F410655

General Info

Members Datasets Scaffolds Average Seq Length
331 218 331 84

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0010672|Ga0495636_0010672_1032_1310
Length 92
Sequence MEKESIMLWTLIVGLIVGAIAKLLMPGRDPGGFIITMIIGVAGAFLAHFLGANLGWYQEGEPAGFVASVLGAVILLAIYRAVIGRKTLTPRT

Samples

Sample ID Description Type Environment
1 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
146 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.47
Metatranscriptomes 4.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.14
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006777J48905_1001803 3300003308 Bacteria 525
2 Ga0065714_10077692 3300005288 Bacteria 2667
3 Ga0065704_10758486 3300005289 Bacteria 539
4 Ga0065712_10069283 3300005290 Bacteria 7602
5 Ga0065715_10093657 3300005293 Bacteria 4606
6 Ga0070658_10296526 3300005327 Bacteria 1378
7 Ga0070676_10005862 3300005328 Bacteria 6558
8 Ga0070676_10169051 3300005328 Unclassified 1412
9 Ga0070676_10809993 3300005328 Unclassified 692
10 Ga0070683_100172433 3300005329 Bacteria 2053
11 Ga0070690_101165697 3300005330 Unclassified 613
12 Ga0070670_100040359 3300005331 Bacteria 4013
13 Ga0068869_100102656 3300005334 Bacteria 2165
14 Ga0068869_101314182 3300005334 Bacteria 638
15 Ga0070666_10278082 3300005335 Bacteria 1189
16 Ga0070680_101075661 3300005336 Bacteria 695
17 Ga0070682_100110915 3300005337 Bacteria 1828
18 Ga0068868_100316622 3300005338 Unclassified 1328
19 Ga0068868_100799908 3300005338 Bacteria 851
20 Ga0070689_100000006 3300005340 Bacteria 332562
21 Ga0070689_100303986 3300005340 Unclassified 1328
22 Ga0070689_100848845 3300005340 Bacteria 805
23 Ga0070687_100131331 3300005343 Unclassified 1446
24 Ga0070668_100205568 3300005347 Bacteria 1618
25 Ga0070669_100002078 3300005353 Bacteria 14468
26 Ga0070669_100131372 3300005353 Bacteria 1921
27 Ga0070669_100203803 3300005353 Unclassified 1558
28 Ga0070671_100060144 3300005355 Bacteria 3163
29 Ga0070671_100158696 3300005355 Bacteria 1911
30 Ga0070674_100032403 3300005356 Bacteria 3470
31 Ga0070674_101703624 3300005356 Bacteria 570
32 Ga0070673_100274505 3300005364 Bacteria 1477
33 Ga0070659_101291426 3300005366 Bacteria 647
34 Ga0070667_100002714 3300005367 Bacteria 15320
35 Ga0070667_102119603 3300005367 Bacteria 530
36 Ga0070667_102285276 3300005367 Unclassified 509
37 Ga0070713_102251317 3300005436 Unclassified 528
38 Ga0070701_10073632 3300005438 Unclassified 1832
39 Ga0070711_100765594 3300005439 Unclassified 817
40 Ga0070705_100561175 3300005440 Bacteria 877
41 Ga0070700_100914983 3300005441 Bacteria 715
42 Ga0070694_101598148 3300005444 Bacteria 553
43 Ga0070694_101930390 3300005444 Bacteria 504
44 Ga0070708_100002458 3300005445 Bacteria 14346
45 Ga0070663_100958700 3300005455 Bacteria 742
46 Ga0070663_101105664 3300005455 Bacteria 693
47 Ga0070662_101127453 3300005457 Bacteria 673
48 Ga0068867_100097089 3300005459 Bacteria 2244
49 Ga0068867_100915394 3300005459 Unclassified 790
50 Ga0068867_101653480 3300005459 Bacteria 599
51 Ga0070685_10768027 3300005466 Bacteria 708
52 Ga0070685_10863242 3300005466 Bacteria 671
53 Ga0070706_100006956 3300005467 Bacteria 10670
54 Ga0070707_100684316 3300005468 Bacteria 988
55 Ga0070698_100466157 3300005471 Bacteria 1199
56 Ga0070699_100081598 3300005518 Bacteria 2819
57 Ga0070699_101675496 3300005518 Bacteria 582
58 Ga0070679_100177153 3300005530 Bacteria 2105
59 Ga0070679_100394691 3300005530 Unclassified 1330
60 Ga0070684_101880705 3300005535 Bacteria 565
61 Ga0070684_102088451 3300005535 Unclassified 535
62 Ga0070697_100001388 3300005536 Bacteria 18330
63 Ga0070697_100243435 3300005536 Unclassified 1536
64 Ga0068853_100000583 3300005539 Bacteria 24976
65 Ga0068853_101625065 3300005539 Bacteria 626
66 Ga0070672_100037446 3300005543 Bacteria 3701
67 Ga0070686_100060608 3300005544 Bacteria 2442
68 Ga0070686_100514071 3300005544 Bacteria 931
69 Ga0070686_100846932 3300005544 Bacteria 740
70 Ga0070695_100169774 3300005545 Bacteria 1538
71 Ga0070696_100921404 3300005546 Unclassified 726
72 Ga0070693_100289898 3300005547 Bacteria 1099
73 Ga0070693_100568606 3300005547 Unclassified 814
74 Ga0070665_100164453 3300005548 Unclassified 2221
75 Ga0068855_100068659 3300005563 Bacteria 4126
76 Ga0068855_100249759 3300005563 Bacteria 1979
77 Ga0068855_102074692 3300005563 Bacteria 573
78 Ga0070664_100384661 3300005564 Bacteria 1281
79 Ga0068857_100246994 3300005577 Unclassified 1635
80 Ga0068857_100603572 3300005577 Bacteria 1038
81 Ga0068854_100193005 3300005578 Bacteria 1597
82 Ga0068854_101542468 3300005578 Bacteria 604
83 Ga0068856_100289126 3300005614 Unclassified 1656
84 Ga0068856_100427991 3300005614 Bacteria 1344
85 Ga0068856_100436347 3300005614 Bacteria 1330
86 Ga0068852_101663089 3300005616 Bacteria 661
87 Ga0068859_101353075 3300005617 Bacteria 785
88 Ga0068861_100298033 3300005719 Bacteria 1395
89 Ga0068858_100557804 3300005842 Bacteria 1109
90 Ga0068858_101506294 3300005842 Unclassified 663
91 Ga0068860_100289940 3300005843 Unclassified 1601
92 Ga0068860_100741741 3300005843 Bacteria 993
93 Ga0068860_101091085 3300005843 Unclassified 817
94 Ga0068862_100159308 3300005844 Bacteria 2014
95 Ga0068862_100195313 3300005844 Unclassified 1823
96 Ga0081455_10047462 3300005937 Unclassified 3719
97 Ga0081455_10322806 3300005937 Unclassified 1099
98 Ga0070715_10185167 3300006163 Unclassified 1047
99 Ga0097621_100084481 3300006237 Bacteria 2646
100 Ga0097621_100204038 3300006237 Bacteria 1717
101 Ga0097621_101299519 3300006237 Bacteria 687
102 Ga0097621_101494669 3300006237 Bacteria 641
103 Ga0068871_100092133 3300006358 Bacteria 2527
104 Ga0068871_100248541 3300006358 Unclassified 1548
105 Ga0068871_100900464 3300006358 Bacteria 820
106 Ga0075428_100876574 3300006844 Bacteria 952
107 Ga0075431_100161109 3300006847 Bacteria 2307
108 Ga0075431_100304118 3300006847 Bacteria 1611
109 Ga0075431_102074719 3300006847 Unclassified 523
110 Ga0075433_10892269 3300006852 Bacteria 776
111 Ga0075433_11710573 3300006852 Unclassified 542
112 Ga0075434_100177645 3300006871 Bacteria 2149
113 Ga0075434_100839012 3300006871 Unclassified 935
114 Ga0075429_100042928 3300006880 Bacteria 3934
115 Ga0075429_100155892 3300006880 Bacteria 2000
116 Ga0075429_100661833 3300006880 Bacteria 915
117 Ga0068865_100020426 3300006881 Bacteria 4294
118 Ga0075436_100264112 3300006914 Bacteria 1228
119 Ga0097620_101353235 3300006931 Bacteria 785
120 Ga0075435_100331146 3300007076 Unclassified 1304
121 Ga0075435_100410751 3300007076 Bacteria 1165
122 Ga0099795_10368923 3300007788 Unclassified 646
123 Ga0111539_10004278 3300009094 Bacteria 18687
124 Ga0105245_10000009 3300009098 Bacteria 279713
125 Ga0105245_10647505 3300009098 Bacteria 1087
126 Ga0114129_10155598 3300009147 Bacteria 3126
127 Ga0114129_10265652 3300009147 Bacteria 2298
128 Ga0114129_11892226 3300009147 Bacteria 724
129 Ga0114129_13479515 3300009147 Bacteria 504
130 Ga0105241_10013482 3300009174 Bacteria 5990
131 Ga0105248_10753468 3300009177 Unclassified 1099
132 Ga0105248_11174203 3300009177 Bacteria 868
133 Ga0105238_10041368 3300009551 Unclassified 4667
134 Ga0105238_10280448 3300009551 Bacteria 1648
135 Ga0105249_10108764 3300009553 Bacteria 2617
136 Ga0105246_12538776 3300011119 Bacteria 505
137 Ga0157370_11507265 3300013104 Unclassified 605
138 Ga0157369_10217203 3300013105 Bacteria 2002
139 Ga0157374_10181453 3300013296 Bacteria 2056
140 Ga0157374_10455575 3300013296 Bacteria 1281
141 Ga0157374_10472071 3300013296 Bacteria 1257
142 Ga0157374_10813668 3300013296 Unclassified 950
143 Ga0157378_10031092 3300013297 Unclassified 4715
144 Ga0157378_10056526 3300013297 Bacteria 3497
145 Ga0157378_10109545 3300013297 Bacteria 2530
146 Ga0157378_10221318 3300013297 Bacteria 1799
147 Ga0157378_10545658 3300013297 Bacteria 1164
148 Ga0157378_11322723 3300013297 Bacteria 762
149 Ga0157378_11382630 3300013297 Unclassified 747
150 Ga0157378_11448661 3300013297 Bacteria 730
151 Ga0163162_10090774 3300013306 Bacteria 3137
152 Ga0157375_10535063 3300013308 Bacteria 1334
153 Ga0157375_13353271 3300013308 Bacteria 534
154 Ga0163163_12011511 3300014325 Bacteria 638
155 Ga0157380_10085818 3300014326 Bacteria 2585
156 Ga0157380_12826236 3300014326 Unclassified 552
157 Ga0182008_10948808 3300014497 Unclassified 509
158 Ga0157377_11531641 3300014745 Unclassified 531
159 Ga0157376_10121837 3300014969 Bacteria 2313
160 Ga0157376_10152133 3300014969 Bacteria 2088
161 Ga0157376_10462210 3300014969 Bacteria 1240
162 Ga0206349_1197564 3300020075 Bacteria 1117
163 Ga0206350_11220247 3300020080 Bacteria 722
164 Ga0206353_11909214 3300020082 Bacteria 692
165 Ga0154015_1134243 3300020610 Unclassified 876
166 Ga0213874_10235329 3300021377 Unclassified 670
167 Ga0213876_10028571 3300021384 Bacteria 2940
168 Ga0224712_10058075 3300022467 Bacteria 1531
169 Ga0207697_10000135 3300025315 Bacteria 35637
170 Ga0207682_10110736 3300025893 Bacteria 1208
171 Ga0207688_10001418 3300025901 Bacteria 12498
172 Ga0207680_10082830 3300025903 Unclassified 2020
173 Ga0207645_10012342 3300025907 Bacteria 5798
174 Ga0207645_10181240 3300025907 Bacteria 1382
175 Ga0207684_10064538 3300025910 Bacteria 3109
176 Ga0207654_10059192 3300025911 Bacteria 2233
177 Ga0207662_11199995 3300025918 Bacteria 539
178 Ga0207681_10017829 3300025923 Bacteria 4464
179 Ga0207694_10051477 3300025924 Bacteria 3192
180 Ga0207659_11113734 3300025926 Bacteria 679
181 Ga0207687_10000124 3300025927 Bacteria 51583
182 Ga0207644_10087862 3300025931 Bacteria 2311
183 Ga0207644_10753662 3300025931 Bacteria 813
184 Ga0207670_10000003 3300025936 Bacteria 760449
185 Ga0207670_10008381 3300025936 Bacteria 5832
186 Ga0207670_10021212 3300025936 Bacteria 4004
187 Ga0207670_10304556 3300025936 Unclassified 1249
188 Ga0207669_10048815 3300025937 Bacteria 2517
189 Ga0207704_10005892 3300025938 Bacteria 5675
190 Ga0207691_10206095 3300025940 Bacteria 1710
191 Ga0207711_11265343 3300025941 Bacteria 680
192 Ga0207689_10084914 3300025942 Bacteria 2602
193 Ga0207679_10357821 3300025945 Bacteria 1274
194 Ga0207667_10369164 3300025949 Unclassified 1463
195 Ga0207667_10660213 3300025949 Bacteria 1051
196 Ga0207667_10961882 3300025949 Unclassified 843
197 Ga0207712_10471790 3300025961 Bacteria 1068
198 Ga0207668_10135337 3300025972 Bacteria 1887
199 Ga0207668_10328522 3300025972 Bacteria 1271
200 Ga0207640_10187380 3300025981 Bacteria 1557
201 Ga0207640_10623323 3300025981 Bacteria 916
202 Ga0207658_10164815 3300025986 Bacteria 1820
203 Ga0207658_11547276 3300025986 Bacteria 606
204 Ga0207658_12130614 3300025986 Unclassified 509
205 Ga0207677_10431041 3300026023 Bacteria 1125
206 Ga0207677_12099173 3300026023 Unclassified 525
207 Ga0207677_12219653 3300026023 Unclassified 511
208 Ga0207703_12247105 3300026035 Bacteria 521
209 Ga0207639_10004111 3300026041 Bacteria 9810
210 Ga0207678_10814489 3300026067 Bacteria 825
211 Ga0207678_10916409 3300026067 Bacteria 775
212 Ga0207708_10297321 3300026075 Bacteria 1312
213 Ga0207702_10437229 3300026078 Bacteria 1267
214 Ga0207702_11941724 3300026078 Unclassified 579
215 Ga0207648_10042765 3300026089 Bacteria 3978
216 Ga0207648_10236500 3300026089 Unclassified 1626
217 Ga0207674_10365481 3300026116 Bacteria 1395
218 Ga0207674_11391627 3300026116 Bacteria 671
219 Ga0207675_100359926 3300026118 Bacteria 1427
220 Ga0207675_100708164 3300026118 Bacteria 1016
221 Ga0207683_10020180 3300026121 Bacteria 5696
222 Ga0207683_10655185 3300026121 Bacteria 973
223 Ga0207698_11515567 3300026142 Bacteria 686
224 Ga0209969_1045998 3300027360 Bacteria 681
225 Ga0209995_1007287 3300027471 Bacteria 1784
226 Ga0209968_1052031 3300027526 Bacteria 713
227 Ga0209966_1095007 3300027695 Bacteria 670
228 Ga0207428_10187555 3300027907 Bacteria 1560
229 Ga0268266_10078913 3300028379 Bacteria 2865
230 Ga0268265_10310655 3300028380 Bacteria 1423
231 Ga0268265_10545267 3300028380 Unclassified 1100
232 Ga0268264_10264574 3300028381 Unclassified 1604
233 Ga0268264_11084804 3300028381 Bacteria 809
234 Ga0265337_1016716 3300028556 Unclassified 2366
235 Ga0265326_10037451 3300028558 Bacteria 1379
236 Ga0265324_10000073 3300029957 Bacteria 79760
237 Ga0265339_10000082 3300031249 Bacteria 81791
238 Ga0307513_10006430 3300031456 Bacteria 15353
239 Ga0307408_100063631 3300031548 Bacteria 2699
240 Ga0265314_10089629 3300031711 Bacteria 2006
241 Ga0265342_10047659 3300031712 Bacteria 2571
242 Ga0307410_10381805 3300031852 Bacteria 1134
243 Ga0307406_10675212 3300031901 Bacteria 860
244 Ga0307416_100961609 3300032002 Bacteria 956
245 Ga0307415_101705672 3300032126 Bacteria 608
246 Ga0373947_0714546 3300035725 Unclassified 684
247 Ga0373937_0350506 3300036401 Bacteria 1398
248 Ga0373925_0144494 3300037068 Bacteria 1864
249 Ga0373925_1058805 3300037068 Bacteria 668
250 Ga0395899_0051790 3300037312 Bacteria 3046
251 Ga0395900_0050153 3300037418 Bacteria 4299
252 Ga0395900_0124478 3300037418 Bacteria 2644
253 Ga0395898_0224219 3300037466 Bacteria 1793
254 Ga0395901_0119741 3300038443 Bacteria 2766
255 Ga0395901_0337733 3300038443 Bacteria 1556
256 Ga0242420_125354 3300038996 Unclassified 563
257 Ga0436365_0923216 3300039437 Unclassified 892
258 Ga0436365_1880327 3300039437 Bacteria 1901
259 Ga0436363_1579282 3300039450 Bacteria 3400
260 Ga0436362_1172326 3300039453 Bacteria 3655
261 Ga0451807_0562759 3300041486 Bacteria 739
262 Ga0451855_1148549 3300041511 Bacteria 504
263 Ga0439431_0160732 3300041997 Bacteria 642
264 Ga0451577_1925577 3300042876 Bacteria 517
265 Ga0453684_0508394 3300044712 Bacteria 1333
266 Ga0451576_1169890 3300045051 Bacteria 804
267 Ga0466958_0597553 3300045836 Bacteria 718
268 Ga0466967_0718988 3300045976 Bacteria 990
269 Ga0495647_0056800 3300046681 Bacteria 1535
270 Ga0495658_0003525 3300046683 Bacteria 7743
271 Ga0495636_0010672 3300047318 Unclassified 3631
272 Ga0495684_0980863 3300047471 Unclassified 538
273 Ga0496100_0264615 3300048903 Bacteria 1276
274 Ga0496100_0949624 3300048903 Unclassified 676
275 Ga0496100_1382688 3300048903 Unclassified 556
276 Ga0496100_1511310 3300048903 Unclassified 530
277 Ga0496101_0196390 3300048904 Bacteria 1559
278 Ga0496102_0314383 3300048905 Archaea 1476
279 Ga0496107_1093813 3300048910 Unclassified 576
280 Ga0496108_0210793 3300048911 Unclassified 1687
281 Ga0496108_1334407 3300048911 Bacteria 602
282 Ga0496109_0294567 3300048912 Bacteria 1530
283 Ga0496110_1726877 3300048913 Unclassified 536
284 Ga0496112_0216283 3300048915 Bacteria 1873
285 Ga0496112_1162239 3300048915 Unclassified 689
286 Ga0496114_0056113 3300048917 Bacteria 3286
287 Ga0496114_1710053 3300048917 Bacteria 517
288 Ga0496115_0136911 3300048918 Bacteria 2019
289 Ga0501038_1343022 3300049574 Unclassified 515
290 Ga0501040_0108157 3300049576 Bacteria 1944
291 Ga0501042_0271265 3300049578 Bacteria 1225
292 Ga0501048_1339190 3300049582 Bacteria 515
293 Ga0501067_0209727 3300049583 Bacteria 1085
294 Ga0501073_0249318 3300049589 Bacteria 1226
295 Ga0501076_0668834 3300049592 Bacteria 857
296 Ga0501261_105475 3300049690 Bacteria 541
297 Ga0501079_0499947 3300049741 Unclassified 956
298 Ga0501083_0550973 3300049744 Unclassified 750
299 Ga0501044_0004074 3300049823 Bacteria 16388
300 Ga0501044_0021891 3300049823 Bacteria 6817
301 Ga0501045_0480576 3300049824 Bacteria 923
302 Ga0501045_1401293 3300049824 Unclassified 508
303 nmdc:mga05p37_110879_c1 3300050507 Bacteria 3375
304 nmdc:mga05p37_340625_c1 3300050507 Unclassified 1768
305 nmdc:mga09592_1376055_c1 3300050508 Unclassified 578
306 nmdc:mga09592_50225_c1 3300050508 Bacteria 3518
307 nmdc:mga09592_641624_c1 3300050508 Bacteria 907
308 nmdc:mga09592_95019_c1 3300050508 Bacteria 2549
309 nmdc:mga09592_987074_c1 3300050508 Bacteria 704
310 nmdc:mga06r32_119902_c1 3300050510 Bacteria 2594
311 nmdc:mga06r32_1632228_c1 3300050510 Unclassified 583
312 nmdc:mga06r32_837203_c1 3300050510 Unclassified 879
313 nmdc:mga08y16_106274_c1 3300050511 Bacteria 2922
314 nmdc:mga0n895_1648027_c1 3300050512 Unclassified 605
315 nmdc:mga0n895_431859_c1 3300050512 Bacteria 1331
316 nmdc:mga0rr50_105747_c2 3300050513 Bacteria 1640
317 nmdc:mga0rr50_187286_c1 3300050513 Unclassified 1694
318 nmdc:mga08x19_279766_c1 3300050514 Bacteria 1156
319 nmdc:mga0a205_496764_c1 3300050515 Bacteria 1077
320 Ga0500568_0042457 3300053139 Bacteria 1822
321 Ga0501084_0244365 3300054114 Bacteria 1515
322 Ga0501084_1160867 3300054114 Bacteria 648
323 Ga0587073_0041284 3300059492 Unclassified 1007
324 Ga0587073_0143869 3300059492 Unclassified 668
325 Ga0587085_081191 3300059506 Unclassified 653
326 Ga0587085_091276 3300059506 Unclassified 629
327 Ga0587091_069983 3300059511 Unclassified 765
328 Ga0587094_075640 3300059513 Unclassified 614
329 Ga0587128_022763 3300059630 Bacteria 977
330 Ga0587075_041426 3300059644 Unclassified 773
331 Ga0587111_0117378 3300060346 Unclassified 681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0249318 Ga0501073_0249318_732_1004 69
2 3300049744 Ga0501083_0550973 Ga0501083_0550973_227_499 69
3 3300005544 Ga0070686_100846932 Ga0070686_1008469322 72
4 3300020082 Ga0206353_11909214 Ga0206353_119092142 74
5 3300020610 Ga0154015_1134243 Ga0154015_11342431 74
6 3300005356 Ga0070674_101703624 Ga0070674_1017036241 76
7 3300005436 Ga0070713_102251317 Ga0070713_1022513171 76
8 3300006358 Ga0068871_100900464 Ga0068871_1009004641 76
9 3300005466 Ga0070685_10768027 Ga0070685_107680271 77
10 3300031456 Ga0307513_10006430 Ga0307513_1000643013 77
11 3300059630 Ga0587128_022763 Ga0587128_022763_46_315 77
12 3300005327 Ga0070658_10296526 Ga0070658_102965262 78
13 3300005336 Ga0070680_101075661 Ga0070680_1010756612 78
14 3300005530 Ga0070679_100177153 Ga0070679_1001771533 78
15 3300005535 Ga0070684_101880705 Ga0070684_1018807051 78
16 3300005577 Ga0068857_100603572 Ga0068857_1006035722 78
17 3300020075 Ga0206349_1197564 Ga0206349_11975642 78
18 3300020080 Ga0206350_11220247 Ga0206350_112202472 78
19 3300022467 Ga0224712_10058075 Ga0224712_100580752 78
20 3300026116 Ga0207674_11391627 Ga0207674_113916272 78
21 3300037418 Ga0395900_0050153 Ga0395900_0050153_3395_3655 78
22 3300037466 Ga0395898_0224219 Ga0395898_0224219_310_570 78
23 3300038443 Ga0395901_0337733 Ga0395901_0337733_895_1155 78
24 3300005347 Ga0070668_100205568 Ga0070668_1002055682 80
25 3300005355 Ga0070671_100060144 Ga0070671_1000601442 80
26 3300005367 Ga0070667_102285276 Ga0070667_1022852762 80
27 3300005530 Ga0070679_100394691 Ga0070679_1003946913 80
28 3300005563 Ga0068855_102074692 Ga0068855_1020746922 80
29 3300005937 Ga0081455_10322806 Ga0081455_103228063 80
30 3300013297 Ga0157378_10056526 Ga0157378_100565263 80
31 3300025931 Ga0207644_10087862 Ga0207644_100878622 80
32 3300025972 Ga0207668_10328522 Ga0207668_103285222 80
33 3300025986 Ga0207658_12130614 Ga0207658_121306141 80
34 3300039437 Ga0436365_0923216 Ga0436365_0923216_45_299 80
35 3300050508 nmdc:mga09592_50225_c1 nmdc:mga09592_50225_c1_2812_3057 80
36 3300005330 Ga0070690_101165697 Ga0070690_1011656972 81
37 3300005444 Ga0070694_101598148 Ga0070694_1015981482 81
38 3300006847 Ga0075431_100161109 Ga0075431_1001611092 81
39 3300009147 Ga0114129_10265652 Ga0114129_102656521 81
40 3300009147 Ga0114129_11892226 Ga0114129_118922262 81
41 3300013308 Ga0157375_13353271 Ga0157375_133532712 81
42 3300026121 Ga0207683_10655185 Ga0207683_106551852 81
43 3300036401 Ga0373937_0350506 Ga0373937_0350506_44_307 81
44 3300050507 nmdc:mga05p37_110879_c1 nmdc:mga05p37_110879_c1_1610_1858 81
45 3300050508 nmdc:mga09592_641624_c1 nmdc:mga09592_641624_c1_196_444 81
46 3300050510 nmdc:mga06r32_837203_c1 nmdc:mga06r32_837203_c1_390_638 81
47 3300050512 nmdc:mga0n895_431859_c1 nmdc:mga0n895_431859_c1_697_945 81
48 3300050513 nmdc:mga0rr50_187286_c1 nmdc:mga0rr50_187286_c1_931_1179 81
49 3300050514 nmdc:mga08x19_279766_c1 nmdc:mga08x19_279766_c1_570_818 81
50 3300050515 nmdc:mga0a205_496764_c1 nmdc:mga0a205_496764_c1_458_706 81
51 3300005328 Ga0070676_10005862 Ga0070676_100058626 82
52 3300005329 Ga0070683_100172433 Ga0070683_1001724333 82
53 3300005331 Ga0070670_100040359 Ga0070670_1000403593 82
54 3300005335 Ga0070666_10278082 Ga0070666_102780822 82
55 3300005338 Ga0068868_100316622 Ga0068868_1003166222 82
56 3300005340 Ga0070689_100848845 Ga0070689_1008488451 82
57 3300005353 Ga0070669_100131372 Ga0070669_1001313722 82
58 3300005355 Ga0070671_100158696 Ga0070671_1001586962 82
59 3300005356 Ga0070674_100032403 Ga0070674_1000324033 82
60 3300005364 Ga0070673_100274505 Ga0070673_1002745053 82
61 3300005367 Ga0070667_100002714 Ga0070667_1000027144 82
62 3300005457 Ga0070662_101127453 Ga0070662_1011274532 82
63 3300005459 Ga0068867_100097089 Ga0068867_1000970893 82
64 3300005466 Ga0070685_10863242 Ga0070685_108632422 82
65 3300005539 Ga0068853_101625065 Ga0068853_1016250652 82
66 3300005543 Ga0070672_100037446 Ga0070672_1000374463 82
67 3300005548 Ga0070665_100164453 Ga0070665_1001644532 82
68 3300005564 Ga0070664_100384661 Ga0070664_1003846612 82
69 3300005844 Ga0068862_100159308 Ga0068862_1001593083 82
70 3300006237 Ga0097621_100084481 Ga0097621_1000844812 82
71 3300006358 Ga0068871_100248541 Ga0068871_1002485413 82
72 3300006881 Ga0068865_100020426 Ga0068865_1000204263 82
73 3300011119 Ga0105246_12538776 Ga0105246_125387762 82
74 3300013296 Ga0157374_10181453 Ga0157374_101814533 82
75 3300013297 Ga0157378_10221318 Ga0157378_102213181 82
76 3300013306 Ga0163162_10090774 Ga0163162_100907743 82
77 3300013308 Ga0157375_10535063 Ga0157375_105350632 82
78 3300014969 Ga0157376_10121837 Ga0157376_101218373 82
79 3300025315 Ga0207697_10000135 Ga0207697_100001357 82
80 3300025893 Ga0207682_10110736 Ga0207682_101107363 82
81 3300025901 Ga0207688_10001418 Ga0207688_1000141811 82
82 3300025903 Ga0207680_10082830 Ga0207680_100828302 82
83 3300025907 Ga0207645_10012342 Ga0207645_100123422 82
84 3300025923 Ga0207681_10017829 Ga0207681_100178294 82
85 3300025926 Ga0207659_11113734 Ga0207659_111137341 82
86 3300025931 Ga0207644_10753662 Ga0207644_107536622 82
87 3300025936 Ga0207670_10008381 Ga0207670_100083816 82
88 3300025937 Ga0207669_10048815 Ga0207669_100488153 82
89 3300025938 Ga0207704_10005892 Ga0207704_100058924 82
90 3300025940 Ga0207691_10206095 Ga0207691_102060953 82
91 3300025945 Ga0207679_10357821 Ga0207679_103578212 82
92 3300025972 Ga0207668_10135337 Ga0207668_101353373 82
93 3300025986 Ga0207658_11547276 Ga0207658_115472761 82
94 3300026023 Ga0207677_12099173 Ga0207677_120991732 82
95 3300026067 Ga0207678_10814489 Ga0207678_108144892 82
96 3300026089 Ga0207648_10042765 Ga0207648_100427654 82
97 3300026121 Ga0207683_10020180 Ga0207683_100201802 82
98 3300027360 Ga0209969_1045998 Ga0209969_10459982 82
99 3300027471 Ga0209995_1007287 Ga0209995_10072872 82
100 3300027526 Ga0209968_1052031 Ga0209968_10520311 82
101 3300027695 Ga0209966_1095007 Ga0209966_10950071 82
102 3300028379 Ga0268266_10078913 Ga0268266_100789133 82
103 3300028380 Ga0268265_10545267 Ga0268265_105452672 82
104 3300041997 Ga0439431_0160732 Ga0439431_0160732_275_526 82
105 3300048903 Ga0496100_0949624 Ga0496100_0949624_374_625 82
106 3300048911 Ga0496108_0210793 Ga0496108_0210793_1113_1364 82
107 3300048912 Ga0496109_0294567 Ga0496109_0294567_282_533 82
108 3300048913 Ga0496110_1726877 Ga0496110_1726877_209_460 82
109 3300048915 Ga0496112_0216283 Ga0496112_0216283_658_909 82
110 3300048917 Ga0496114_1710053 Ga0496114_1710053_64_315 82
111 3300050508 nmdc:mga09592_95019_c1 nmdc:mga09592_95019_c1_492_743 82
112 3300005328 Ga0070676_10169051 Ga0070676_101690511 83
113 3300005328 Ga0070676_10809993 Ga0070676_108099931 83
114 3300005353 Ga0070669_100203803 Ga0070669_1002038032 83
115 3300005366 Ga0070659_101291426 Ga0070659_1012914261 83
116 3300005367 Ga0070667_102119603 Ga0070667_1021196031 83
117 3300005440 Ga0070705_100561175 Ga0070705_1005611752 83
118 3300005444 Ga0070694_101930390 Ga0070694_1019303901 83
119 3300005445 Ga0070708_100002458 Ga0070708_10000245810 83
120 3300005459 Ga0068867_101653480 Ga0068867_1016534802 83
121 3300005467 Ga0070706_100006956 Ga0070706_1000069564 83
122 3300005468 Ga0070707_100684316 Ga0070707_1006843162 83
123 3300005471 Ga0070698_100466157 Ga0070698_1004661572 83
124 3300005518 Ga0070699_100081598 Ga0070699_1000815985 83
125 3300005536 Ga0070697_100001388 Ga0070697_10000138814 83
126 3300005544 Ga0070686_100514071 Ga0070686_1005140712 83
127 3300005578 Ga0068854_101542468 Ga0068854_1015424682 83
128 3300005614 Ga0068856_100427991 Ga0068856_1004279913 83
129 3300005617 Ga0068859_101353075 Ga0068859_1013530752 83
130 3300005843 Ga0068860_100741741 Ga0068860_1007417412 83
131 3300005844 Ga0068862_100195313 Ga0068862_1001953131 83
132 3300006163 Ga0070715_10185167 Ga0070715_101851671 83
133 3300006237 Ga0097621_100204038 Ga0097621_1002040383 83
134 3300006358 Ga0068871_100092133 Ga0068871_1000921332 83
135 3300006844 Ga0075428_100876574 Ga0075428_1008765741 83
136 3300006847 Ga0075431_102074719 Ga0075431_1020747191 83
137 3300006852 Ga0075433_11710573 Ga0075433_117105731 83
138 3300006871 Ga0075434_100839012 Ga0075434_1008390122 83
139 3300006880 Ga0075429_100155892 Ga0075429_1001558921 83
140 3300006931 Ga0097620_101353235 Ga0097620_1013532352 83
141 3300007076 Ga0075435_100410751 Ga0075435_1004107512 83
142 3300007788 Ga0099795_10368923 Ga0099795_103689231 83
143 3300009094 Ga0111539_10004278 Ga0111539_100042788 83
144 3300009147 Ga0114129_10155598 Ga0114129_101555983 83
145 3300009174 Ga0105241_10013482 Ga0105241_100134822 83
146 3300009177 Ga0105248_10753468 Ga0105248_107534682 83
147 3300009551 Ga0105238_10280448 Ga0105238_102804481 83
148 3300009553 Ga0105249_10108764 Ga0105249_101087642 83
149 3300013296 Ga0157374_10472071 Ga0157374_104720712 83
150 3300013296 Ga0157374_10813668 Ga0157374_108136682 83
151 3300013297 Ga0157378_10031092 Ga0157378_100310922 83
152 3300013297 Ga0157378_10109545 Ga0157378_101095451 83
153 3300013297 Ga0157378_11448661 Ga0157378_114486612 83
154 3300014969 Ga0157376_10152133 Ga0157376_101521332 83
155 3300014969 Ga0157376_10462210 Ga0157376_104622101 83
156 3300025907 Ga0207645_10181240 Ga0207645_101812402 83
157 3300025910 Ga0207684_10064538 Ga0207684_100645383 83
158 3300025911 Ga0207654_10059192 Ga0207654_100591922 83
159 3300025918 Ga0207662_11199995 Ga0207662_111999952 83
160 3300025961 Ga0207712_10471790 Ga0207712_104717901 83
161 3300025981 Ga0207640_10623323 Ga0207640_106233232 83
162 3300025986 Ga0207658_10164815 Ga0207658_101648152 83
163 3300026023 Ga0207677_12219653 Ga0207677_122196531 83
164 3300026078 Ga0207702_11941724 Ga0207702_119417241 83
165 3300026089 Ga0207648_10236500 Ga0207648_102365001 83
166 3300027907 Ga0207428_10187555 Ga0207428_101875552 83
167 3300028380 Ga0268265_10310655 Ga0268265_103106551 83
168 3300031852 Ga0307410_10381805 Ga0307410_103818052 83
169 3300031901 Ga0307406_10675212 Ga0307406_106752122 83
170 3300032002 Ga0307416_100961609 Ga0307416_1009616092 83
171 3300032126 Ga0307415_101705672 Ga0307415_1017056722 83
172 3300035725 Ga0373947_0714546 Ga0373947_0714546_65_319 83
173 3300037068 Ga0373925_0144494 Ga0373925_0144494_256_510 83
174 3300037068 Ga0373925_1058805 Ga0373925_1058805_131_382 83
175 3300045051 Ga0451576_1169890 Ga0451576_1169890_429_689 83
176 3300046681 Ga0495647_0056800 Ga0495647_0056800_803_1057 83
177 3300046683 Ga0495658_0003525 Ga0495658_0003525_2420_2674 83
178 3300048903 Ga0496100_0264615 Ga0496100_0264615_893_1144 83
179 3300048903 Ga0496100_1511310 Ga0496100_1511310_191_442 83
180 3300048904 Ga0496101_0196390 Ga0496101_0196390_1097_1348 83
181 3300048918 Ga0496115_0136911 Ga0496115_0136911_212_463 83
182 3300049576 Ga0501040_0108157 Ga0501040_0108157_108_362 83
183 3300049578 Ga0501042_0271265 Ga0501042_0271265_841_1095 83
184 3300049582 Ga0501048_1339190 Ga0501048_1339190_174_428 83
185 3300049592 Ga0501076_0668834 Ga0501076_0668834_541_795 83
186 3300049690 Ga0501261_105475 Ga0501261_105475_204_455 83
187 3300049824 Ga0501045_0480576 Ga0501045_0480576_631_885 83
188 3300050507 nmdc:mga05p37_340625_c1 nmdc:mga05p37_340625_c1_1188_1439 83
189 3300050508 nmdc:mga09592_1376055_c1 nmdc:mga09592_1376055_c1_146_397 83
190 3300050510 nmdc:mga06r32_1632228_c1 nmdc:mga06r32_1632228_c1_29_280 83
191 3300050511 nmdc:mga08y16_106274_c1 nmdc:mga08y16_106274_c1_1317_1577 83
192 3300050512 nmdc:mga0n895_1648027_c1 nmdc:mga0n895_1648027_c1_129_389 83
193 3300050513 nmdc:mga0rr50_105747_c2 nmdc:mga0rr50_105747_c2_1235_1495 83
194 3300053139 Ga0500568_0042457 Ga0500568_0042457_164_415 83
195 3300054114 Ga0501084_0244365 Ga0501084_0244365_92_346 83
196 3300005288 Ga0065714_10077692 Ga0065714_100776924 84
197 3300005289 Ga0065704_10758486 Ga0065704_107584862 84
198 3300005334 Ga0068869_101314182 Ga0068869_1013141822 84
199 3300005337 Ga0070682_100110915 Ga0070682_1001109152 84
200 3300005338 Ga0068868_100799908 Ga0068868_1007999082 84
201 3300005340 Ga0070689_100000006 Ga0070689_10000000670 84
202 3300005340 Ga0070689_100303986 Ga0070689_1003039862 84
203 3300005353 Ga0070669_100002078 Ga0070669_10000207813 84
204 3300005439 Ga0070711_100765594 Ga0070711_1007655942 84
205 3300005441 Ga0070700_100914983 Ga0070700_1009149831 84
206 3300005455 Ga0070663_101105664 Ga0070663_1011056641 84
207 3300005459 Ga0068867_100915394 Ga0068867_1009153941 84
208 3300005518 Ga0070699_101675496 Ga0070699_1016754961 84
209 3300005535 Ga0070684_102088451 Ga0070684_1020884511 84
210 3300005536 Ga0070697_100243435 Ga0070697_1002434351 84
211 3300005539 Ga0068853_100000583 Ga0068853_10000058311 84
212 3300005544 Ga0070686_100060608 Ga0070686_1000606084 84
213 3300005547 Ga0070693_100289898 Ga0070693_1002898982 84
214 3300005563 Ga0068855_100068659 Ga0068855_1000686595 84
215 3300005563 Ga0068855_100249759 Ga0068855_1002497592 84
216 3300005577 Ga0068857_100246994 Ga0068857_1002469943 84
217 3300005578 Ga0068854_100193005 Ga0068854_1001930052 84
218 3300005614 Ga0068856_100436347 Ga0068856_1004363472 84
219 3300005616 Ga0068852_101663089 Ga0068852_1016630892 84
220 3300005719 Ga0068861_100298033 Ga0068861_1002980331 84
221 3300005842 Ga0068858_100557804 Ga0068858_1005578043 84
222 3300005843 Ga0068860_100289940 Ga0068860_1002899403 84
223 3300009098 Ga0105245_10647505 Ga0105245_106475052 84
224 3300009147 Ga0114129_13479515 Ga0114129_134795152 84
225 3300009551 Ga0105238_10041368 Ga0105238_100413684 84
226 3300013297 Ga0157378_10545658 Ga0157378_105456583 84
227 3300014325 Ga0163163_12011511 Ga0163163_120115111 84
228 3300014326 Ga0157380_10085818 Ga0157380_100858182 84
229 3300014497 Ga0182008_10948808 Ga0182008_109488081 84
230 3300021377 Ga0213874_10235329 Ga0213874_102353291 84
231 3300021384 Ga0213876_10028571 Ga0213876_100285713 84
232 3300025924 Ga0207694_10051477 Ga0207694_100514774 84
233 3300025936 Ga0207670_10000003 Ga0207670_10000003370 84
234 3300025936 Ga0207670_10304556 Ga0207670_103045562 84
235 3300025949 Ga0207667_10369164 Ga0207667_103691641 84
236 3300025949 Ga0207667_10660213 Ga0207667_106602131 84
237 3300025981 Ga0207640_10187380 Ga0207640_101873802 84
238 3300026023 Ga0207677_10431041 Ga0207677_104310412 84
239 3300026041 Ga0207639_10004111 Ga0207639_100041116 84
240 3300026078 Ga0207702_10437229 Ga0207702_104372291 84
241 3300026116 Ga0207674_10365481 Ga0207674_103654812 84
242 3300026118 Ga0207675_100359926 Ga0207675_1003599261 84
243 3300026142 Ga0207698_11515567 Ga0207698_115155672 84
244 3300028381 Ga0268264_10264574 Ga0268264_102645743 84
245 3300028381 Ga0268264_11084804 Ga0268264_110848042 84
246 3300028556 Ga0265337_1016716 Ga0265337_10167161 84
247 3300028558 Ga0265326_10037451 Ga0265326_100374512 84
248 3300029957 Ga0265324_10000073 Ga0265324_1000007324 84
249 3300031249 Ga0265339_10000082 Ga0265339_1000008245 84
250 3300031712 Ga0265342_10047659 Ga0265342_100476592 84
251 3300039437 Ga0436365_1880327 Ga0436365_1880327_96_350 84
252 3300039450 Ga0436363_1579282 Ga0436363_1579282_2354_2608 84
253 3300039453 Ga0436362_1172326 Ga0436362_1172326_1001_1255 84
254 3300041486 Ga0451807_0562759 Ga0451807_0562759_101_358 84
255 3300041511 Ga0451855_1148549 Ga0451855_1148549_88_345 84
256 3300042876 Ga0451577_1925577 Ga0451577_1925577_128_382 84
257 3300044712 Ga0453684_0508394 Ga0453684_0508394_1035_1289 84
258 3300045836 Ga0466958_0597553 Ga0466958_0597553_330_587 84
259 3300045976 Ga0466967_0718988 Ga0466967_0718988_361_615 84
260 3300048917 Ga0496114_0056113 Ga0496114_0056113_181_438 84
261 3300049583 Ga0501067_0209727 Ga0501067_0209727_758_1015 84
262 3300050508 nmdc:mga09592_987074_c1 nmdc:mga09592_987074_c1_108_371 84
263 3300059492 Ga0587073_0041284 Ga0587073_0041284_361_615 84
264 3300059506 Ga0587085_081191 Ga0587085_081191_101_355 84
265 3300059511 Ga0587091_069983 Ga0587091_069983_189_443 84
266 3300059513 Ga0587094_075640 Ga0587094_075640_158_412 84
267 3300059644 Ga0587075_041426 Ga0587075_041426_197_451 84
268 3300060346 Ga0587111_0117378 Ga0587111_0117378_182_436 84
269 3300005455 Ga0070663_100958700 Ga0070663_1009587001 85
270 3300005614 Ga0068856_100289126 Ga0068856_1002891262 85
271 3300006237 Ga0097621_101494669 Ga0097621_1014946692 85
272 3300006880 Ga0075429_100042928 Ga0075429_1000429284 85
273 3300009098 Ga0105245_10000009 Ga0105245_1000000933 85
274 3300009177 Ga0105248_11174203 Ga0105248_111742031 85
275 3300013105 Ga0157369_10217203 Ga0157369_102172033 85
276 3300013296 Ga0157374_10455575 Ga0157374_104555752 85
277 3300013297 Ga0157378_11322723 Ga0157378_113227231 85
278 3300014745 Ga0157377_11531641 Ga0157377_115316411 85
279 3300025927 Ga0207687_10000124 Ga0207687_1000012430 85
280 3300025941 Ga0207711_11265343 Ga0207711_112653431 85
281 3300026035 Ga0207703_12247105 Ga0207703_122471051 85
282 3300026067 Ga0207678_10916409 Ga0207678_109164092 85
283 3300031711 Ga0265314_10089629 Ga0265314_100896292 85
284 3300047471 Ga0495684_0980863 Ga0495684_0980863_218_475 85
285 3300049574 Ga0501038_1343022 Ga0501038_1343022_83_340 85
286 3300049823 Ga0501044_0004074 Ga0501044_0004074_7956_8213 85
287 3300049823 Ga0501044_0021891 Ga0501044_0021891_400_657 85
288 3300049824 Ga0501045_1401293 Ga0501045_1401293_39_296 85
289 3300054114 Ga0501084_1160867 Ga0501084_1160867_131_388 85
290 3300005290 Ga0065712_10069283 Ga0065712_100692834 86
291 3300005293 Ga0065715_10093657 Ga0065715_100936574 86
292 3300005334 Ga0068869_100102656 Ga0068869_1001026562 86
293 3300005343 Ga0070687_100131331 Ga0070687_1001313311 86
294 3300005438 Ga0070701_10073632 Ga0070701_100736322 86
295 3300005545 Ga0070695_100169774 Ga0070695_1001697743 86
296 3300005842 Ga0068858_101506294 Ga0068858_1015062942 86
297 3300006237 Ga0097621_101299519 Ga0097621_1012995192 86
298 3300006847 Ga0075431_100304118 Ga0075431_1003041183 86
299 3300006852 Ga0075433_10892269 Ga0075433_108922692 86
300 3300006871 Ga0075434_100177645 Ga0075434_1001776451 86
301 3300006880 Ga0075429_100661833 Ga0075429_1006618332 86
302 3300006914 Ga0075436_100264112 Ga0075436_1002641122 86
303 3300007076 Ga0075435_100331146 Ga0075435_1003311462 86
304 3300013104 Ga0157370_11507265 Ga0157370_115072651 86
305 3300014326 Ga0157380_12826236 Ga0157380_128262361 86
306 3300025936 Ga0207670_10021212 Ga0207670_100212123 86
307 3300025942 Ga0207689_10084914 Ga0207689_100849144 86
308 3300025949 Ga0207667_10961882 Ga0207667_109618822 86
309 3300026075 Ga0207708_10297321 Ga0207708_102973212 86
310 3300037312 Ga0395899_0051790 Ga0395899_0051790_2606_2869 86
311 3300037418 Ga0395900_0124478 Ga0395900_0124478_600_863 86
312 3300038443 Ga0395901_0119741 Ga0395901_0119741_1837_2100 86
313 3300047318 Ga0495636_0010672 Ga0495636_0010672_1032_1310 86
314 3300048911 Ga0496108_1334407 Ga0496108_1334407_22_285 86
315 3300050510 nmdc:mga06r32_119902_c1 nmdc:mga06r32_119902_c1_987_1250 86
316 3300059492 Ga0587073_0143869 Ga0587073_0143869_137_400 86
317 3300059506 Ga0587085_091276 Ga0587085_091276_249_512 86
318 3300003308 Ga0006777J48905_1001803 Ga0006777J48905_10018032 87
319 3300005546 Ga0070696_100921404 Ga0070696_1009214042 87
320 3300005547 Ga0070693_100568606 Ga0070693_1005686061 87
321 3300005843 Ga0068860_101091085 Ga0068860_1010910851 87
322 3300005937 Ga0081455_10047462 Ga0081455_100474622 87
323 3300013297 Ga0157378_11382630 Ga0157378_113826302 87
324 3300026118 Ga0207675_100708164 Ga0207675_1007081642 87
325 3300031548 Ga0307408_100063631 Ga0307408_1000636311 87
326 3300038996 Ga0242420_125354 Ga0242420_125354_168_434 87
327 3300048903 Ga0496100_1382688 Ga0496100_1382688_62_328 87
328 3300048905 Ga0496102_0314383 Ga0496102_0314383_900_1166 87
329 3300048910 Ga0496107_1093813 Ga0496107_1093813_234_500 87
330 3300048915 Ga0496112_1162239 Ga0496112_1162239_303_569 87
331 3300049741 Ga0501079_0499947 Ga0501079_0499947_103_369 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

37

84

0.97

Feature Viewer

pLDDT pTM Quality
63.53 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map