694_10107825 3300025924 Bacteria 2213
131 Ga0207694_10239977 3300025924 Bacteria 1481
132 Ga0207694_11600582 3300025924 Bacteria 549
133 Ga0207700_10003222 3300025928 Bacteria 9425
134 Ga0207700_10037832 3300025928 Bacteria 3498
135 Ga0207700_10081890 3300025928 Bacteria 2522
136 Ga0207700_10766708 3300025928 Bacteria 862
137 Ga0207664_10021693 3300025929 Bacteria 4783
138 Ga0207664_10238499 3300025929 Bacteria 1583
139 Ga0207664_10450178 3300025929 Bacteria 1149
140 Ga0207661_10006894 3300025944 Bacteria 8052
141 Ga0207667_10961950 3300025949 Bacteria 843
142 Ga0207712_10137846 3300025961 Bacteria 1868
143 Ga0207668_10228331 3300025972 Bacteria 1499
144 Ga0207639_10440752 3300026041 Bacteria 1181
145 Ga0207708_10080863 3300026075 Bacteria 2497
146 Ga0207674_10050892 3300026116 Bacteria 4230
147 Ga0207698_10390176 3300026142 Bacteria 1327
148 Ga0207698_10936149 3300026142 Bacteria 875
149 Ga0209813_10060156 3300027866 Bacteria 1211
150 Ga0268266_10061170 3300028379 Bacteria 3247
151 Ga0268265_10716375 3300028380 Bacteria 968
152 Ga0265318_10081727 3300028577 Bacteria 1193
153 Ga0307517_10646076 3300028786 Bacteria 515
154 Ga0265338_10072982 3300028800 Bacteria 2927
155 Ga0265338_10842178 3300028800 Bacteria 627
156 Ga0265330_10036735 3300031235 Bacteria 2182
157 Ga0265332_10036432 3300031238 Bacteria 2136
158 Ga0265320_10078284 3300031240 Bacteria 1546
159 Ga0265325_10018555 3300031241 Bacteria 3858
160 Ga0265325_10020439 3300031241 Bacteria 3649
161 Ga0265340_10056984 3300031247 Bacteria 1878
162 Ga0265339_10000128 3300031249 Bacteria 62891
163 Ga0265331_10016939 3300031250 Bacteria 3813
164 Ga0265316_10133014 3300031344 Bacteria 1872
165 Ga0265313_10000246 3300031595 Bacteria 58903
166 Ga0307508_10060278 3300031616 Bacteria 3356
167 Ga0265314_10051186 3300031711 Bacteria 2878
168 Ga0265342_10071290 3300031712 Bacteria 2025
169 Ga0307413_11212976 3300031824 Bacteria 657
170 Ga0307412_10535801 3300031911 Bacteria 981
171 Ga0307416_101058868 3300032002 Bacteria 915
172 Ga0307414_11406955 3300032004 Bacteria 648
173 Ga0307411_11142141 3300032005 Bacteria 704
174 Ga0307510_10021634 3300033180 Bacteria 7493
175 Ga0373940_0163229 3300035088 Bacteria 716
176 Ga0373936_0134757 3300035113 Bacteria 1063
177 Ga0373943_0102175 3300035170 Bacteria 1501
178 Ga0373935_1325494 3300035692 Bacteria 538
179 Ga0373927_0494291 3300035695 Bacteria 808
180 Ga0373947_0439755 3300035725 Bacteria 883
181 Ga0395899_0131223 3300037312 Bacteria 1789
182 Ga0395900_0016204 3300037418 Bacteria 7593
183 Ga0395900_0251707 3300037418 Bacteria 1768
184 Ga0395898_0018364 3300037466 Bacteria 7133
185 Ga0395898_0081881 3300037466 Bacteria 3112
186 Ga0395898_1310446 3300037466 Bacteria 653
187 Ga0395905_1242880 3300037471 Bacteria 648
188 Ga0395905_1805624 3300037471 Bacteria 517
189 Ga0436364_1077928 3300037853 Bacteria 4644
190 Ga0436364_1091147 3300037853 Bacteria 575
191 Ga0436364_1479878 3300037853 Bacteria 568
192 Ga0395901_0055125 3300038443 Bacteria 4133
193 Ga0395901_0143811 3300038443 Bacteria 2507
194 Ga0436365_0441521 3300039437 Bacteria 985
195 Ga0436365_0608066 3300039437 Bacteria 1183
196 Ga0436365_0914429 3300039437 Bacteria 2302
197 Ga0436365_0982478 3300039437 Bacteria 4414
198 Ga0436365_1354869 3300039437 Bacteria 1464
199 Ga0436365_1424254 3300039437 Bacteria 523
200 Ga0436360_0786650 3300039438 Bacteria 918
201 Ga0436361_0588340 3300039447 Bacteria 547
202 Ga0436361_0653135 3300039447 Bacteria 644
203 Ga0436361_0972306 3300039447 Bacteria 1087
204 Ga0436363_0904821 3300039450 Bacteria 1666
205 Ga0436363_0964901 3300039450 Bacteria 539
206 Ga0436363_1234302 3300039450 Bacteria 678
207 Ga0436362_0897386 3300039453 Bacteria 860
208 Ga0436362_1015799 3300039453 Bacteria 583
209 Ga0436362_1173835 3300039453 Bacteria 954
210 Ga0451837_0285724 3300041494 Bacteria 794
211 Ga0451853_3528503 3300041512 Bacteria 773
212 Ga0439441_156509 3300042001 Bacteria 539
213 Ga0466963_0050794 3300044694 Bacteria 2745
214 Ga0466963_0392085 3300044694 Bacteria 979
215 Ga0466963_0870696 3300044694 Bacteria 635
216 Ga0466968_0098682 3300044735 Bacteria 1302
217 Ga0466970_0291723 3300044765 Bacteria 919
218 Ga0466957_0506521 3300044842 Bacteria 837
219 Ga0466960_0181620 3300044901 Bacteria 1141
220 Ga0466959_0402627 3300045049 Bacteria 930
221 Ga0466959_1196764 3300045049 Bacteria 505
222 Ga0466967_0577031 3300045976 Bacteria 1108
223 Ga0495639_0517229 3300046475 Bacteria 610
224 Ga0495648_0003557 3300046524 Bacteria 13636
225 Ga0495645_0033101 3300046543 Bacteria 3770
226 Ga0495668_0090365 3300046616 Bacteria 1678
227 Ga0495668_0368578 3300046616 Bacteria 789
228 Ga0495624_0475308 3300046690 Bacteria 748
229 Ga0495675_0625246 3300047444 Bacteria 609
230 Ga0495681_0261902 3300047470 Bacteria 679
231 Ga0496101_0183114 3300048904 Bacteria 1614
232 Ga0496104_0068183 3300048907 Bacteria 3380
233 Ga0496104_0078363 3300048907 Bacteria 3149
234 Ga0496105_0940841 3300048908 Bacteria 649
235 Ga0496106_0341135 3300048909 Bacteria 1203
236 Ga0496107_0065397 3300048910 Bacteria 2636
237 Ga0496108_0032413 3300048911 Bacteria 4340
238 Ga0496109_0007761 3300048912 Bacteria 9085
239 Ga0496109_0356946 3300048912 Bacteria 1381
240 Ga0496110_0572960 3300048913 Bacteria 1025
241 Ga0496110_1189685 3300048913 Bacteria 671
242 Ga0496112_0858988 3300048915 Bacteria 830
243 Ga0496114_0603075 3300048917 Bacteria 968
244 Ga0496117_0129281 3300048920 Bacteria 1534
245 Ga0496120_0069566 3300048923 Bacteria 1938
246 Ga0496121_0002265 3300048924 Bacteria 29946
247 Ga0496121_0087852 3300048924 Bacteria 2439
248 Ga0496123_0080762 3300048926 Bacteria 1979
249 Ga0496124_0123246 3300048927 Bacteria 2068
250 Ga0496126_0003779 3300048929 Bacteria 18791
251 Ga0496126_0128673 3300048929 Bacteria 2190
252 Ga0496126_0171394 3300048929 Bacteria 1849
253 Ga0501031_0001574 3300049568 Bacteria 14219
254 Ga0501031_0254016 3300049568 Bacteria 1142
255 Ga0501032_0019016 3300049569 Bacteria 4806
256 Ga0501032_0067799 3300049569 Bacteria 2383
257 Ga0501033_0000602 3300049570 Bacteria 33313
258 Ga0501033_0060817 3300049570 Bacteria 2785
259 Ga0501033_1204621 3300049570 Bacteria 501
260 Ga0501034_0232020 3300049571 Bacteria 1794
261 Ga0501034_0247319 3300049571 Bacteria 1728
262 Ga0501034_0261257 3300049571 Bacteria 1674
263 Ga0501034_0696737 3300049571 Bacteria 914
264 Ga0501034_0896512 3300049571 Bacteria 775
265 Ga0501036_0027497 3300049572 Bacteria 4805
266 Ga0501036_0040271 3300049572 Bacteria 3951
267 Ga0501036_0366626 3300049572 Bacteria 1202
268 Ga0501037_0005229 3300049573 Bacteria 9436
269 Ga0501037_0124417 3300049573 Bacteria 1852
270 Ga0501038_0043577 3300049574 Bacteria 3901
271 Ga0501038_0085575 3300049574 Bacteria 2651
272 Ga0501038_0115829 3300049574 Bacteria 2215
273 Ga0501039_0005003 3300049575 Bacteria 10058
274 Ga0501039_0377372 3300049575 Bacteria 1114
275 Ga0501041_0139074 3300049577 Bacteria 1514
276 Ga0501042_0310108 3300049578 Bacteria 1140
277 Ga0501043_0017795 3300049579 Bacteria 5571
278 Ga0501043_0317865 3300049579 Bacteria 1187
279 Ga0501046_0040410 3300049580 Bacteria 3727
280 Ga0501047_0108494 3300049581 Bacteria 2658
281 Ga0501047_0141174 3300049581 Bacteria 2287
282 Ga0501068_0069068 3300049584 Bacteria 2154
283 Ga0501069_0115284 3300049585 Bacteria 1532
284 Ga0501070_0083845 3300049586 Bacteria 2639
285 Ga0501070_0737121 3300049586 Bacteria 777
286 Ga0501072_0198037 3300049588 Bacteria 1602
287 Ga0501073_0030149 3300049589 Bacteria 3874
288 Ga0501073_0479470 3300049589 Bacteria 860
289 Ga0501075_0018700 3300049591 Bacteria 5018
290 Ga0501076_0009730 3300049592 Bacteria 7101
291 Ga0501076_0404192 3300049592 Bacteria 1123
292 Ga0501077_0012800 3300049593 Bacteria 5257
293 Ga0501079_0037376 3300049741 Bacteria 3742
294 Ga0501080_0028790 3300049742 Bacteria 5171
295 Ga0501080_0418906 3300049742 Bacteria 1203
296 Ga0501081_0005912 3300049743 Bacteria 7916
297 Ga0501083_0061150 3300049744 Bacteria 2515
298 Ga0501083_0350900 3300049744 Bacteria 959
299 Ga0501035_0019042 3300049822 Bacteria 6318
300 Ga0501035_0422535 3300049822 Bacteria 1106
301 Ga0501044_0023837 3300049823 Bacteria 6504
302 Ga0501044_0031893 3300049823 Bacteria 5542
303 Ga0501044_0371904 3300049823 Bacteria 1346
304 Ga0501045_0284916 3300049824 Bacteria 1230
305 nmdc:mga03683_2394_c1 3300050489 Bacteria 5817
306 nmdc:mga03n38_121298_c1 3300050490 Bacteria 1285
307 nmdc:mga03n38_890310_c1 3300050490 Bacteria 522
308 nmdc:mga00v17_2278_c1 3300050491 Bacteria 9845
309 nmdc:mga0yw44_19859_c1 3300050492 Bacteria 3715
310 nmdc:mga0yw44_423014_c1 3300050492 Bacteria 902
311 nmdc:mga06z11_290229_c1 3300050494 Bacteria 970
312 nmdc:mga04h51_53383_c1 3300050495 Bacteria 1363
313 nmdc:mga08y16_736204_c1 3300050511 Bacteria 983
314 nmdc:mga0n895_55443_c1 3300050512 Bacteria 3901
315 nmdc:mga0rr50_108076_c2 3300050513 Bacteria 1592
316 Ga0495601_0024377 3300053077 Bacteria 3726
317 Ga0495601_1067521 3300053077 Bacteria 506
318 Ga0495612_0029849 3300053078 Bacteria 2196
319 Ga0500643_000016 3300053087 Bacteria 309502
320 Ga0500651_0013998 3300053093 Bacteria 4898
321 Ga0500641_0025659 3300053096 Bacteria 2281
322 Ga0500650_0512941 3300053098 Bacteria 509
323 Ga0500618_097495 3300053125 Bacteria 661
324 Ga0500559_0018680 3300053136 Bacteria 2927
325 Ga0500577_0000206 3300053142 Bacteria 15624
326 Ga0500645_108376 3300053730 Bacteria 780
327 Ga0501084_0034571 3300054114 Bacteria 4226
328 Ga0587066_229911 3300059490 Bacteria 501
329 Ga0501082_0001505 3300060353 Bacteria 20531
330 Ga0501082_0475402 3300060353 Bacteria 1092
331 Ga0501082_0830947 3300060353 Bacteria 808
332 Ga0466962_0508011 3300061719 Bacteria 610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035088 Ga0373940_0163229 Ga0373940_0163229_240_638 86
2 3300048908 Ga0496105_0940841 Ga0496105_0940841_22_426 86
3 3300048913 Ga0496110_1189685 Ga0496110_1189685_41_445 86
4 3300009093 Ga0105240_12118111 Ga0105240_121181111 87
5 3300005327 Ga0070658_10243725 Ga0070658_102437253 99
6 3300005336 Ga0070680_100082707 Ga0070680_1000827073 99
7 3300005366 Ga0070659_101711647 Ga0070659_1017116471 99
8 3300005518 Ga0070699_100377164 Ga0070699_1003771642 99
9 3300005530 Ga0070679_100203507 Ga0070679_1002035072 99
10 3300005539 Ga0068853_100064464 Ga0068853_1000644643 99
11 3300005563 Ga0068855_101266551 Ga0068855_1012665512 99
12 3300005937 Ga0081455_10272218 Ga0081455_102722182 99
13 3300013100 Ga0157373_10027222 Ga0157373_100272223 99
14 3300013104 Ga0157370_10517796 Ga0157370_105177961 99
15 3300049585 Ga0501069_0115284 Ga0501069_0115284_761_1063 99
16 3300049742 Ga0501080_0418906 Ga0501080_0418906_375_677 99
17 3300053096 Ga0500641_0025659 Ga0500641_0025659_1272_1577 99
18 3300003659 JGI25404J52841_10088742 JGI25404J52841_100887422 100
19 3300003771 Ga0055526_1027195 Ga0055526_10271952 100
20 3300003911 JGI25405J52794_10011686 JGI25405J52794_100116862 100
21 3300004803 Ga0058862_11878546 Ga0058862_118785462 100
22 3300005262 Ga0065165_1117674 Ga0065165_11176741 100
23 3300005336 Ga0070680_100281590 Ga0070680_1002815902 100
24 3300005344 Ga0070661_100982520 Ga0070661_1009825201 100
25 3300005355 Ga0070671_100290172 Ga0070671_1002901721 100
26 3300005366 Ga0070659_100068435 Ga0070659_1000684353 100
27 3300005434 Ga0070709_10231308 Ga0070709_102313082 100
28 3300005434 Ga0070709_10232911 Ga0070709_102329112 100
29 3300005435 Ga0070714_100016681 Ga0070714_1000166814 100
30 3300005435 Ga0070714_100067039 Ga0070714_1000670392 100
31 3300005436 Ga0070713_100021481 Ga0070713_1000214813 100
32 3300005436 Ga0070713_100033548 Ga0070713_1000335485 100
33 3300005436 Ga0070713_100113328 Ga0070713_1001133282 100
34 3300005436 Ga0070713_100331053 Ga0070713_1003310532 100
35 3300005436 Ga0070713_100426876 Ga0070713_1004268762 100
36 3300005439 Ga0070711_101554521 Ga0070711_1015545212 100
37 3300005440 Ga0070705_100014784 Ga0070705_1000147843 100
38 3300005441 Ga0070700_100097753 Ga0070700_1000977531 100
39 3300005444 Ga0070694_100272618 Ga0070694_1002726182 100
40 3300005445 Ga0070708_100684531 Ga0070708_1006845311 100
41 3300005455 Ga0070663_101359672 Ga0070663_1013596722 100
42 3300005457 Ga0070662_100767071 Ga0070662_1007670711 100
43 3300005458 Ga0070681_10019896 Ga0070681_100198962 100
44 3300005467 Ga0070706_100452587 Ga0070706_1004525871 100
45 3300005471 Ga0070698_102060591 Ga0070698_1020605911 100
46 3300005530 Ga0070679_100586828 Ga0070679_1005868282 100
47 3300005530 Ga0070679_101950240 Ga0070679_1019502401 100
48 3300005536 Ga0070697_100480699 Ga0070697_1004806991 100
49 3300005545 Ga0070695_100115151 Ga0070695_1001151512 100
50 3300005546 Ga0070696_100002378 Ga0070696_1000023787 100
51 3300005547 Ga0070693_100195329 Ga0070693_1001953291 100
52 3300005549 Ga0070704_100000451 Ga0070704_10000045117 100
53 3300005577 Ga0068857_100129461 Ga0068857_1001294613 100
54 3300005578 Ga0068854_101260867 Ga0068854_1012608672 100
55 3300005578 Ga0068854_101595070 Ga0068854_1015950701 100
56 3300005616 Ga0068852_100392855 Ga0068852_1003928553 100
57 3300005719 Ga0068861_102106901 Ga0068861_1021069011 100
58 3300005844 Ga0068862_100936764 Ga0068862_1009367643 100
59 3300005937 Ga0081455_10000774 Ga0081455_1000077424 100
60 3300005983 Ga0081540_1009328 Ga0081540_10093283 100
61 3300006028 Ga0070717_10002016 Ga0070717_100020165 100
62 3300006028 Ga0070717_10314643 Ga0070717_103146433 100
63 3300006028 Ga0070717_10681234 Ga0070717_106812341 100
64 3300006038 Ga0075365_10555905 Ga0075365_105559052 100
65 3300006042 Ga0075368_10291175 Ga0075368_102911752 100
66 3300006048 Ga0075363_100263009 Ga0075363_1002630091 100
67 3300006048 Ga0075363_100495307 Ga0075363_1004953071 100
68 3300006175 Ga0070712_100164982 Ga0070712_1001649823 100
69 3300006175 Ga0070712_100269979 Ga0070712_1002699792 100
70 3300006175 Ga0070712_101015400 Ga0070712_1010154001 100
71 3300006178 Ga0075367_10364882 Ga0075367_103648821 100
72 3300006844 Ga0075428_101330985 Ga0075428_1013309851 100
73 3300006844 Ga0075428_102230210 Ga0075428_1022302102 100
74 3300006871 Ga0075434_100011347 Ga0075434_1000113475 100
75 3300006871 Ga0075434_100720071 Ga0075434_1007200712 100
76 3300006880 Ga0075429_101582217 Ga0075429_1015822171 100
77 3300006914 Ga0075436_100142438 Ga0075436_1001424381 100
78 3300007076 Ga0075435_100020491 Ga0075435_1000204914 100
79 3300009093 Ga0105240_10024173 Ga0105240_100241735 100
80 3300009093 Ga0105240_11366460 Ga0105240_113664602 100
81 3300009147 Ga0114129_10043032 Ga0114129_100430322 100
82 3300009177 Ga0105248_10028042 Ga0105248_100280423 100
83 3300009545 Ga0105237_10082386 Ga0105237_100823863 100
84 3300009545 Ga0105237_10092764 Ga0105237_100927642 100
85 3300009545 Ga0105237_10218923 Ga0105237_102189233 100
86 3300009551 Ga0105238_10045610 Ga0105238_100456104 100
87 3300009553 Ga0105249_10002317 Ga0105249_100023179 100
88 3300013100 Ga0157373_11563266 Ga0157373_115632662 100
89 3300013104 Ga0157370_10204278 Ga0157370_102042783 100
90 3300013104 Ga0157370_10823860 Ga0157370_108238602 100
91 3300013104 Ga0157370_11304454 Ga0157370_113044542 100
92 3300013104 Ga0157370_11662578 Ga0157370_116625781 100
93 3300013105 Ga0157369_10005391 Ga0157369_1000539111 100
94 3300013105 Ga0157369_10048517 Ga0157369_100485172 100
95 3300013105 Ga0157369_11094195 Ga0157369_110941951 100
96 3300013306 Ga0163162_10484911 Ga0163162_104849113 100
97 3300013307 Ga0157372_10692274 Ga0157372_106922742 100
98 3300013307 Ga0157372_11251203 Ga0157372_112512032 100
99 3300013307 Ga0157372_12323592 Ga0157372_123235921 100
100 3300013308 Ga0157375_10651601 Ga0157375_106516012 100
101 3300014325 Ga0163163_10006622 Ga0163163_100066225 100
102 3300014325 Ga0163163_11330277 Ga0163163_113302772 100
103 3300014969 Ga0157376_11572843 Ga0157376_115728432 100
104 3300017792 Ga0163161_10352078 Ga0163161_103520783 100
105 3300020075 Ga0206349_1050715 Ga0206349_10507151 100
106 3300020078 Ga0206352_10211722 Ga0206352_102117221 100
107 3300021358 Ga0213873_10188288 Ga0213873_101882881 100
108 3300021377 Ga0213874_10024503 Ga0213874_100245032 100
109 3300021384 Ga0213876_10404873 Ga0213876_104048732 100
110 3300021388 Ga0213875_10283905 Ga0213875_102839051 100
111 3300022467 Ga0224712_10020049 Ga0224712_100200493 100
112 3300022467 Ga0224712_10129604 Ga0224712_101296042 100
113 3300022467 Ga0224712_10242863 Ga0224712_102428632 100
114 3300025295 Ga0209564_1000946 Ga0209564_100094638 100
115 3300025898 Ga0207692_10474490 Ga0207692_104744902 100
116 3300025906 Ga0207699_10209958 Ga0207699_102099582 100
117 3300025910 Ga0207684_11174676 Ga0207684_111746761 100
118 3300025912 Ga0207707_10377845 Ga0207707_103778452 100
119 3300025913 Ga0207695_10041564 Ga0207695_100415646 100
120 3300025914 Ga0207671_10089125 Ga0207671_100891252 100
121 3300025915 Ga0207693_10276239 Ga0207693_102762391 100
122 3300025915 Ga0207693_10569178 Ga0207693_105691781 100
123 3300025917 Ga0207660_10297738 Ga0207660_102977383 100
124 3300025917 Ga0207660_11680650 Ga0207660_116806501 100
125 3300025924 Ga0207694_10107825 Ga0207694_101078253 100
126 3300025924 Ga0207694_11600582 Ga0207694_116005822 100
127 3300025928 Ga0207700_10003222 Ga0207700_100032229 100
128 3300025928 Ga0207700_10037832 Ga0207700_100378323 100
129 3300025928 Ga0207700_10081890 Ga0207700_100818903 100
130 3300025928 Ga0207700_10766708 Ga0207700_107667082 100
131 3300025929 Ga0207664_10021693 Ga0207664_100216934 100
132 3300025929 Ga0207664_10238499 Ga0207664_102384992 100
133 3300025929 Ga0207664_10450178 Ga0207664_104501781 100
134 3300025944 Ga0207661_10006894 Ga0207661_100068945 100
135 3300025949 Ga0207667_10961950 Ga0207667_109619502 100
136 3300025961 Ga0207712_10137846 Ga0207712_101378462 100
137 3300025972 Ga0207668_10228331 Ga0207668_102283312 100
138 3300026041 Ga0207639_10440752 Ga0207639_104407522 100
139 3300026075 Ga0207708_10080863 Ga0207708_100808633 100
140 3300026116 Ga0207674_10050892 Ga0207674_100508925 100
141 3300026142 Ga0207698_10390176 Ga0207698_103901762 100
142 3300026142 Ga0207698_10936149 Ga0207698_109361491 100
143 3300027866 Ga0209813_10060156 Ga0209813_100601562 100
144 3300028380 Ga0268265_10716375 Ga0268265_107163753 100
145 3300028577 Ga0265318_10081727 Ga0265318_100817271 100
146 3300028800 Ga0265338_10072982 Ga0265338_100729822 100
147 3300028800 Ga0265338_10842178 Ga0265338_108421781 100
148 3300031235 Ga0265330_10036735 Ga0265330_100367353 100
149 3300031238 Ga0265332_10036432 Ga0265332_100364324 100
150 3300031240 Ga0265320_10078284 Ga0265320_100782843 100
151 3300031241 Ga0265325_10018555 Ga0265325_100185556 100
152 3300031241 Ga0265325_10020439 Ga0265325_100204393 100
153 3300031247 Ga0265340_10056984 Ga0265340_100569842 100
154 3300031249 Ga0265339_10000128 Ga0265339_100001283 100
155 3300031250 Ga0265331_10016939 Ga0265331_100169394 100
156 3300031344 Ga0265316_10133014 Ga0265316_101330143 100
157 3300031595 Ga0265313_10000246 Ga0265313_1000024611 100
158 3300031616 Ga0307508_10060278 Ga0307508_100602784 100
159 3300031711 Ga0265314_10051186 Ga0265314_100511863 100
160 3300031712 Ga0265342_10071290 Ga0265342_100712902 100
161 3300031824 Ga0307413_11212976 Ga0307413_112129762 100
162 3300031911 Ga0307412_10535801 Ga0307412_105358012 100
163 3300032002 Ga0307416_101058868 Ga0307416_1010588682 100
164 3300032004 Ga0307414_11406955 Ga0307414_114069551 100
165 3300032005 Ga0307411_11142141 Ga0307411_111421412 100
166 3300035113 Ga0373936_0134757 Ga0373936_0134757_477_779 100
167 3300035170 Ga0373943_0102175 Ga0373943_0102175_954_1256 100
168 3300035692 Ga0373935_1325494 Ga0373935_1325494_191_493 100
169 3300035695 Ga0373927_0494291 Ga0373927_0494291_35_337 100
170 3300035725 Ga0373947_0439755 Ga0373947_0439755_401_703 100
171 3300037312 Ga0395899_0131223 Ga0395899_0131223_1394_1696 100
172 3300037418 Ga0395900_0016204 Ga0395900_0016204_6685_6987 100
173 3300037418 Ga0395900_0251707 Ga0395900_0251707_257_559 100
174 3300037466 Ga0395898_0018364 Ga0395898_0018364_6065_6367 100
175 3300037466 Ga0395898_0081881 Ga0395898_0081881_717_1019 100
176 3300037466 Ga0395898_1310446 Ga0395898_1310446_212_520 100
177 3300037853 Ga0436364_1077928 Ga0436364_1077928_970_1272 100
178 3300037853 Ga0436364_1091147 Ga0436364_1091147_239_541 100
179 3300037853 Ga0436364_1479878 Ga0436364_1479878_56_358 100
180 3300038443 Ga0395901_0055125 Ga0395901_0055125_3207_3509 100
181 3300038443 Ga0395901_0143811 Ga0395901_0143811_1875_2177 100
182 3300039437 Ga0436365_0608066 Ga0436365_0608066_780_1082 100
183 3300039437 Ga0436365_0914429 Ga0436365_0914429_49_351 100
184 3300039437 Ga0436365_0982478 Ga0436365_0982478_3132_3434 100
185 3300039437 Ga0436365_1354869 Ga0436365_1354869_741_1043 100
186 3300039437 Ga0436365_1424254 Ga0436365_1424254_83_385 100
187 3300039438 Ga0436360_0786650 Ga0436360_0786650_490_792 100
188 3300039447 Ga0436361_0588340 Ga0436361_0588340_101_403 100
189 3300039447 Ga0436361_0653135 Ga0436361_0653135_281_583 100
190 3300039447 Ga0436361_0972306 Ga0436361_0972306_321_623 100
191 3300039450 Ga0436363_0904821 Ga0436363_0904821_966_1268 100
192 3300039450 Ga0436363_0964901 Ga0436363_0964901_50_352 100
193 3300039450 Ga0436363_1234302 Ga0436363_1234302_42_344 100
194 3300039453 Ga0436362_0897386 Ga0436362_0897386_185_487 100
195 3300039453 Ga0436362_1015799 Ga0436362_1015799_192_515 100
196 3300039453 Ga0436362_1173835 Ga0436362_1173835_371_673 100
197 3300041494 Ga0451837_0285724 Ga0451837_0285724_157_462 100
198 3300042001 Ga0439441_156509 Ga0439441_156509_62_388 100
199 3300044694 Ga0466963_0392085 Ga0466963_0392085_224_526 100
200 3300044694 Ga0466963_0870696 Ga0466963_0870696_221_523 100
201 3300044735 Ga0466968_0098682 Ga0466968_0098682_323_628 100
202 3300044765 Ga0466970_0291723 Ga0466970_0291723_522_827 100
203 3300045049 Ga0466959_0402627 Ga0466959_0402627_244_546 100
204 3300046475 Ga0495639_0517229 Ga0495639_0517229_220_522 100
205 3300046524 Ga0495648_0003557 Ga0495648_0003557_10069_10371 100
206 3300046543 Ga0495645_0033101 Ga0495645_0033101_2739_3041 100
207 3300046616 Ga0495668_0090365 Ga0495668_0090365_1051_1365 100
208 3300046616 Ga0495668_0368578 Ga0495668_0368578_124_429 100
209 3300046690 Ga0495624_0475308 Ga0495624_0475308_339_641 100
210 3300047444 Ga0495675_0625246 Ga0495675_0625246_28_339 100
211 3300047470 Ga0495681_0261902 Ga0495681_0261902_219_521 100
212 3300048904 Ga0496101_0183114 Ga0496101_0183114_10_324 100
213 3300048907 Ga0496104_0068183 Ga0496104_0068183_2452_2754 100
214 3300048907 Ga0496104_0078363 Ga0496104_0078363_351_665 100
215 3300048909 Ga0496106_0341135 Ga0496106_0341135_718_1032 100
216 3300048910 Ga0496107_0065397 Ga0496107_0065397_237_539 100
217 3300048911 Ga0496108_0032413 Ga0496108_0032413_3197_3511 100
218 3300048912 Ga0496109_0007761 Ga0496109_0007761_5461_5775 100
219 3300048912 Ga0496109_0356946 Ga0496109_0356946_875_1177 100
220 3300048913 Ga0496110_0572960 Ga0496110_0572960_21_335 100
221 3300048915 Ga0496112_0858988 Ga0496112_0858988_313_627 100
222 3300048917 Ga0496114_0603075 Ga0496114_0603075_503_805 100
223 3300048920 Ga0496117_0129281 Ga0496117_0129281_598_912 100
224 3300048923 Ga0496120_0069566 Ga0496120_0069566_1226_1528 100
225 3300048924 Ga0496121_0002265 Ga0496121_0002265_2372_2674 100
226 3300048924 Ga0496121_0087852 Ga0496121_0087852_443_745 100
227 3300048926 Ga0496123_0080762 Ga0496123_0080762_539_853 100
228 3300048927 Ga0496124_0123246 Ga0496124_0123246_333_647 100
229 3300048929 Ga0496126_0003779 Ga0496126_0003779_2178_2480 100
230 3300048929 Ga0496126_0128673 Ga0496126_0128673_1544_1846 100
231 3300048929 Ga0496126_0171394 Ga0496126_0171394_629_931 100
232 3300049568 Ga0501031_0001574 Ga0501031_0001574_3185_3487 100
233 3300049568 Ga0501031_0254016 Ga0501031_0254016_517_828 100
234 3300049569 Ga0501032_0019016 Ga0501032_0019016_478_780 100
235 3300049569 Ga0501032_0067799 Ga0501032_0067799_35_346 100
236 3300049570 Ga0501033_0000602 Ga0501033_0000602_703_1005 100
237 3300049570 Ga0501033_0060817 Ga0501033_0060817_189_500 100
238 3300049570 Ga0501033_1204621 Ga0501033_1204621_172_480 100
239 3300049571 Ga0501034_0232020 Ga0501034_0232020_933_1241 100
240 3300049571 Ga0501034_0247319 Ga0501034_0247319_1285_1587 100
241 3300049571 Ga0501034_0261257 Ga0501034_0261257_211_513 100
242 3300049571 Ga0501034_0696737 Ga0501034_0696737_485_796 100
243 3300049571 Ga0501034_0896512 Ga0501034_0896512_422_730 100
244 3300049572 Ga0501036_0027497 Ga0501036_0027497_3146_3448 100
245 3300049572 Ga0501036_0040271 Ga0501036_0040271_239_550 100
246 3300049572 Ga0501036_0366626 Ga0501036_0366626_39_347 100
247 3300049573 Ga0501037_0005229 Ga0501037_0005229_8705_9007 100
248 3300049573 Ga0501037_0124417 Ga0501037_0124417_639_950 100
249 3300049574 Ga0501038_0043577 Ga0501038_0043577_478_780 100
250 3300049574 Ga0501038_0085575 Ga0501038_0085575_2200_2508 100
251 3300049574 Ga0501038_0115829 Ga0501038_0115829_643_954 100
252 3300049575 Ga0501039_0005003 Ga0501039_0005003_2698_3000 100
253 3300049575 Ga0501039_0377372 Ga0501039_0377372_118_429 100
254 3300049577 Ga0501041_0139074 Ga0501041_0139074_499_801 100
255 3300049578 Ga0501042_0310108 Ga0501042_0310108_289_597 100
256 3300049579 Ga0501043_0017795 Ga0501043_0017795_1592_1903 100
257 3300049579 Ga0501043_0317865 Ga0501043_0317865_474_782 100
258 3300049580 Ga0501046_0040410 Ga0501046_0040410_1901_2203 100
259 3300049581 Ga0501047_0108494 Ga0501047_0108494_1378_1689 100
260 3300049581 Ga0501047_0141174 Ga0501047_0141174_110_418 100
261 3300049584 Ga0501068_0069068 Ga0501068_0069068_841_1143 100
262 3300049586 Ga0501070_0083845 Ga0501070_0083845_1279_1587 100
263 3300049586 Ga0501070_0737121 Ga0501070_0737121_94_405 100
264 3300049588 Ga0501072_0198037 Ga0501072_0198037_332_640 100
265 3300049589 Ga0501073_0030149 Ga0501073_0030149_485_796 100
266 3300049589 Ga0501073_0479470 Ga0501073_0479470_234_536 100
267 3300049591 Ga0501075_0018700 Ga0501075_0018700_4601_4915 100
268 3300049592 Ga0501076_0009730 Ga0501076_0009730_4919_5233 100
269 3300049592 Ga0501076_0404192 Ga0501076_0404192_796_1104 100
270 3300049593 Ga0501077_0012800 Ga0501077_0012800_4190_4504 100
271 3300049741 Ga0501079_0037376 Ga0501079_0037376_2447_2761 100
272 3300049742 Ga0501080_0028790 Ga0501080_0028790_4086_4397 100
273 3300049743 Ga0501081_0005912 Ga0501081_0005912_3637_3951 100
274 3300049744 Ga0501083_0061150 Ga0501083_0061150_1795_2109 100
275 3300049744 Ga0501083_0350900 Ga0501083_0350900_238_540 100
276 3300049822 Ga0501035_0019042 Ga0501035_0019042_2450_2752 100
277 3300049822 Ga0501035_0422535 Ga0501035_0422535_341_649 100
278 3300049823 Ga0501044_0023837 Ga0501044_0023837_5857_6168 100
279 3300049823 Ga0501044_0031893 Ga0501044_0031893_4497_4799 100
280 3300049823 Ga0501044_0371904 Ga0501044_0371904_929_1237 100
281 3300049824 Ga0501045_0284916 Ga0501045_0284916_61_363 100
282 3300050489 nmdc:mga03683_2394_c1 nmdc:mga03683_2394_c1_3016_3318 100
283 3300050490 nmdc:mga03n38_121298_c1 nmdc:mga03n38_121298_c1_785_1087 100
284 3300050490 nmdc:mga03n38_890310_c1 nmdc:mga03n38_890310_c1_21_323 100
285 3300050491 nmdc:mga00v17_2278_c1 nmdc:mga00v17_2278_c1_55_357 100
286 3300050492 nmdc:mga0yw44_19859_c1 nmdc:mga0yw44_19859_c1_1380_1682 100
287 3300050494 nmdc:mga06z11_290229_c1 nmdc:mga06z11_290229_c1_208_510 100
288 3300050495 nmdc:mga04h51_53383_c1 nmdc:mga04h51_53383_c1_387_689 100
289 3300050511 nmdc:mga08y16_736204_c1 nmdc:mga08y16_736204_c1_358_663 100
290 3300050512 nmdc:mga0n895_55443_c1 nmdc:mga0n895_55443_c1_2217_2519 100
291 3300050513 nmdc:mga0rr50_108076_c2 nmdc:mga0rr50_108076_c2_1223_1525 100
292 3300053077 Ga0495601_0024377 Ga0495601_0024377_1413_1715 100
293 3300053077 Ga0495601_1067521 Ga0495601_1067521_31_351 100
294 3300053078 Ga0495612_0029849 Ga0495612_0029849_188_490 100
295 3300053093 Ga0500651_0013998 Ga0500651_0013998_2798_3109 100
296 3300053098 Ga0500650_0512941 Ga0500650_0512941_143_457 100
297 3300053125 Ga0500618_097495 Ga0500618_097495_288_590 100
298 3300053136 Ga0500559_0018680 Ga0500559_0018680_927_1229 100
299 3300053142 Ga0500577_0000206 Ga0500577_0000206_14672_14974 100
300 3300053730 Ga0500645_108376 Ga0500645_108376_456_758 100
301 3300054114 Ga0501084_0034571 Ga0501084_0034571_2147_2461 100
302 3300059490 Ga0587066_229911 Ga0587066_229911_144_446 100
303 3300060353 Ga0501082_0001505 Ga0501082_0001505_10828_11142 100
304 3300060353 Ga0501082_0475402 Ga0501082_0475402_82_393 100
305 3300060353 Ga0501082_0830947 Ga0501082_0830947_257_559 100
306 3300001989 JGI24739J22299_10030061 JGI24739J22299_100300612 101
307 3300001990 JGI24737J22298_10059233 JGI24737J22298_100592332 101
308 3300002075 JGI24738J21930_10058259 JGI24738J21930_100582591 101
309 3300003215 JGI25153J46596_10018903 JGI25153J46596_100189031 101
310 3300005548 Ga0070665_100040655 Ga0070665_1000406555 101
311 3300005937 Ga0081455_10020355 Ga0081455_100203551 101
312 3300005983 Ga0081540_1005098 Ga0081540_10050989 101
313 3300009545 Ga0105237_10994791 Ga0105237_109947911 101
314 3300009551 Ga0105238_11670321 Ga0105238_116703212 101
315 3300025297 Ga0209758_1000474 Ga0209758_100047458 101
316 3300025914 Ga0207671_10803299 Ga0207671_108032991 101
317 3300025924 Ga0207694_10239977 Ga0207694_102399771 101
318 3300028379 Ga0268266_10061170 Ga0268266_100611704 101
319 3300028786 Ga0307517_10646076 Ga0307517_106460761 101
320 3300033180 Ga0307510_10021634 Ga0307510_100216345 101
321 3300037471 Ga0395905_1242880 Ga0395905_1242880_21_326 101
322 3300037471 Ga0395905_1805624 Ga0395905_1805624_84_389 101
323 3300039437 Ga0436365_0441521 Ga0436365_0441521_616_921 101
324 3300041512 Ga0451853_3528503 Ga0451853_3528503_216_539 101
325 3300044694 Ga0466963_0050794 Ga0466963_0050794_662_967 101
326 3300044842 Ga0466957_0506521 Ga0466957_0506521_257_562 101
327 3300044901 Ga0466960_0181620 Ga0466960_0181620_627_974 101
328 3300045049 Ga0466959_1196764 Ga0466959_1196764_105_452 101
329 3300045976 Ga0466967_0577031 Ga0466967_0577031_352_657 101
330 3300050492 nmdc:mga0yw44_423014_c1 nmdc:mga0yw44_423014_c1_87_392 101
331 3300053087 Ga0500643_000016 Ga0500643_000016_79831_80136 101
332 3300061719 Ga0466962_0508011 Ga0466962_0508011_194_499 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06844

DUF1244

Protein of unknown function (DUF1244)

53

119

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tjg-assembly1.cif.gz_D thermus aquaticus delta1.1-sigmaa holoenzyme/downstream-fork promoter complex with an open clamp 0.7111 42 69
3v1z-assembly1.cif.gz_A crystal structure of type iif restriction endonuclease bse634i with cognate dna 0.6711 42 77
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.619 9 74
7arp-assembly1.cif.gz_B native l-2-haloacid dehalogenase from zobellia galactanivorans 0.6068 11 71
7qnm-assembly4.cif.gz_G crystallization and structural analyses of zghad, a l-2-haloacid dehalogenase from the marine flavobacterium zobellia galactanivorans 0.6021 11 71
ID Description Score Start End Superfamily
6mdeA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.6979 39 70 3.30.230.10
af_Q65XR9_493_717_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.6852 43 64 3.30.870.10
3um9B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.6772 9 71 1.10.150.240
3um9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.6741 11 71 1.10.150.240
3v1zA00 Alpha Beta;3-Layer(aba) Sandwich;Restriction Endonuclease; 0.6711 42 77 3.40.91.10
ID Description Score Start End GO Terms
AF-A0A3B9ILQ6-F1-model_v4 DUF1244 domain-containing protein 0.895 39 97
AF-A0A1Y0BN75-F1-model_v4 J417 0.8129 35 83
AF-A0A3B9ILQ6-F1-model_v4 DUF1244 domain-containing protein 0.8072 39 97
AF-A0A1Y0BN75-F1-model_v4 J417 0.7979 35 83
AF-A0A1Z8MSS2-F1-model_v4 SMc04008-like domain-containing protein 0.7924 35 85

Feature Viewer

pLDDT pTM Quality
82.54 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map