F410655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 218 | 331 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300047318|Ga0495636_0010672|Ga0495636_0010672_1032_1310 |
| Length | 92 |
| Sequence | MEKESIMLWTLIVGLIVGAIAKLLMPGRDPGGFIITMIIGVAGAFLAHFLGANLGWYQEGEPAGFVASVLGAVILLAIYRAVIGRKTLTPRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 168 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 170 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 198 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 211 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.47 |
| Metatranscriptomes | 4.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 5.14 |
| Rhizosphere | 92.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006777J48905_1001803 | 3300003308 | Bacteria | 525 |
| 2 | Ga0065714_10077692 | 3300005288 | Bacteria | 2667 |
| 3 | Ga0065704_10758486 | 3300005289 | Bacteria | 539 |
| 4 | Ga0065712_10069283 | 3300005290 | Bacteria | 7602 |
| 5 | Ga0065715_10093657 | 3300005293 | Bacteria | 4606 |
| 6 | Ga0070658_10296526 | 3300005327 | Bacteria | 1378 |
| 7 | Ga0070676_10005862 | 3300005328 | Bacteria | 6558 |
| 8 | Ga0070676_10169051 | 3300005328 | Unclassified | 1412 |
| 9 | Ga0070676_10809993 | 3300005328 | Unclassified | 692 |
| 10 | Ga0070683_100172433 | 3300005329 | Bacteria | 2053 |
| 11 | Ga0070690_101165697 | 3300005330 | Unclassified | 613 |
| 12 | Ga0070670_100040359 | 3300005331 | Bacteria | 4013 |
| 13 | Ga0068869_100102656 | 3300005334 | Bacteria | 2165 |
| 14 | Ga0068869_101314182 | 3300005334 | Bacteria | 638 |
| 15 | Ga0070666_10278082 | 3300005335 | Bacteria | 1189 |
| 16 | Ga0070680_101075661 | 3300005336 | Bacteria | 695 |
| 17 | Ga0070682_100110915 | 3300005337 | Bacteria | 1828 |
| 18 | Ga0068868_100316622 | 3300005338 | Unclassified | 1328 |
| 19 | Ga0068868_100799908 | 3300005338 | Bacteria | 851 |
| 20 | Ga0070689_100000006 | 3300005340 | Bacteria | 332562 |
| 21 | Ga0070689_100303986 | 3300005340 | Unclassified | 1328 |
| 22 | Ga0070689_100848845 | 3300005340 | Bacteria | 805 |
| 23 | Ga0070687_100131331 | 3300005343 | Unclassified | 1446 |
| 24 | Ga0070668_100205568 | 3300005347 | Bacteria | 1618 |
| 25 | Ga0070669_100002078 | 3300005353 | Bacteria | 14468 |
| 26 | Ga0070669_100131372 | 3300005353 | Bacteria | 1921 |
| 27 | Ga0070669_100203803 | 3300005353 | Unclassified | 1558 |
| 28 | Ga0070671_100060144 | 3300005355 | Bacteria | 3163 |
| 29 | Ga0070671_100158696 | 3300005355 | Bacteria | 1911 |
| 30 | Ga0070674_100032403 | 3300005356 | Bacteria | 3470 |
| 31 | Ga0070674_101703624 | 3300005356 | Bacteria | 570 |
| 32 | Ga0070673_100274505 | 3300005364 | Bacteria | 1477 |
| 33 | Ga0070659_101291426 | 3300005366 | Bacteria | 647 |
| 34 | Ga0070667_100002714 | 3300005367 | Bacteria | 15320 |
| 35 | Ga0070667_102119603 | 3300005367 | Bacteria | 530 |
| 36 | Ga0070667_102285276 | 3300005367 | Unclassified | 509 |
| 37 | Ga0070713_102251317 | 3300005436 | Unclassified | 528 |
| 38 | Ga0070701_10073632 | 3300005438 | Unclassified | 1832 |
| 39 | Ga0070711_100765594 | 3300005439 | Unclassified | 817 |
| 40 | Ga0070705_100561175 | 3300005440 | Bacteria | 877 |
| 41 | Ga0070700_100914983 | 3300005441 | Bacteria | 715 |
| 42 | Ga0070694_101598148 | 3300005444 | Bacteria | 553 |
| 43 | Ga0070694_101930390 | 3300005444 | Bacteria | 504 |
| 44 | Ga0070708_100002458 | 3300005445 | Bacteria | 14346 |
| 45 | Ga0070663_100958700 | 3300005455 | Bacteria | 742 |
| 46 | Ga0070663_101105664 | 3300005455 | Bacteria | 693 |
| 47 | Ga0070662_101127453 | 3300005457 | Bacteria | 673 |
| 48 | Ga0068867_100097089 | 3300005459 | Bacteria | 2244 |
| 49 | Ga0068867_100915394 | 3300005459 | Unclassified | 790 |
| 50 | Ga0068867_101653480 | 3300005459 | Bacteria | 599 |
| 51 | Ga0070685_10768027 | 3300005466 | Bacteria | 708 |
| 52 | Ga0070685_10863242 | 3300005466 | Bacteria | 671 |
| 53 | Ga0070706_100006956 | 3300005467 | Bacteria | 10670 |
| 54 | Ga0070707_100684316 | 3300005468 | Bacteria | 988 |
| 55 | Ga0070698_100466157 | 3300005471 | Bacteria | 1199 |
| 56 | Ga0070699_100081598 | 3300005518 | Bacteria | 2819 |
| 57 | Ga0070699_101675496 | 3300005518 | Bacteria | 582 |
| 58 | Ga0070679_100177153 | 3300005530 | Bacteria | 2105 |
| 59 | Ga0070679_100394691 | 3300005530 | Unclassified | 1330 |
| 60 | Ga0070684_101880705 | 3300005535 | Bacteria | 565 |
| 61 | Ga0070684_102088451 | 3300005535 | Unclassified | 535 |
| 62 | Ga0070697_100001388 | 3300005536 | Bacteria | 18330 |
| 63 | Ga0070697_100243435 | 3300005536 | Unclassified | 1536 |
| 64 | Ga0068853_100000583 | 3300005539 | Bacteria | 24976 |
| 65 | Ga0068853_101625065 | 3300005539 | Bacteria | 626 |
| 66 | Ga0070672_100037446 | 3300005543 | Bacteria | 3701 |
| 67 | Ga0070686_100060608 | 3300005544 | Bacteria | 2442 |
| 68 | Ga0070686_100514071 | 3300005544 | Bacteria | 931 |
| 69 | Ga0070686_100846932 | 3300005544 | Bacteria | 740 |
| 70 | Ga0070695_100169774 | 3300005545 | Bacteria | 1538 |
| 71 | Ga0070696_100921404 | 3300005546 | Unclassified | 726 |
| 72 | Ga0070693_100289898 | 3300005547 | Bacteria | 1099 |
| 73 | Ga0070693_100568606 | 3300005547 | Unclassified | 814 |
| 74 | Ga0070665_100164453 | 3300005548 | Unclassified | 2221 |
| 75 | Ga0068855_100068659 | 3300005563 | Bacteria | 4126 |
| 76 | Ga0068855_100249759 | 3300005563 | Bacteria | 1979 |
| 77 | Ga0068855_102074692 | 3300005563 | Bacteria | 573 |
| 78 | Ga0070664_100384661 | 3300005564 | Bacteria | 1281 |
| 79 | Ga0068857_100246994 | 3300005577 | Unclassified | 1635 |
| 80 | Ga0068857_100603572 | 3300005577 | Bacteria | 1038 |
| 81 | Ga0068854_100193005 | 3300005578 | Bacteria | 1597 |
| 82 | Ga0068854_101542468 | 3300005578 | Bacteria | 604 |
| 83 | Ga0068856_100289126 | 3300005614 | Unclassified | 1656 |
| 84 | Ga0068856_100427991 | 3300005614 | Bacteria | 1344 |
| 85 | Ga0068856_100436347 | 3300005614 | Bacteria | 1330 |
| 86 | Ga0068852_101663089 | 3300005616 | Bacteria | 661 |
| 87 | Ga0068859_101353075 | 3300005617 | Bacteria | 785 |
| 88 | Ga0068861_100298033 | 3300005719 | Bacteria | 1395 |
| 89 | Ga0068858_100557804 | 3300005842 | Bacteria | 1109 |
| 90 | Ga0068858_101506294 | 3300005842 | Unclassified | 663 |
| 91 | Ga0068860_100289940 | 3300005843 | Unclassified | 1601 |
| 92 | Ga0068860_100741741 | 3300005843 | Bacteria | 993 |
| 93 | Ga0068860_101091085 | 3300005843 | Unclassified | 817 |
| 94 | Ga0068862_100159308 | 3300005844 | Bacteria | 2014 |
| 95 | Ga0068862_100195313 | 3300005844 | Unclassified | 1823 |
| 96 | Ga0081455_10047462 | 3300005937 | Unclassified | 3719 |
| 97 | Ga0081455_10322806 | 3300005937 | Unclassified | 1099 |
| 98 | Ga0070715_10185167 | 3300006163 | Unclassified | 1047 |
| 99 | Ga0097621_100084481 | 3300006237 | Bacteria | 2646 |
| 100 | Ga0097621_100204038 | 3300006237 | Bacteria | 1717 |
| 101 | Ga0097621_101299519 | 3300006237 | Bacteria | 687 |
| 102 | Ga0097621_101494669 | 3300006237 | Bacteria | 641 |
| 103 | Ga0068871_100092133 | 3300006358 | Bacteria | 2527 |
| 104 | Ga0068871_100248541 | 3300006358 | Unclassified | 1548 |
| 105 | Ga0068871_100900464 | 3300006358 | Bacteria | 820 |
| 106 | Ga0075428_100876574 | 3300006844 | Bacteria | 952 |
| 107 | Ga0075431_100161109 | 3300006847 | Bacteria | 2307 |
| 108 | Ga0075431_100304118 | 3300006847 | Bacteria | 1611 |
| 109 | Ga0075431_102074719 | 3300006847 | Unclassified | 523 |
| 110 | Ga0075433_10892269 | 3300006852 | Bacteria | 776 |
| 111 | Ga0075433_11710573 | 3300006852 | Unclassified | 542 |
| 112 | Ga0075434_100177645 | 3300006871 | Bacteria | 2149 |
| 113 | Ga0075434_100839012 | 3300006871 | Unclassified | 935 |
| 114 | Ga0075429_100042928 | 3300006880 | Bacteria | 3934 |
| 115 | Ga0075429_100155892 | 3300006880 | Bacteria | 2000 |
| 116 | Ga0075429_100661833 | 3300006880 | Bacteria | 915 |
| 117 | Ga0068865_100020426 | 3300006881 | Bacteria | 4294 |
| 118 | Ga0075436_100264112 | 3300006914 | Bacteria | 1228 |
| 119 | Ga0097620_101353235 | 3300006931 | Bacteria | 785 |
| 120 | Ga0075435_100331146 | 3300007076 | Unclassified | 1304 |
| 121 | Ga0075435_100410751 | 3300007076 | Bacteria | 1165 |
| 122 | Ga0099795_10368923 | 3300007788 | Unclassified | 646 |
| 123 | Ga0111539_10004278 | 3300009094 | Bacteria | 18687 |
| 124 | Ga0105245_10000009 | 3300009098 | Bacteria | 279713 |
| 125 | Ga0105245_10647505 | 3300009098 | Bacteria | 1087 |
| 126 | Ga0114129_10155598 | 3300009147 | Bacteria | 3126 |
| 127 | Ga0114129_10265652 | 3300009147 | Bacteria | 2298 |
| 128 | Ga0114129_11892226 | 3300009147 | Bacteria | 724 |
| 129 | Ga0114129_13479515 | 3300009147 | Bacteria | 504 |
| 130 | Ga0105241_10013482 | 3300009174 | Bacteria | 5990 |
| 131 | Ga0105248_10753468 | 3300009177 | Unclassified | 1099 |
| 132 | Ga0105248_11174203 | 3300009177 | Bacteria | 868 |
| 133 | Ga0105238_10041368 | 3300009551 | Unclassified | 4667 |
| 134 | Ga0105238_10280448 | 3300009551 | Bacteria | 1648 |
| 135 | Ga0105249_10108764 | 3300009553 | Bacteria | 2617 |
| 136 | Ga0105246_12538776 | 3300011119 | Bacteria | 505 |
| 137 | Ga0157370_11507265 | 3300013104 | Unclassified | 605 |
| 138 | Ga0157369_10217203 | 3300013105 | Bacteria | 2002 |
| 139 | Ga0157374_10181453 | 3300013296 | Bacteria | 2056 |
| 140 | Ga0157374_10455575 | 3300013296 | Bacteria | 1281 |
| 141 | Ga0157374_10472071 | 3300013296 | Bacteria | 1257 |
| 142 | Ga0157374_10813668 | 3300013296 | Unclassified | 950 |
| 143 | Ga0157378_10031092 | 3300013297 | Unclassified | 4715 |
| 144 | Ga0157378_10056526 | 3300013297 | Bacteria | 3497 |
| 145 | Ga0157378_10109545 | 3300013297 | Bacteria | 2530 |
| 146 | Ga0157378_10221318 | 3300013297 | Bacteria | 1799 |
| 147 | Ga0157378_10545658 | 3300013297 | Bacteria | 1164 |
| 148 | Ga0157378_11322723 | 3300013297 | Bacteria | 762 |
| 149 | Ga0157378_11382630 | 3300013297 | Unclassified | 747 |
| 150 | Ga0157378_11448661 | 3300013297 | Bacteria | 730 |
| 151 | Ga0163162_10090774 | 3300013306 | Bacteria | 3137 |
| 152 | Ga0157375_10535063 | 3300013308 | Bacteria | 1334 |
| 153 | Ga0157375_13353271 | 3300013308 | Bacteria | 534 |
| 154 | Ga0163163_12011511 | 3300014325 | Bacteria | 638 |
| 155 | Ga0157380_10085818 | 3300014326 | Bacteria | 2585 |
| 156 | Ga0157380_12826236 | 3300014326 | Unclassified | 552 |
| 157 | Ga0182008_10948808 | 3300014497 | Unclassified | 509 |
| 158 | Ga0157377_11531641 | 3300014745 | Unclassified | 531 |
| 159 | Ga0157376_10121837 | 3300014969 | Bacteria | 2313 |
| 160 | Ga0157376_10152133 | 3300014969 | Bacteria | 2088 |
| 161 | Ga0157376_10462210 | 3300014969 | Bacteria | 1240 |
| 162 | Ga0206349_1197564 | 3300020075 | Bacteria | 1117 |
| 163 | Ga0206350_11220247 | 3300020080 | Bacteria | 722 |
| 164 | Ga0206353_11909214 | 3300020082 | Bacteria | 692 |
| 165 | Ga0154015_1134243 | 3300020610 | Unclassified | 876 |
| 166 | Ga0213874_10235329 | 3300021377 | Unclassified | 670 |
| 167 | Ga0213876_10028571 | 3300021384 | Bacteria | 2940 |
| 168 | Ga0224712_10058075 | 3300022467 | Bacteria | 1531 |
| 169 | Ga0207697_10000135 | 3300025315 | Bacteria | 35637 |
| 170 | Ga0207682_10110736 | 3300025893 | Bacteria | 1208 |
| 171 | Ga0207688_10001418 | 3300025901 | Bacteria | 12498 |
| 172 | Ga0207680_10082830 | 3300025903 | Unclassified | 2020 |
| 173 | Ga0207645_10012342 | 3300025907 | Bacteria | 5798 |
| 174 | Ga0207645_10181240 | 3300025907 | Bacteria | 1382 |
| 175 | Ga0207684_10064538 | 3300025910 | Bacteria | 3109 |
| 176 | Ga0207654_10059192 | 3300025911 | Bacteria | 2233 |
| 177 | Ga0207662_11199995 | 3300025918 | Bacteria | 539 |
| 178 | Ga0207681_10017829 | 3300025923 | Bacteria | 4464 |
| 179 | Ga0207694_10051477 | 3300025924 | Bacteria | 3192 |
| 180 | Ga0207659_11113734 | 3300025926 | Bacteria | 679 |
| 181 | Ga0207687_10000124 | 3300025927 | Bacteria | 51583 |
| 182 | Ga0207644_10087862 | 3300025931 | Bacteria | 2311 |
| 183 | Ga0207644_10753662 | 3300025931 | Bacteria | 813 |
| 184 | Ga0207670_10000003 | 3300025936 | Bacteria | 760449 |
| 185 | Ga0207670_10008381 | 3300025936 | Bacteria | 5832 |
| 186 | Ga0207670_10021212 | 3300025936 | Bacteria | 4004 |
| 187 | Ga0207670_10304556 | 3300025936 | Unclassified | 1249 |
| 188 | Ga0207669_10048815 | 3300025937 | Bacteria | 2517 |
| 189 | Ga0207704_10005892 | 3300025938 | Bacteria | 5675 |
| 190 | Ga0207691_10206095 | 3300025940 | Bacteria | 1710 |
| 191 | Ga0207711_11265343 | 3300025941 | Bacteria | 680 |
| 192 | Ga0207689_10084914 | 3300025942 | Bacteria | 2602 |
| 193 | Ga0207679_10357821 | 3300025945 | Bacteria | 1274 |
| 194 | Ga0207667_10369164 | 3300025949 | Unclassified | 1463 |
| 195 | Ga0207667_10660213 | 3300025949 | Bacteria | 1051 |
| 196 | Ga0207667_10961882 | 3300025949 | Unclassified | 843 |
| 197 | Ga0207712_10471790 | 3300025961 | Bacteria | 1068 |
| 198 | Ga0207668_10135337 | 3300025972 | Bacteria | 1887 |
| 199 | Ga0207668_10328522 | 3300025972 | Bacteria | 1271 |
| 200 | Ga0207640_10187380 | 3300025981 | Bacteria | 1557 |
| 201 | Ga0207640_10623323 | 3300025981 | Bacteria | 916 |
| 202 | Ga0207658_10164815 | 3300025986 | Bacteria | 1820 |
| 203 | Ga0207658_11547276 | 3300025986 | Bacteria | 606 |
| 204 | Ga0207658_12130614 | 3300025986 | Unclassified | 509 |
| 205 | Ga0207677_10431041 | 3300026023 | Bacteria | 1125 |
| 206 | Ga0207677_12099173 | 3300026023 | Unclassified | 525 |
| 207 | Ga0207677_12219653 | 3300026023 | Unclassified | 511 |
| 208 | Ga0207703_12247105 | 3300026035 | Bacteria | 521 |
| 209 | Ga0207639_10004111 | 3300026041 | Bacteria | 9810 |
| 210 | Ga0207678_10814489 | 3300026067 | Bacteria | 825 |
| 211 | Ga0207678_10916409 | 3300026067 | Bacteria | 775 |
| 212 | Ga0207708_10297321 | 3300026075 | Bacteria | 1312 |
| 213 | Ga0207702_10437229 | 3300026078 | Bacteria | 1267 |
| 214 | Ga0207702_11941724 | 3300026078 | Unclassified | 579 |
| 215 | Ga0207648_10042765 | 3300026089 | Bacteria | 3978 |
| 216 | Ga0207648_10236500 | 3300026089 | Unclassified | 1626 |
| 217 | Ga0207674_10365481 | 3300026116 | Bacteria | 1395 |
| 218 | Ga0207674_11391627 | 3300026116 | Bacteria | 671 |
| 219 | Ga0207675_100359926 | 3300026118 | Bacteria | 1427 |
| 220 | Ga0207675_100708164 | 3300026118 | Bacteria | 1016 |
| 221 | Ga0207683_10020180 | 3300026121 | Bacteria | 5696 |
| 222 | Ga0207683_10655185 | 3300026121 | Bacteria | 973 |
| 223 | Ga0207698_11515567 | 3300026142 | Bacteria | 686 |
| 224 | Ga0209969_1045998 | 3300027360 | Bacteria | 681 |
| 225 | Ga0209995_1007287 | 3300027471 | Bacteria | 1784 |
| 226 | Ga0209968_1052031 | 3300027526 | Bacteria | 713 |
| 227 | Ga0209966_1095007 | 3300027695 | Bacteria | 670 |
| 228 | Ga0207428_10187555 | 3300027907 | Bacteria | 1560 |
| 229 | Ga0268266_10078913 | 3300028379 | Bacteria | 2865 |
| 230 | Ga0268265_10310655 | 3300028380 | Bacteria | 1423 |
| 231 | Ga0268265_10545267 | 3300028380 | Unclassified | 1100 |
| 232 | Ga0268264_10264574 | 3300028381 | Unclassified | 1604 |
| 233 | Ga0268264_11084804 | 3300028381 | Bacteria | 809 |
| 234 | Ga0265337_1016716 | 3300028556 | Unclassified | 2366 |
| 235 | Ga0265326_10037451 | 3300028558 | Bacteria | 1379 |
| 236 | Ga0265324_10000073 | 3300029957 | Bacteria | 79760 |
| 237 | Ga0265339_10000082 | 3300031249 | Bacteria | 81791 |
| 238 | Ga0307513_10006430 | 3300031456 | Bacteria | 15353 |
| 239 | Ga0307408_100063631 | 3300031548 | Bacteria | 2699 |
| 240 | Ga0265314_10089629 | 3300031711 | Bacteria | 2006 |
| 241 | Ga0265342_10047659 | 3300031712 | Bacteria | 2571 |
| 242 | Ga0307410_10381805 | 3300031852 | Bacteria | 1134 |
| 243 | Ga0307406_10675212 | 3300031901 | Bacteria | 860 |
| 244 | Ga0307416_100961609 | 3300032002 | Bacteria | 956 |
| 245 | Ga0307415_101705672 | 3300032126 | Bacteria | 608 |
| 246 | Ga0373947_0714546 | 3300035725 | Unclassified | 684 |
| 247 | Ga0373937_0350506 | 3300036401 | Bacteria | 1398 |
| 248 | Ga0373925_0144494 | 3300037068 | Bacteria | 1864 |
| 249 | Ga0373925_1058805 | 3300037068 | Bacteria | 668 |
| 250 | Ga0395899_0051790 | 3300037312 | Bacteria | 3046 |
| 251 | Ga0395900_0050153 | 3300037418 | Bacteria | 4299 |
| 252 | Ga0395900_0124478 | 3300037418 | Bacteria | 2644 |
| 253 | Ga0395898_0224219 | 3300037466 | Bacteria | 1793 |
| 254 | Ga0395901_0119741 | 3300038443 | Bacteria | 2766 |
| 255 | Ga0395901_0337733 | 3300038443 | Bacteria | 1556 |
| 256 | Ga0242420_125354 | 3300038996 | Unclassified | 563 |
| 257 | Ga0436365_0923216 | 3300039437 | Unclassified | 892 |
| 258 | Ga0436365_1880327 | 3300039437 | Bacteria | 1901 |
| 259 | Ga0436363_1579282 | 3300039450 | Bacteria | 3400 |
| 260 | Ga0436362_1172326 | 3300039453 | Bacteria | 3655 |
| 261 | Ga0451807_0562759 | 3300041486 | Bacteria | 739 |
| 262 | Ga0451855_1148549 | 3300041511 | Bacteria | 504 |
| 263 | Ga0439431_0160732 | 3300041997 | Bacteria | 642 |
| 264 | Ga0451577_1925577 | 3300042876 | Bacteria | 517 |
| 265 | Ga0453684_0508394 | 3300044712 | Bacteria | 1333 |
| 266 | Ga0451576_1169890 | 3300045051 | Bacteria | 804 |
| 267 | Ga0466958_0597553 | 3300045836 | Bacteria | 718 |
| 268 | Ga0466967_0718988 | 3300045976 | Bacteria | 990 |
| 269 | Ga0495647_0056800 | 3300046681 | Bacteria | 1535 |
| 270 | Ga0495658_0003525 | 3300046683 | Bacteria | 7743 |
| 271 | Ga0495636_0010672 | 3300047318 | Unclassified | 3631 |
| 272 | Ga0495684_0980863 | 3300047471 | Unclassified | 538 |
| 273 | Ga0496100_0264615 | 3300048903 | Bacteria | 1276 |
| 274 | Ga0496100_0949624 | 3300048903 | Unclassified | 676 |
| 275 | Ga0496100_1382688 | 3300048903 | Unclassified | 556 |
| 276 | Ga0496100_1511310 | 3300048903 | Unclassified | 530 |
| 277 | Ga0496101_0196390 | 3300048904 | Bacteria | 1559 |
| 278 | Ga0496102_0314383 | 3300048905 | Archaea | 1476 |
| 279 | Ga0496107_1093813 | 3300048910 | Unclassified | 576 |
| 280 | Ga0496108_0210793 | 3300048911 | Unclassified | 1687 |
| 281 | Ga0496108_1334407 | 3300048911 | Bacteria | 602 |
| 282 | Ga0496109_0294567 | 3300048912 | Bacteria | 1530 |
| 283 | Ga0496110_1726877 | 3300048913 | Unclassified | 536 |
| 284 | Ga0496112_0216283 | 3300048915 | Bacteria | 1873 |
| 285 | Ga0496112_1162239 | 3300048915 | Unclassified | 689 |
| 286 | Ga0496114_0056113 | 3300048917 | Bacteria | 3286 |
| 287 | Ga0496114_1710053 | 3300048917 | Bacteria | 517 |
| 288 | Ga0496115_0136911 | 3300048918 | Bacteria | 2019 |
| 289 | Ga0501038_1343022 | 3300049574 | Unclassified | 515 |
| 290 | Ga0501040_0108157 | 3300049576 | Bacteria | 1944 |
| 291 | Ga0501042_0271265 | 3300049578 | Bacteria | 1225 |
| 292 | Ga0501048_1339190 | 3300049582 | Bacteria | 515 |
| 293 | Ga0501067_0209727 | 3300049583 | Bacteria | 1085 |
| 294 | Ga0501073_0249318 | 3300049589 | Bacteria | 1226 |
| 295 | Ga0501076_0668834 | 3300049592 | Bacteria | 857 |
| 296 | Ga0501261_105475 | 3300049690 | Bacteria | 541 |
| 297 | Ga0501079_0499947 | 3300049741 | Unclassified | 956 |
| 298 | Ga0501083_0550973 | 3300049744 | Unclassified | 750 |
| 299 | Ga0501044_0004074 | 3300049823 | Bacteria | 16388 |
| 300 | Ga0501044_0021891 | 3300049823 | Bacteria | 6817 |
| 301 | Ga0501045_0480576 | 3300049824 | Bacteria | 923 |
| 302 | Ga0501045_1401293 | 3300049824 | Unclassified | 508 |
| 303 | nmdc:mga05p37_110879_c1 | 3300050507 | Bacteria | 3375 |
| 304 | nmdc:mga05p37_340625_c1 | 3300050507 | Unclassified | 1768 |
| 305 | nmdc:mga09592_1376055_c1 | 3300050508 | Unclassified | 578 |
| 306 | nmdc:mga09592_50225_c1 | 3300050508 | Bacteria | 3518 |
| 307 | nmdc:mga09592_641624_c1 | 3300050508 | Bacteria | 907 |
| 308 | nmdc:mga09592_95019_c1 | 3300050508 | Bacteria | 2549 |
| 309 | nmdc:mga09592_987074_c1 | 3300050508 | Bacteria | 704 |
| 310 | nmdc:mga06r32_119902_c1 | 3300050510 | Bacteria | 2594 |
| 311 | nmdc:mga06r32_1632228_c1 | 3300050510 | Unclassified | 583 |
| 312 | nmdc:mga06r32_837203_c1 | 3300050510 | Unclassified | 879 |
| 313 | nmdc:mga08y16_106274_c1 | 3300050511 | Bacteria | 2922 |
| 314 | nmdc:mga0n895_1648027_c1 | 3300050512 | Unclassified | 605 |
| 315 | nmdc:mga0n895_431859_c1 | 3300050512 | Bacteria | 1331 |
| 316 | nmdc:mga0rr50_105747_c2 | 3300050513 | Bacteria | 1640 |
| 317 | nmdc:mga0rr50_187286_c1 | 3300050513 | Unclassified | 1694 |
| 318 | nmdc:mga08x19_279766_c1 | 3300050514 | Bacteria | 1156 |
| 319 | nmdc:mga0a205_496764_c1 | 3300050515 | Bacteria | 1077 |
| 320 | Ga0500568_0042457 | 3300053139 | Bacteria | 1822 |
| 321 | Ga0501084_0244365 | 3300054114 | Bacteria | 1515 |
| 322 | Ga0501084_1160867 | 3300054114 | Bacteria | 648 |
| 323 | Ga0587073_0041284 | 3300059492 | Unclassified | 1007 |
| 324 | Ga0587073_0143869 | 3300059492 | Unclassified | 668 |
| 325 | Ga0587085_081191 | 3300059506 | Unclassified | 653 |
| 326 | Ga0587085_091276 | 3300059506 | Unclassified | 629 |
| 327 | Ga0587091_069983 | 3300059511 | Unclassified | 765 |
| 328 | Ga0587094_075640 | 3300059513 | Unclassified | 614 |
| 329 | Ga0587128_022763 | 3300059630 | Bacteria | 977 |
| 330 | Ga0587075_041426 | 3300059644 | Unclassified | 773 |
| 331 | Ga0587111_0117378 | 3300060346 | Unclassified | 681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0249318 | Ga0501073_0249318_732_1004 | 69 |
| 2 | 3300049744 | Ga0501083_0550973 | Ga0501083_0550973_227_499 | 69 |
| 3 | 3300005544 | Ga0070686_100846932 | Ga0070686_1008469322 | 72 |
| 4 | 3300020082 | Ga0206353_11909214 | Ga0206353_119092142 | 74 |
| 5 | 3300020610 | Ga0154015_1134243 | Ga0154015_11342431 | 74 |
| 6 | 3300005356 | Ga0070674_101703624 | Ga0070674_1017036241 | 76 |
| 7 | 3300005436 | Ga0070713_102251317 | Ga0070713_1022513171 | 76 |
| 8 | 3300006358 | Ga0068871_100900464 | Ga0068871_1009004641 | 76 |
| 9 | 3300005466 | Ga0070685_10768027 | Ga0070685_107680271 | 77 |
| 10 | 3300031456 | Ga0307513_10006430 | Ga0307513_1000643013 | 77 |
| 11 | 3300059630 | Ga0587128_022763 | Ga0587128_022763_46_315 | 77 |
| 12 | 3300005327 | Ga0070658_10296526 | Ga0070658_102965262 | 78 |
| 13 | 3300005336 | Ga0070680_101075661 | Ga0070680_1010756612 | 78 |
| 14 | 3300005530 | Ga0070679_100177153 | Ga0070679_1001771533 | 78 |
| 15 | 3300005535 | Ga0070684_101880705 | Ga0070684_1018807051 | 78 |
| 16 | 3300005577 | Ga0068857_100603572 | Ga0068857_1006035722 | 78 |
| 17 | 3300020075 | Ga0206349_1197564 | Ga0206349_11975642 | 78 |
| 18 | 3300020080 | Ga0206350_11220247 | Ga0206350_112202472 | 78 |
| 19 | 3300022467 | Ga0224712_10058075 | Ga0224712_100580752 | 78 |
| 20 | 3300026116 | Ga0207674_11391627 | Ga0207674_113916272 | 78 |
| 21 | 3300037418 | Ga0395900_0050153 | Ga0395900_0050153_3395_3655 | 78 |
| 22 | 3300037466 | Ga0395898_0224219 | Ga0395898_0224219_310_570 | 78 |
| 23 | 3300038443 | Ga0395901_0337733 | Ga0395901_0337733_895_1155 | 78 |
| 24 | 3300005347 | Ga0070668_100205568 | Ga0070668_1002055682 | 80 |
| 25 | 3300005355 | Ga0070671_100060144 | Ga0070671_1000601442 | 80 |
| 26 | 3300005367 | Ga0070667_102285276 | Ga0070667_1022852762 | 80 |
| 27 | 3300005530 | Ga0070679_100394691 | Ga0070679_1003946913 | 80 |
| 28 | 3300005563 | Ga0068855_102074692 | Ga0068855_1020746922 | 80 |
| 29 | 3300005937 | Ga0081455_10322806 | Ga0081455_103228063 | 80 |
| 30 | 3300013297 | Ga0157378_10056526 | Ga0157378_100565263 | 80 |
| 31 | 3300025931 | Ga0207644_10087862 | Ga0207644_100878622 | 80 |
| 32 | 3300025972 | Ga0207668_10328522 | Ga0207668_103285222 | 80 |
| 33 | 3300025986 | Ga0207658_12130614 | Ga0207658_121306141 | 80 |
| 34 | 3300039437 | Ga0436365_0923216 | Ga0436365_0923216_45_299 | 80 |
| 35 | 3300050508 | nmdc:mga09592_50225_c1 | nmdc:mga09592_50225_c1_2812_3057 | 80 |
| 36 | 3300005330 | Ga0070690_101165697 | Ga0070690_1011656972 | 81 |
| 37 | 3300005444 | Ga0070694_101598148 | Ga0070694_1015981482 | 81 |
| 38 | 3300006847 | Ga0075431_100161109 | Ga0075431_1001611092 | 81 |
| 39 | 3300009147 | Ga0114129_10265652 | Ga0114129_102656521 | 81 |
| 40 | 3300009147 | Ga0114129_11892226 | Ga0114129_118922262 | 81 |
| 41 | 3300013308 | Ga0157375_13353271 | Ga0157375_133532712 | 81 |
| 42 | 3300026121 | Ga0207683_10655185 | Ga0207683_106551852 | 81 |
| 43 | 3300036401 | Ga0373937_0350506 | Ga0373937_0350506_44_307 | 81 |
| 44 | 3300050507 | nmdc:mga05p37_110879_c1 | nmdc:mga05p37_110879_c1_1610_1858 | 81 |
| 45 | 3300050508 | nmdc:mga09592_641624_c1 | nmdc:mga09592_641624_c1_196_444 | 81 |
| 46 | 3300050510 | nmdc:mga06r32_837203_c1 | nmdc:mga06r32_837203_c1_390_638 | 81 |
| 47 | 3300050512 | nmdc:mga0n895_431859_c1 | nmdc:mga0n895_431859_c1_697_945 | 81 |
| 48 | 3300050513 | nmdc:mga0rr50_187286_c1 | nmdc:mga0rr50_187286_c1_931_1179 | 81 |
| 49 | 3300050514 | nmdc:mga08x19_279766_c1 | nmdc:mga08x19_279766_c1_570_818 | 81 |
| 50 | 3300050515 | nmdc:mga0a205_496764_c1 | nmdc:mga0a205_496764_c1_458_706 | 81 |
| 51 | 3300005328 | Ga0070676_10005862 | Ga0070676_100058626 | 82 |
| 52 | 3300005329 | Ga0070683_100172433 | Ga0070683_1001724333 | 82 |
| 53 | 3300005331 | Ga0070670_100040359 | Ga0070670_1000403593 | 82 |
| 54 | 3300005335 | Ga0070666_10278082 | Ga0070666_102780822 | 82 |
| 55 | 3300005338 | Ga0068868_100316622 | Ga0068868_1003166222 | 82 |
| 56 | 3300005340 | Ga0070689_100848845 | Ga0070689_1008488451 | 82 |
| 57 | 3300005353 | Ga0070669_100131372 | Ga0070669_1001313722 | 82 |
| 58 | 3300005355 | Ga0070671_100158696 | Ga0070671_1001586962 | 82 |
| 59 | 3300005356 | Ga0070674_100032403 | Ga0070674_1000324033 | 82 |
| 60 | 3300005364 | Ga0070673_100274505 | Ga0070673_1002745053 | 82 |
| 61 | 3300005367 | Ga0070667_100002714 | Ga0070667_1000027144 | 82 |
| 62 | 3300005457 | Ga0070662_101127453 | Ga0070662_1011274532 | 82 |
| 63 | 3300005459 | Ga0068867_100097089 | Ga0068867_1000970893 | 82 |
| 64 | 3300005466 | Ga0070685_10863242 | Ga0070685_108632422 | 82 |
| 65 | 3300005539 | Ga0068853_101625065 | Ga0068853_1016250652 | 82 |
| 66 | 3300005543 | Ga0070672_100037446 | Ga0070672_1000374463 | 82 |
| 67 | 3300005548 | Ga0070665_100164453 | Ga0070665_1001644532 | 82 |
| 68 | 3300005564 | Ga0070664_100384661 | Ga0070664_1003846612 | 82 |
| 69 | 3300005844 | Ga0068862_100159308 | Ga0068862_1001593083 | 82 |
| 70 | 3300006237 | Ga0097621_100084481 | Ga0097621_1000844812 | 82 |
| 71 | 3300006358 | Ga0068871_100248541 | Ga0068871_1002485413 | 82 |
| 72 | 3300006881 | Ga0068865_100020426 | Ga0068865_1000204263 | 82 |
| 73 | 3300011119 | Ga0105246_12538776 | Ga0105246_125387762 | 82 |
| 74 | 3300013296 | Ga0157374_10181453 | Ga0157374_101814533 | 82 |
| 75 | 3300013297 | Ga0157378_10221318 | Ga0157378_102213181 | 82 |
| 76 | 3300013306 | Ga0163162_10090774 | Ga0163162_100907743 | 82 |
| 77 | 3300013308 | Ga0157375_10535063 | Ga0157375_105350632 | 82 |
| 78 | 3300014969 | Ga0157376_10121837 | Ga0157376_101218373 | 82 |
| 79 | 3300025315 | Ga0207697_10000135 | Ga0207697_100001357 | 82 |
| 80 | 3300025893 | Ga0207682_10110736 | Ga0207682_101107363 | 82 |
| 81 | 3300025901 | Ga0207688_10001418 | Ga0207688_1000141811 | 82 |
| 82 | 3300025903 | Ga0207680_10082830 | Ga0207680_100828302 | 82 |
| 83 | 3300025907 | Ga0207645_10012342 | Ga0207645_100123422 | 82 |
| 84 | 3300025923 | Ga0207681_10017829 | Ga0207681_100178294 | 82 |
| 85 | 3300025926 | Ga0207659_11113734 | Ga0207659_111137341 | 82 |
| 86 | 3300025931 | Ga0207644_10753662 | Ga0207644_107536622 | 82 |
| 87 | 3300025936 | Ga0207670_10008381 | Ga0207670_100083816 | 82 |
| 88 | 3300025937 | Ga0207669_10048815 | Ga0207669_100488153 | 82 |
| 89 | 3300025938 | Ga0207704_10005892 | Ga0207704_100058924 | 82 |
| 90 | 3300025940 | Ga0207691_10206095 | Ga0207691_102060953 | 82 |
| 91 | 3300025945 | Ga0207679_10357821 | Ga0207679_103578212 | 82 |
| 92 | 3300025972 | Ga0207668_10135337 | Ga0207668_101353373 | 82 |
| 93 | 3300025986 | Ga0207658_11547276 | Ga0207658_115472761 | 82 |
| 94 | 3300026023 | Ga0207677_12099173 | Ga0207677_120991732 | 82 |
| 95 | 3300026067 | Ga0207678_10814489 | Ga0207678_108144892 | 82 |
| 96 | 3300026089 | Ga0207648_10042765 | Ga0207648_100427654 | 82 |
| 97 | 3300026121 | Ga0207683_10020180 | Ga0207683_100201802 | 82 |
| 98 | 3300027360 | Ga0209969_1045998 | Ga0209969_10459982 | 82 |
| 99 | 3300027471 | Ga0209995_1007287 | Ga0209995_10072872 | 82 |
| 100 | 3300027526 | Ga0209968_1052031 | Ga0209968_10520311 | 82 |
| 101 | 3300027695 | Ga0209966_1095007 | Ga0209966_10950071 | 82 |
| 102 | 3300028379 | Ga0268266_10078913 | Ga0268266_100789133 | 82 |
| 103 | 3300028380 | Ga0268265_10545267 | Ga0268265_105452672 | 82 |
| 104 | 3300041997 | Ga0439431_0160732 | Ga0439431_0160732_275_526 | 82 |
| 105 | 3300048903 | Ga0496100_0949624 | Ga0496100_0949624_374_625 | 82 |
| 106 | 3300048911 | Ga0496108_0210793 | Ga0496108_0210793_1113_1364 | 82 |
| 107 | 3300048912 | Ga0496109_0294567 | Ga0496109_0294567_282_533 | 82 |
| 108 | 3300048913 | Ga0496110_1726877 | Ga0496110_1726877_209_460 | 82 |
| 109 | 3300048915 | Ga0496112_0216283 | Ga0496112_0216283_658_909 | 82 |
| 110 | 3300048917 | Ga0496114_1710053 | Ga0496114_1710053_64_315 | 82 |
| 111 | 3300050508 | nmdc:mga09592_95019_c1 | nmdc:mga09592_95019_c1_492_743 | 82 |
| 112 | 3300005328 | Ga0070676_10169051 | Ga0070676_101690511 | 83 |
| 113 | 3300005328 | Ga0070676_10809993 | Ga0070676_108099931 | 83 |
| 114 | 3300005353 | Ga0070669_100203803 | Ga0070669_1002038032 | 83 |
| 115 | 3300005366 | Ga0070659_101291426 | Ga0070659_1012914261 | 83 |
| 116 | 3300005367 | Ga0070667_102119603 | Ga0070667_1021196031 | 83 |
| 117 | 3300005440 | Ga0070705_100561175 | Ga0070705_1005611752 | 83 |
| 118 | 3300005444 | Ga0070694_101930390 | Ga0070694_1019303901 | 83 |
| 119 | 3300005445 | Ga0070708_100002458 | Ga0070708_10000245810 | 83 |
| 120 | 3300005459 | Ga0068867_101653480 | Ga0068867_1016534802 | 83 |
| 121 | 3300005467 | Ga0070706_100006956 | Ga0070706_1000069564 | 83 |
| 122 | 3300005468 | Ga0070707_100684316 | Ga0070707_1006843162 | 83 |
| 123 | 3300005471 | Ga0070698_100466157 | Ga0070698_1004661572 | 83 |
| 124 | 3300005518 | Ga0070699_100081598 | Ga0070699_1000815985 | 83 |
| 125 | 3300005536 | Ga0070697_100001388 | Ga0070697_10000138814 | 83 |
| 126 | 3300005544 | Ga0070686_100514071 | Ga0070686_1005140712 | 83 |
| 127 | 3300005578 | Ga0068854_101542468 | Ga0068854_1015424682 | 83 |
| 128 | 3300005614 | Ga0068856_100427991 | Ga0068856_1004279913 | 83 |
| 129 | 3300005617 | Ga0068859_101353075 | Ga0068859_1013530752 | 83 |
| 130 | 3300005843 | Ga0068860_100741741 | Ga0068860_1007417412 | 83 |
| 131 | 3300005844 | Ga0068862_100195313 | Ga0068862_1001953131 | 83 |
| 132 | 3300006163 | Ga0070715_10185167 | Ga0070715_101851671 | 83 |
| 133 | 3300006237 | Ga0097621_100204038 | Ga0097621_1002040383 | 83 |
| 134 | 3300006358 | Ga0068871_100092133 | Ga0068871_1000921332 | 83 |
| 135 | 3300006844 | Ga0075428_100876574 | Ga0075428_1008765741 | 83 |
| 136 | 3300006847 | Ga0075431_102074719 | Ga0075431_1020747191 | 83 |
| 137 | 3300006852 | Ga0075433_11710573 | Ga0075433_117105731 | 83 |
| 138 | 3300006871 | Ga0075434_100839012 | Ga0075434_1008390122 | 83 |
| 139 | 3300006880 | Ga0075429_100155892 | Ga0075429_1001558921 | 83 |
| 140 | 3300006931 | Ga0097620_101353235 | Ga0097620_1013532352 | 83 |
| 141 | 3300007076 | Ga0075435_100410751 | Ga0075435_1004107512 | 83 |
| 142 | 3300007788 | Ga0099795_10368923 | Ga0099795_103689231 | 83 |
| 143 | 3300009094 | Ga0111539_10004278 | Ga0111539_100042788 | 83 |
| 144 | 3300009147 | Ga0114129_10155598 | Ga0114129_101555983 | 83 |
| 145 | 3300009174 | Ga0105241_10013482 | Ga0105241_100134822 | 83 |
| 146 | 3300009177 | Ga0105248_10753468 | Ga0105248_107534682 | 83 |
| 147 | 3300009551 | Ga0105238_10280448 | Ga0105238_102804481 | 83 |
| 148 | 3300009553 | Ga0105249_10108764 | Ga0105249_101087642 | 83 |
| 149 | 3300013296 | Ga0157374_10472071 | Ga0157374_104720712 | 83 |
| 150 | 3300013296 | Ga0157374_10813668 | Ga0157374_108136682 | 83 |
| 151 | 3300013297 | Ga0157378_10031092 | Ga0157378_100310922 | 83 |
| 152 | 3300013297 | Ga0157378_10109545 | Ga0157378_101095451 | 83 |
| 153 | 3300013297 | Ga0157378_11448661 | Ga0157378_114486612 | 83 |
| 154 | 3300014969 | Ga0157376_10152133 | Ga0157376_101521332 | 83 |
| 155 | 3300014969 | Ga0157376_10462210 | Ga0157376_104622101 | 83 |
| 156 | 3300025907 | Ga0207645_10181240 | Ga0207645_101812402 | 83 |
| 157 | 3300025910 | Ga0207684_10064538 | Ga0207684_100645383 | 83 |
| 158 | 3300025911 | Ga0207654_10059192 | Ga0207654_100591922 | 83 |
| 159 | 3300025918 | Ga0207662_11199995 | Ga0207662_111999952 | 83 |
| 160 | 3300025961 | Ga0207712_10471790 | Ga0207712_104717901 | 83 |
| 161 | 3300025981 | Ga0207640_10623323 | Ga0207640_106233232 | 83 |
| 162 | 3300025986 | Ga0207658_10164815 | Ga0207658_101648152 | 83 |
| 163 | 3300026023 | Ga0207677_12219653 | Ga0207677_122196531 | 83 |
| 164 | 3300026078 | Ga0207702_11941724 | Ga0207702_119417241 | 83 |
| 165 | 3300026089 | Ga0207648_10236500 | Ga0207648_102365001 | 83 |
| 166 | 3300027907 | Ga0207428_10187555 | Ga0207428_101875552 | 83 |
| 167 | 3300028380 | Ga0268265_10310655 | Ga0268265_103106551 | 83 |
| 168 | 3300031852 | Ga0307410_10381805 | Ga0307410_103818052 | 83 |
| 169 | 3300031901 | Ga0307406_10675212 | Ga0307406_106752122 | 83 |
| 170 | 3300032002 | Ga0307416_100961609 | Ga0307416_1009616092 | 83 |
| 171 | 3300032126 | Ga0307415_101705672 | Ga0307415_1017056722 | 83 |
| 172 | 3300035725 | Ga0373947_0714546 | Ga0373947_0714546_65_319 | 83 |
| 173 | 3300037068 | Ga0373925_0144494 | Ga0373925_0144494_256_510 | 83 |
| 174 | 3300037068 | Ga0373925_1058805 | Ga0373925_1058805_131_382 | 83 |
| 175 | 3300045051 | Ga0451576_1169890 | Ga0451576_1169890_429_689 | 83 |
| 176 | 3300046681 | Ga0495647_0056800 | Ga0495647_0056800_803_1057 | 83 |
| 177 | 3300046683 | Ga0495658_0003525 | Ga0495658_0003525_2420_2674 | 83 |
| 178 | 3300048903 | Ga0496100_0264615 | Ga0496100_0264615_893_1144 | 83 |
| 179 | 3300048903 | Ga0496100_1511310 | Ga0496100_1511310_191_442 | 83 |
| 180 | 3300048904 | Ga0496101_0196390 | Ga0496101_0196390_1097_1348 | 83 |
| 181 | 3300048918 | Ga0496115_0136911 | Ga0496115_0136911_212_463 | 83 |
| 182 | 3300049576 | Ga0501040_0108157 | Ga0501040_0108157_108_362 | 83 |
| 183 | 3300049578 | Ga0501042_0271265 | Ga0501042_0271265_841_1095 | 83 |
| 184 | 3300049582 | Ga0501048_1339190 | Ga0501048_1339190_174_428 | 83 |
| 185 | 3300049592 | Ga0501076_0668834 | Ga0501076_0668834_541_795 | 83 |
| 186 | 3300049690 | Ga0501261_105475 | Ga0501261_105475_204_455 | 83 |
| 187 | 3300049824 | Ga0501045_0480576 | Ga0501045_0480576_631_885 | 83 |
| 188 | 3300050507 | nmdc:mga05p37_340625_c1 | nmdc:mga05p37_340625_c1_1188_1439 | 83 |
| 189 | 3300050508 | nmdc:mga09592_1376055_c1 | nmdc:mga09592_1376055_c1_146_397 | 83 |
| 190 | 3300050510 | nmdc:mga06r32_1632228_c1 | nmdc:mga06r32_1632228_c1_29_280 | 83 |
| 191 | 3300050511 | nmdc:mga08y16_106274_c1 | nmdc:mga08y16_106274_c1_1317_1577 | 83 |
| 192 | 3300050512 | nmdc:mga0n895_1648027_c1 | nmdc:mga0n895_1648027_c1_129_389 | 83 |
| 193 | 3300050513 | nmdc:mga0rr50_105747_c2 | nmdc:mga0rr50_105747_c2_1235_1495 | 83 |
| 194 | 3300053139 | Ga0500568_0042457 | Ga0500568_0042457_164_415 | 83 |
| 195 | 3300054114 | Ga0501084_0244365 | Ga0501084_0244365_92_346 | 83 |
| 196 | 3300005288 | Ga0065714_10077692 | Ga0065714_100776924 | 84 |
| 197 | 3300005289 | Ga0065704_10758486 | Ga0065704_107584862 | 84 |
| 198 | 3300005334 | Ga0068869_101314182 | Ga0068869_1013141822 | 84 |
| 199 | 3300005337 | Ga0070682_100110915 | Ga0070682_1001109152 | 84 |
| 200 | 3300005338 | Ga0068868_100799908 | Ga0068868_1007999082 | 84 |
| 201 | 3300005340 | Ga0070689_100000006 | Ga0070689_10000000670 | 84 |
| 202 | 3300005340 | Ga0070689_100303986 | Ga0070689_1003039862 | 84 |
| 203 | 3300005353 | Ga0070669_100002078 | Ga0070669_10000207813 | 84 |
| 204 | 3300005439 | Ga0070711_100765594 | Ga0070711_1007655942 | 84 |
| 205 | 3300005441 | Ga0070700_100914983 | Ga0070700_1009149831 | 84 |
| 206 | 3300005455 | Ga0070663_101105664 | Ga0070663_1011056641 | 84 |
| 207 | 3300005459 | Ga0068867_100915394 | Ga0068867_1009153941 | 84 |
| 208 | 3300005518 | Ga0070699_101675496 | Ga0070699_1016754961 | 84 |
| 209 | 3300005535 | Ga0070684_102088451 | Ga0070684_1020884511 | 84 |
| 210 | 3300005536 | Ga0070697_100243435 | Ga0070697_1002434351 | 84 |
| 211 | 3300005539 | Ga0068853_100000583 | Ga0068853_10000058311 | 84 |
| 212 | 3300005544 | Ga0070686_100060608 | Ga0070686_1000606084 | 84 |
| 213 | 3300005547 | Ga0070693_100289898 | Ga0070693_1002898982 | 84 |
| 214 | 3300005563 | Ga0068855_100068659 | Ga0068855_1000686595 | 84 |
| 215 | 3300005563 | Ga0068855_100249759 | Ga0068855_1002497592 | 84 |
| 216 | 3300005577 | Ga0068857_100246994 | Ga0068857_1002469943 | 84 |
| 217 | 3300005578 | Ga0068854_100193005 | Ga0068854_1001930052 | 84 |
| 218 | 3300005614 | Ga0068856_100436347 | Ga0068856_1004363472 | 84 |
| 219 | 3300005616 | Ga0068852_101663089 | Ga0068852_1016630892 | 84 |
| 220 | 3300005719 | Ga0068861_100298033 | Ga0068861_1002980331 | 84 |
| 221 | 3300005842 | Ga0068858_100557804 | Ga0068858_1005578043 | 84 |
| 222 | 3300005843 | Ga0068860_100289940 | Ga0068860_1002899403 | 84 |
| 223 | 3300009098 | Ga0105245_10647505 | Ga0105245_106475052 | 84 |
| 224 | 3300009147 | Ga0114129_13479515 | Ga0114129_134795152 | 84 |
| 225 | 3300009551 | Ga0105238_10041368 | Ga0105238_100413684 | 84 |
| 226 | 3300013297 | Ga0157378_10545658 | Ga0157378_105456583 | 84 |
| 227 | 3300014325 | Ga0163163_12011511 | Ga0163163_120115111 | 84 |
| 228 | 3300014326 | Ga0157380_10085818 | Ga0157380_100858182 | 84 |
| 229 | 3300014497 | Ga0182008_10948808 | Ga0182008_109488081 | 84 |
| 230 | 3300021377 | Ga0213874_10235329 | Ga0213874_102353291 | 84 |
| 231 | 3300021384 | Ga0213876_10028571 | Ga0213876_100285713 | 84 |
| 232 | 3300025924 | Ga0207694_10051477 | Ga0207694_100514774 | 84 |
| 233 | 3300025936 | Ga0207670_10000003 | Ga0207670_10000003370 | 84 |
| 234 | 3300025936 | Ga0207670_10304556 | Ga0207670_103045562 | 84 |
| 235 | 3300025949 | Ga0207667_10369164 | Ga0207667_103691641 | 84 |
| 236 | 3300025949 | Ga0207667_10660213 | Ga0207667_106602131 | 84 |
| 237 | 3300025981 | Ga0207640_10187380 | Ga0207640_101873802 | 84 |
| 238 | 3300026023 | Ga0207677_10431041 | Ga0207677_104310412 | 84 |
| 239 | 3300026041 | Ga0207639_10004111 | Ga0207639_100041116 | 84 |
| 240 | 3300026078 | Ga0207702_10437229 | Ga0207702_104372291 | 84 |
| 241 | 3300026116 | Ga0207674_10365481 | Ga0207674_103654812 | 84 |
| 242 | 3300026118 | Ga0207675_100359926 | Ga0207675_1003599261 | 84 |
| 243 | 3300026142 | Ga0207698_11515567 | Ga0207698_115155672 | 84 |
| 244 | 3300028381 | Ga0268264_10264574 | Ga0268264_102645743 | 84 |
| 245 | 3300028381 | Ga0268264_11084804 | Ga0268264_110848042 | 84 |
| 246 | 3300028556 | Ga0265337_1016716 | Ga0265337_10167161 | 84 |
| 247 | 3300028558 | Ga0265326_10037451 | Ga0265326_100374512 | 84 |
| 248 | 3300029957 | Ga0265324_10000073 | Ga0265324_1000007324 | 84 |
| 249 | 3300031249 | Ga0265339_10000082 | Ga0265339_1000008245 | 84 |
| 250 | 3300031712 | Ga0265342_10047659 | Ga0265342_100476592 | 84 |
| 251 | 3300039437 | Ga0436365_1880327 | Ga0436365_1880327_96_350 | 84 |
| 252 | 3300039450 | Ga0436363_1579282 | Ga0436363_1579282_2354_2608 | 84 |
| 253 | 3300039453 | Ga0436362_1172326 | Ga0436362_1172326_1001_1255 | 84 |
| 254 | 3300041486 | Ga0451807_0562759 | Ga0451807_0562759_101_358 | 84 |
| 255 | 3300041511 | Ga0451855_1148549 | Ga0451855_1148549_88_345 | 84 |
| 256 | 3300042876 | Ga0451577_1925577 | Ga0451577_1925577_128_382 | 84 |
| 257 | 3300044712 | Ga0453684_0508394 | Ga0453684_0508394_1035_1289 | 84 |
| 258 | 3300045836 | Ga0466958_0597553 | Ga0466958_0597553_330_587 | 84 |
| 259 | 3300045976 | Ga0466967_0718988 | Ga0466967_0718988_361_615 | 84 |
| 260 | 3300048917 | Ga0496114_0056113 | Ga0496114_0056113_181_438 | 84 |
| 261 | 3300049583 | Ga0501067_0209727 | Ga0501067_0209727_758_1015 | 84 |
| 262 | 3300050508 | nmdc:mga09592_987074_c1 | nmdc:mga09592_987074_c1_108_371 | 84 |
| 263 | 3300059492 | Ga0587073_0041284 | Ga0587073_0041284_361_615 | 84 |
| 264 | 3300059506 | Ga0587085_081191 | Ga0587085_081191_101_355 | 84 |
| 265 | 3300059511 | Ga0587091_069983 | Ga0587091_069983_189_443 | 84 |
| 266 | 3300059513 | Ga0587094_075640 | Ga0587094_075640_158_412 | 84 |
| 267 | 3300059644 | Ga0587075_041426 | Ga0587075_041426_197_451 | 84 |
| 268 | 3300060346 | Ga0587111_0117378 | Ga0587111_0117378_182_436 | 84 |
| 269 | 3300005455 | Ga0070663_100958700 | Ga0070663_1009587001 | 85 |
| 270 | 3300005614 | Ga0068856_100289126 | Ga0068856_1002891262 | 85 |
| 271 | 3300006237 | Ga0097621_101494669 | Ga0097621_1014946692 | 85 |
| 272 | 3300006880 | Ga0075429_100042928 | Ga0075429_1000429284 | 85 |
| 273 | 3300009098 | Ga0105245_10000009 | Ga0105245_1000000933 | 85 |
| 274 | 3300009177 | Ga0105248_11174203 | Ga0105248_111742031 | 85 |
| 275 | 3300013105 | Ga0157369_10217203 | Ga0157369_102172033 | 85 |
| 276 | 3300013296 | Ga0157374_10455575 | Ga0157374_104555752 | 85 |
| 277 | 3300013297 | Ga0157378_11322723 | Ga0157378_113227231 | 85 |
| 278 | 3300014745 | Ga0157377_11531641 | Ga0157377_115316411 | 85 |
| 279 | 3300025927 | Ga0207687_10000124 | Ga0207687_1000012430 | 85 |
| 280 | 3300025941 | Ga0207711_11265343 | Ga0207711_112653431 | 85 |
| 281 | 3300026035 | Ga0207703_12247105 | Ga0207703_122471051 | 85 |
| 282 | 3300026067 | Ga0207678_10916409 | Ga0207678_109164092 | 85 |
| 283 | 3300031711 | Ga0265314_10089629 | Ga0265314_100896292 | 85 |
| 284 | 3300047471 | Ga0495684_0980863 | Ga0495684_0980863_218_475 | 85 |
| 285 | 3300049574 | Ga0501038_1343022 | Ga0501038_1343022_83_340 | 85 |
| 286 | 3300049823 | Ga0501044_0004074 | Ga0501044_0004074_7956_8213 | 85 |
| 287 | 3300049823 | Ga0501044_0021891 | Ga0501044_0021891_400_657 | 85 |
| 288 | 3300049824 | Ga0501045_1401293 | Ga0501045_1401293_39_296 | 85 |
| 289 | 3300054114 | Ga0501084_1160867 | Ga0501084_1160867_131_388 | 85 |
| 290 | 3300005290 | Ga0065712_10069283 | Ga0065712_100692834 | 86 |
| 291 | 3300005293 | Ga0065715_10093657 | Ga0065715_100936574 | 86 |
| 292 | 3300005334 | Ga0068869_100102656 | Ga0068869_1001026562 | 86 |
| 293 | 3300005343 | Ga0070687_100131331 | Ga0070687_1001313311 | 86 |
| 294 | 3300005438 | Ga0070701_10073632 | Ga0070701_100736322 | 86 |
| 295 | 3300005545 | Ga0070695_100169774 | Ga0070695_1001697743 | 86 |
| 296 | 3300005842 | Ga0068858_101506294 | Ga0068858_1015062942 | 86 |
| 297 | 3300006237 | Ga0097621_101299519 | Ga0097621_1012995192 | 86 |
| 298 | 3300006847 | Ga0075431_100304118 | Ga0075431_1003041183 | 86 |
| 299 | 3300006852 | Ga0075433_10892269 | Ga0075433_108922692 | 86 |
| 300 | 3300006871 | Ga0075434_100177645 | Ga0075434_1001776451 | 86 |
| 301 | 3300006880 | Ga0075429_100661833 | Ga0075429_1006618332 | 86 |
| 302 | 3300006914 | Ga0075436_100264112 | Ga0075436_1002641122 | 86 |
| 303 | 3300007076 | Ga0075435_100331146 | Ga0075435_1003311462 | 86 |
| 304 | 3300013104 | Ga0157370_11507265 | Ga0157370_115072651 | 86 |
| 305 | 3300014326 | Ga0157380_12826236 | Ga0157380_128262361 | 86 |
| 306 | 3300025936 | Ga0207670_10021212 | Ga0207670_100212123 | 86 |
| 307 | 3300025942 | Ga0207689_10084914 | Ga0207689_100849144 | 86 |
| 308 | 3300025949 | Ga0207667_10961882 | Ga0207667_109618822 | 86 |
| 309 | 3300026075 | Ga0207708_10297321 | Ga0207708_102973212 | 86 |
| 310 | 3300037312 | Ga0395899_0051790 | Ga0395899_0051790_2606_2869 | 86 |
| 311 | 3300037418 | Ga0395900_0124478 | Ga0395900_0124478_600_863 | 86 |
| 312 | 3300038443 | Ga0395901_0119741 | Ga0395901_0119741_1837_2100 | 86 |
| 313 | 3300047318 | Ga0495636_0010672 | Ga0495636_0010672_1032_1310 | 86 |
| 314 | 3300048911 | Ga0496108_1334407 | Ga0496108_1334407_22_285 | 86 |
| 315 | 3300050510 | nmdc:mga06r32_119902_c1 | nmdc:mga06r32_119902_c1_987_1250 | 86 |
| 316 | 3300059492 | Ga0587073_0143869 | Ga0587073_0143869_137_400 | 86 |
| 317 | 3300059506 | Ga0587085_091276 | Ga0587085_091276_249_512 | 86 |
| 318 | 3300003308 | Ga0006777J48905_1001803 | Ga0006777J48905_10018032 | 87 |
| 319 | 3300005546 | Ga0070696_100921404 | Ga0070696_1009214042 | 87 |
| 320 | 3300005547 | Ga0070693_100568606 | Ga0070693_1005686061 | 87 |
| 321 | 3300005843 | Ga0068860_101091085 | Ga0068860_1010910851 | 87 |
| 322 | 3300005937 | Ga0081455_10047462 | Ga0081455_100474622 | 87 |
| 323 | 3300013297 | Ga0157378_11382630 | Ga0157378_113826302 | 87 |
| 324 | 3300026118 | Ga0207675_100708164 | Ga0207675_1007081642 | 87 |
| 325 | 3300031548 | Ga0307408_100063631 | Ga0307408_1000636311 | 87 |
| 326 | 3300038996 | Ga0242420_125354 | Ga0242420_125354_168_434 | 87 |
| 327 | 3300048903 | Ga0496100_1382688 | Ga0496100_1382688_62_328 | 87 |
| 328 | 3300048905 | Ga0496102_0314383 | Ga0496102_0314383_900_1166 | 87 |
| 329 | 3300048910 | Ga0496107_1093813 | Ga0496107_1093813_234_500 | 87 |
| 330 | 3300048915 | Ga0496112_1162239 | Ga0496112_1162239_303_569 | 87 |
| 331 | 3300049741 | Ga0501079_0499947 | Ga0501079_0499947_103_369 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar