F409875

General Info

Members Datasets Scaffolds Average Seq Length
329 248 304 259

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0000053|Ga0500635_0000053_42947_43798
Length 283
Sequence MSDVADRVAQARAAASPARIALELRDVRKAFGKTEIIRGASLKVNAGERVAIIGPNGAGKSTLFNLISGRFAPSSGEIVLSGARIDGAPPHRINRQGLARSFQVSNLFTHLSVFENLRCAVLWSLGYRYAFWRFLASLRDANERAEQVMGMLQLDRRRDVLAVNLTYAEQRALEIGLTIAGGADVLLLDEPTAGMSKSETRRFVQLIRSVTEGKTLLTVEHDMGVVFGLADRIAVLVYGEVIAFDTPEAVRANPRVQEAYLGSMLAQAQEAGTDGANASGGGE

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2643221660 Methylibium sp. Root1272 Isolate Unclassified
13 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
14 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
15 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
16 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
19 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
20 2858950400 Achromobacter sp. K91 Isolate Unclassified
21 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
22 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
23 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
24 2941479691
25 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
156 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
157 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
158 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
159 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
160 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
161 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
162 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
163 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
164 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
229 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
230 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
231 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
235 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.4
Metatranscriptomes 0
Isolates 7.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.59
Nodule 1.52
Rhizoplane 2.13
Rhizosphere 61.4
Stem 0
Stem Tuber 0
Unclassified 20.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000182 3300002704 Bacteria 26998
2 JGI25156J39149_1000837 3300002705 Bacteria 15529
3 JGI25156J39149_1006776 3300002705 Unclassified 3086
4 JGI25156J39149_1024503 3300002705 Bacteria 986
5 JGI25156J39149_1028481 3300002705 Bacteria 862
6 JGI25154J39366_1005792 3300002738 Bacteria 1909
7 JGI25157J39369_1000251 3300002741 Bacteria 40025
8 rootL2_10071278 3300003322 Bacteria 2530
9 JGI26128J50194_1001215 3300003347 Bacteria 1607
10 Ga0055539_1000317 3300003752 Bacteria 25090
11 Ga0055533_1000028 3300003756 Bacteria 311012
12 Ga0055533_1000057 3300003756 Bacteria 194035
13 Ga0055525_1000522 3300003759 Bacteria 18499
14 Ga0055535_1001176 3300003761 Bacteria 15121
15 Ga0055535_1010279 3300003761 Bacteria 1550
16 Ga0055529_1000331 3300003763 Bacteria 53202
17 Ga0055524_1000287 3300003775 Bacteria 48964
18 Ga0055530_10003706 3300003791 Bacteria 8509
19 Ga0055540_1000062 3300003792 Bacteria 128474
20 Ga0055540_1007824 3300003792 Bacteria 3958
21 Ga0055540_1021331 3300003792 Bacteria 1685
22 Ga0055531_10000313 3300003794 Bacteria 47791
23 Ga0055531_10003057 3300003794 Bacteria 10840
24 Ga0055531_10008030 3300003794 Bacteria 5640
25 Ga0065165_1000354 3300005262 Bacteria 75337
26 Ga0070658_10032932 3300005327 Bacteria 4167
27 Ga0070658_10049808 3300005327 Bacteria 3395
28 Ga0070658_10164305 3300005327 Bacteria 1864
29 Ga0070690_100005973 3300005330 Bacteria 6875
30 Ga0068869_100105658 3300005334 Bacteria 2136
31 Ga0070660_100065440 3300005339 Bacteria 2829
32 Ga0070660_100411923 3300005339 Bacteria 1118
33 Ga0070661_100265144 3300005344 Bacteria 1329
34 Ga0070669_100241533 3300005353 Bacteria 1435
35 Ga0070671_100014837 3300005355 Bacteria 6295
36 Ga0070667_100019838 3300005367 Bacteria 5578
37 Ga0070708_100552951 3300005445 Bacteria 1086
38 Ga0070662_100043230 3300005457 Bacteria 3222
39 Ga0068867_100423804 3300005459 Bacteria 1128
40 Ga0070679_100030188 3300005530 Bacteria 5351
41 Ga0068853_100170326 3300005539 Bacteria 1970
42 Ga0068855_100008323 3300005563 Bacteria 12537
43 Ga0068855_100068236 3300005563 Bacteria 4140
44 Ga0068857_100000422 3300005577 Bacteria 29970
45 Ga0068854_100011499 3300005578 Bacteria 5766
46 Ga0068856_100004817 3300005614 Bacteria 13375
47 Ga0068861_100043196 3300005719 Bacteria 3381
48 Ga0068858_100005188 3300005842 Bacteria 12760
49 Ga0075370_10018353 3300006353 Bacteria 3796
50 Ga0099824_1036877 3300006942 Bacteria 1391
51 Ga0099823_1007351 3300006944 Bacteria 11174
52 Ga0079104_1000019 3300006946 Bacteria 269313
53 Ga0105240_10001089 3300009093 Bacteria 47935
54 Ga0105240_10086001 3300009093 Bacteria 3851
55 Ga0105240_10653362 3300009093 Bacteria 1152
56 Ga0105243_10076147 3300009148 Bacteria 2725
57 Ga0105243_10306991 3300009148 Bacteria 1440
58 Ga0105241_10066055 3300009174 Bacteria 2796
59 Ga0105242_10164372 3300009176 Bacteria 1945
60 Ga0105248_10021294 3300009177 Bacteria 7185
61 Ga0105248_10243128 3300009177 Bacteria 2026
62 Ga0105237_10325595 3300009545 Bacteria 1541
63 Ga0105238_10088694 3300009551 Bacteria 3079
64 Ga0105249_10338226 3300009553 Bacteria 1521
65 Ga0105239_10027021 3300010375 Bacteria 6317
66 Ga0163163_10540092 3300014325 Bacteria 1228
67 Ga0157379_10004321 3300014968 Bacteria 12157
68 Ga0213872_10027005 3300021361 Bacteria 2637
69 Ga0209674_100007 3300025226 Bacteria 1077082
70 Ga0209563_100033 3300025230 Bacteria 457883
71 Ga0207427_101232 3300025231 Bacteria 9812
72 Ga0209258_100353 3300025242 Bacteria 63996
73 Ga0209258_100475 3300025242 Bacteria 42279
74 Ga0209258_107176 3300025242 Bacteria 1677
75 Ga0209646_1000053 3300025246 Bacteria 284737
76 Ga0209026_1000020 3300025250 Bacteria 376211
77 Ga0209677_100132 3300025253 Bacteria 72060
78 Ga0209677_100161 3300025253 Bacteria 59768
79 Ga0209677_104352 3300025253 Bacteria 4126
80 Ga0209148_1009771 3300025254 Bacteria 1849
81 Ga0209759_1000017 3300025256 Bacteria 376232
82 Ga0209759_1000913 3300025256 Bacteria 21908
83 Ga0209759_1001199 3300025256 Bacteria 16128
84 Ga0209759_1002284 3300025256 Bacteria 8656
85 Ga0209759_1008311 3300025256 Bacteria 3247
86 Ga0209565_1017960 3300025263 Bacteria 1538
87 Ga0209455_1000136 3300025272 Bacteria 146375
88 Ga0209564_1000003 3300025295 Bacteria 1585848
89 Ga0209050_1000703 3300025298 Bacteria 49694
90 Ga0209050_1001330 3300025298 Bacteria 27524
91 Ga0209050_1006175 3300025298 Bacteria 7204
92 Ga0209256_1000024 3300025299 Bacteria 448909
93 Ga0209256_1002204 3300025299 Bacteria 16682
94 Ga0209051_1000063 3300025303 Bacteria 249739
95 Ga0209051_1001500 3300025303 Bacteria 19504
96 Ga0209051_1006198 3300025303 Bacteria 6780
97 Ga0209051_1006392 3300025303 Bacteria 6651
98 Ga0209257_1000021 3300025304 Bacteria 771986
99 Ga0209257_1000118 3300025304 Bacteria 225963
100 Ga0209257_1002930 3300025304 Bacteria 15721
101 Ga0207645_10088274 3300025907 Bacteria 1993
102 Ga0207705_10044625 3300025909 Bacteria 3186
103 Ga0207705_10125539 3300025909 Bacteria 1907
104 Ga0207705_10266604 3300025909 Bacteria 1309
105 Ga0207695_10060918 3300025913 Bacteria 3903
106 Ga0207695_10110219 3300025913 Bacteria 2733
107 Ga0207695_10122989 3300025913 Bacteria 2561
108 Ga0207695_10468010 3300025913 Bacteria 1143
109 Ga0207663_10167349 3300025916 Bacteria 1558
110 Ga0207657_10065219 3300025919 Bacteria 3105
111 Ga0207652_10046817 3300025921 Bacteria 3692
112 Ga0207694_10653421 3300025924 Bacteria 886
113 Ga0207664_10265981 3300025929 Unclassified 1501
114 Ga0207706_10057232 3300025933 Bacteria 3436
115 Ga0207709_10195704 3300025935 Bacteria 1440
116 Ga0207711_10040300 3300025941 Bacteria 3974
117 Ga0207711_10054982 3300025941 Bacteria 3417
118 Ga0207689_10119528 3300025942 Bacteria 2168
119 Ga0207661_10082171 3300025944 Bacteria 2663
120 Ga0207667_10010190 3300025949 Bacteria 11008
121 Ga0207667_10025000 3300025949 Bacteria 6547
122 Ga0207667_10031191 3300025949 Bacteria 5756
123 Ga0207667_10415291 3300025949 Bacteria 1369
124 Ga0207651_10616432 3300025960 Bacteria 950
125 Ga0207640_10017383 3300025981 Bacteria 4207
126 Ga0207703_10008958 3300026035 Bacteria 7884
127 Ga0207639_10204495 3300026041 Bacteria 1696
128 Ga0207639_10441724 3300026041 Bacteria 1180
129 Ga0207702_10002918 3300026078 Bacteria 16003
130 Ga0207648_10188918 3300026089 Bacteria 1825
131 Ga0207674_10001725 3300026116 Bacteria 27953
132 Ga0207675_100032377 3300026118 Bacteria 4869
133 Ga0209281_1000149 3300027111 Bacteria 167880
134 Ga0209389_1010627 3300027296 Bacteria 8307
135 Ga0209968_1000125 3300027526 Bacteria 13613
136 Ga0209966_1000014 3300027695 Bacteria 81913
137 Ga0265336_10000012 3300028666 Bacteria 261478
138 Ga0307517_10040548 3300028786 Bacteria 5065
139 Ga0307515_10031735 3300028794 Bacteria 8785
140 Ga0307515_10135081 3300028794 Bacteria 2688
141 Ga0307515_10180261 3300028794 Bacteria 2065
142 Ga0265324_10001037 3300029957 Bacteria 17052
143 Ga0307511_10062563 3300030521 Bacteria 2823
144 Ga0265328_10006476 3300031239 Bacteria 4954
145 Ga0265331_10001854 3300031250 Bacteria 14925
146 Ga0265327_10000309 3300031251 Bacteria 94387
147 Ga0307408_100000008 3300031548 Bacteria 456355
148 Ga0307514_10001730 3300031649 Bacteria 25002
149 Ga0307516_10003586 3300031730 Bacteria 19792
150 Ga0307516_10256989 3300031730 Bacteria 1439
151 Ga0307405_10064548 3300031731 Bacteria 2328
152 Ga0307412_10000512 3300031911 Bacteria 23134
153 Ga0307411_10002251 3300032005 Bacteria 8429
154 Ga0373959_0005627 3300034820 Bacteria 2058
155 Ga0373949_0016668 3300035090 Bacteria 1648
156 Ga0373923_0021198 3300035111 Bacteria 2534
157 Ga0373939_0000008 3300035114 Bacteria 77597
158 Ga0373954_0230487 3300035118 Bacteria 911
159 Ga0373960_0017521 3300035121 Bacteria 1857
160 Ga0373943_0047569 3300035170 Bacteria 2098
161 Ga0373961_0032476 3300035241 Bacteria 1464
162 Ga0373924_0016924 3300035410 Bacteria 2789
163 Ga0373931_0000533 3300035691 Bacteria 15615
164 Ga0373933_0027220 3300035724 Bacteria 3290
165 Ga0373947_0202945 3300035725 Bacteria 1298
166 Ga0373937_0000868 3300036401 Bacteria 26006
167 Ga0373937_0021374 3300036401 Bacteria 5808
168 Ga0373925_0024457 3300037068 Bacteria 4410
169 Ga0373925_0162198 3300037068 Bacteria 1761
170 Ga0395898_0008097 3300037466 Bacteria 11127
171 Ga0395898_0263189 3300037466 Bacteria 1645
172 Ga0395905_0002029 3300037471 Bacteria 23136
173 Ga0395905_0017190 3300037471 Bacteria 6870
174 Ga0395905_0136483 3300037471 Bacteria 2308
175 Ga0395901_0181036 3300038443 Bacteria 2210
176 Ga0237816_02393 3300039145 Bacteria 1443
177 Ga0436361_0026531 3300039447 Bacteria 11861
178 Ga0436361_0570177 3300039447 Bacteria 2909
179 Ga0451791_0633674 3300041451 Bacteria 1146
180 Ga0451798_1032401 3300041458 Bacteria 1704
181 Ga0451853_3088666 3300041512 Bacteria 1532
182 Ga0439431_0028351 3300041997 Bacteria 1379
183 Ga0450911_001627 3300042115 Bacteria 5005
184 Ga0450917_001487 3300042120 Bacteria 1685
185 Ga0450888_000345 3300042126 Bacteria 4365
186 Ga0450890_000453 3300042127 Bacteria 5991
187 Ga0450891_001892 3300042129 Bacteria 2144
188 Ga0450892_000938 3300042130 Bacteria 3142
189 Ga0450902_020831 3300042137 Bacteria 1082
190 Ga0450903_012692 3300042138 Bacteria 1344
191 Ga0450889_000368 3300042144 Bacteria 5007
192 Ga0450893_0016915 3300042532 Bacteria 1237
193 Ga0466969_0000002 3300044656 Bacteria 178693
194 Ga0466969_0007089 3300044656 Bacteria 5964
195 Ga0466969_0066287 3300044656 Bacteria 1743
196 Ga0466972_0026071 3300044658 Bacteria 2895
197 Ga0466965_0086906 3300044683 Bacteria 1586
198 Ga0466966_0005727 3300044684 Bacteria 8181
199 Ga0466966_0037485 3300044684 Bacteria 3127
200 Ga0466966_0063266 3300044684 Bacteria 2332
201 Ga0466963_0082950 3300044694 Bacteria 2174
202 Ga0466964_0012661 3300044706 Bacteria 3194
203 Ga0453684_0418944 3300044712 Bacteria 1496
204 Ga0466971_0092622 3300044719 Bacteria 1384
205 Ga0466968_0069379 3300044735 Bacteria 1532
206 Ga0466970_0038173 3300044765 Bacteria 2547
207 Ga0466970_0091955 3300044765 Bacteria 1647
208 Ga0466957_0001959 3300044842 Bacteria 10945
209 Ga0466957_0106179 3300044842 Bacteria 1776
210 Ga0466960_0173715 3300044901 Bacteria 1164
211 Ga0466959_0003830 3300045049 Bacteria 9978
212 Ga0466959_0110897 3300045049 Bacteria 1958
213 Ga0466959_0156731 3300045049 Bacteria 1602
214 Ga0451576_0013050 3300045051 Bacteria 9306
215 Ga0451576_0034648 3300045051 Bacteria 5361
216 Ga0466958_0120293 3300045836 Bacteria 1643
217 Ga0466967_0072378 3300045976 Bacteria 3089
218 Ga0466967_0454967 3300045976 Bacteria 1251
219 Ga0495651_0047516 3300046462 Bacteria 3318
220 Ga0495653_0059773 3300046463 Bacteria 2891
221 Ga0495653_0114150 3300046463 Bacteria 1936
222 Ga0495650_0008300 3300046471 Bacteria 6083
223 Ga0495583_0000017 3300046506 Bacteria 310888
224 Ga0495608_0102997 3300046511 Bacteria 1839
225 Ga0495608_0226875 3300046511 Bacteria 1170
226 Ga0495637_0004153 3300046520 Bacteria 7535
227 Ga0495645_0094546 3300046543 Bacteria 2132
228 Ga0495633_0077588 3300046558 Bacteria 1547
229 Ga0495667_0020985 3300046559 Bacteria 4406
230 Ga0495659_0026114 3300046664 Bacteria 2004
231 Ga0495599_0205748 3300046678 Bacteria 1208
232 Ga0495613_0000194 3300046689 Bacteria 59997
233 Ga0495649_0000151 3300046694 Bacteria 60742
234 Ga0495589_0007070 3300046794 Bacteria 5886
235 Ga0495600_0065357 3300046809 Bacteria 2378
236 Ga0495680_0065158 3300047322 Bacteria 2791
237 Ga0495683_0051306 3300047323 Bacteria 2063
238 Ga0495681_0000235 3300047470 Bacteria 45882
239 Ga0495602_0250382 3300048088 Bacteria 1320
240 Ga0495626_0001523 3300048091 Bacteria 18212
241 Ga0496102_0001573 3300048905 Bacteria 20139
242 Ga0496104_0255500 3300048907 Bacteria 1665
243 Ga0496112_0071329 3300048915 Bacteria 3433
244 Ga0496114_0001821 3300048917 Bacteria 16167
245 Ga0496116_0014717 3300048919 Bacteria 6232
246 Ga0496116_0158307 3300048919 Bacteria 1246
247 Ga0496117_0020810 3300048920 Bacteria 5338
248 Ga0496118_0019252 3300048921 Bacteria 6110
249 Ga0496118_0037960 3300048921 Bacteria 3867
250 Ga0496119_0005139 3300048922 Bacteria 12674
251 Ga0496120_0002371 3300048923 Bacteria 19229
252 Ga0496121_0000153 3300048924 Bacteria 150635
253 Ga0496122_0005806 3300048925 Bacteria 14506
254 Ga0496123_0001621 3300048926 Bacteria 30304
255 Ga0496123_0184284 3300048926 Bacteria 1086
256 Ga0496124_0116572 3300048927 Bacteria 2141
257 Ga0496125_0002020 3300048928 Bacteria 27488
258 Ga0496125_0007916 3300048928 Bacteria 11221
259 Ga0496125_0027324 3300048928 Bacteria 5176
260 Ga0496125_0035119 3300048928 Bacteria 4405
261 Ga0496126_0000674 3300048929 Bacteria 63031
262 Ga0496126_0004010 3300048929 Bacteria 17942
263 Ga0496126_0061983 3300048929 Bacteria 3357
264 Ga0496126_0097932 3300048929 Bacteria 2570
265 Ga0501031_0117428 3300049568 Bacteria 1738
266 Ga0501031_0137856 3300049568 Bacteria 1594
267 Ga0501032_0000911 3300049569 Bacteria 23935
268 Ga0501033_0000719 3300049570 Bacteria 30348
269 Ga0501037_0000007 3300049573 Bacteria 215187
270 Ga0501038_0253434 3300049574 Bacteria 1393
271 Ga0501043_0000061 3300049579 Bacteria 97512
272 Ga0501043_0359418 3300049579 Bacteria 1105
273 Ga0501047_0176213 3300049581 Bacteria 2005
274 Ga0501067_0032719 3300049583 Bacteria 2886
275 Ga0501069_0000050 3300049585 Bacteria 71263
276 Ga0501070_0000454 3300049586 Bacteria 37270
277 Ga0501071_0012231 3300049587 Bacteria 5813
278 Ga0501074_0000052 3300049590 Bacteria 56238
279 Ga0501207_003074 3300049654 Bacteria 2195
280 Ga0501253_005083 3300049683 Bacteria 1701
281 Ga0501258_001436 3300049687 Bacteria 1948
282 Ga0501229_000147 3300049706 Bacteria 7305
283 Ga0501080_0017953 3300049742 Bacteria 6548
284 Ga0501080_0023567 3300049742 Bacteria 5704
285 Ga0501083_0000469 3300049744 Bacteria 25915
286 Ga0501262_001215 3300049759 Bacteria 2915
287 Ga0501274_000800 3300049771 Bacteria 2316
288 Ga0501035_0001792 3300049822 Bacteria 21700
289 Ga0501035_0224087 3300049822 Bacteria 1604
290 Ga0501044_0000156 3300049823 Bacteria 84220
291 Ga0501044_0084798 3300049823 Bacteria 3201
292 Ga0501044_0241711 3300049823 Bacteria 1749
293 Ga0501044_0483064 3300049823 Bacteria 1142
294 nmdc:mga0k408_187592_c1 3300050493 Bacteria 1233
295 nmdc:mga07m45_17914_c1 3300050496 Bacteria 3812
296 Ga0500635_0000053 3300053080 Bacteria 74604
297 Ga0495595_0007398 3300053084 Bacteria 4496
298 Ga0495619_0046784 3300053085 Bacteria 2846
299 Ga0495619_0203955 3300053085 Bacteria 1369
300 Ga0500578_0203658 3300053086 Bacteria 1210
301 Ga0500559_0008644 3300053136 Bacteria 4452
302 Ga0500661_016508 3300055283 Bacteria 1320
303 Ga0501082_0016441 3300060353 Bacteria 6368
304 Ga0466962_0038791 3300061719 Bacteria 2281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100030188 Ga0070679_1000301883 234
2 3300009093 Ga0105240_10001089 Ga0105240_1000108924 234
3 3300025913 Ga0207695_10122989 Ga0207695_101229892 234
4 3300025921 Ga0207652_10046817 Ga0207652_100468172 234
5 3300025949 Ga0207667_10025000 Ga0207667_100250003 234
6 3300028794 Ga0307515_10135081 Ga0307515_101350812 236
7 3300041512 Ga0451853_3088666 Ga0451853_3088666_396_1148 244
8 3300046520 Ga0495637_0004153 Ga0495637_0004153_1828_2592 244
9 3300046664 Ga0495659_0026114 Ga0495659_0026114_388_1128 245
10 iso_pu_bacteria 2534681786 2535486027 246
11 iso_pu_bacteria 2599185292 2599905914 246
12 iso_pu_bacteria 2643221569 2643859098 246
13 iso_pu_bacteria 2643221594 2643980072 246
14 iso_pu_bacteria 2643221621 2644122967 246
15 iso_pu_bacteria 2643221639 2644217624 246
16 iso_pu_bacteria 2643221646 2644258641 246
17 iso_pu_bacteria 2808606395 2809033796 246
18 iso_pu_bacteria 2858950400 2858954558 246
19 iso_pu_bacteria 2941479691 2941484908 246
20 iso_pu_bacteria 2619619299 2621297417 247
21 iso_pu_bacteria 2738541265 2738672858 247
22 iso_pu_bacteria 2738541282 2738751251 247
23 iso_pu_bacteria 2738541303 2738860292 247
24 iso_pu_bacteria 2816332298 2817493475 247
25 iso_pu_bacteria 8048746797 8048749894 247
26 iso_pu_bacteria 2643221544 2643742757 248
27 iso_pu_bacteria 2738541337 2739056662 249
28 3300003792 Ga0055540_1007824 Ga0055540_10078243 250
29 3300003792 Ga0055540_1021331 Ga0055540_10213312 250
30 3300003794 Ga0055531_10000313 Ga0055531_1000031319 250
31 3300005367 Ga0070667_100019838 Ga0070667_1000198385 250
32 3300005457 Ga0070662_100043230 Ga0070662_1000432301 250
33 3300005842 Ga0068858_100005188 Ga0068858_1000051889 250
34 3300009148 Ga0105243_10306991 Ga0105243_103069912 250
35 3300009177 Ga0105248_10243128 Ga0105248_102431282 250
36 3300014968 Ga0157379_10004321 Ga0157379_100043213 250
37 3300025298 Ga0209050_1006175 Ga0209050_10061757 250
38 3300025303 Ga0209051_1001500 Ga0209051_100150012 250
39 3300025304 Ga0209257_1000021 Ga0209257_1000021425 250
40 3300025933 Ga0207706_10057232 Ga0207706_100572322 250
41 3300025935 Ga0207709_10195704 Ga0207709_101957042 250
42 3300025941 Ga0207711_10040300 Ga0207711_100403002 250
43 3300025960 Ga0207651_10616432 Ga0207651_106164322 250
44 3300026035 Ga0207703_10008958 Ga0207703_100089583 250
45 3300028794 Ga0307515_10180261 Ga0307515_101802612 250
46 3300031239 Ga0265328_10006476 Ga0265328_100064764 250
47 3300031250 Ga0265331_10001854 Ga0265331_1000185413 250
48 3300031251 Ga0265327_10000309 Ga0265327_1000030987 250
49 3300031911 Ga0307412_10000512 Ga0307412_1000051215 250
50 3300035111 Ga0373923_0021198 Ga0373923_0021198_1392_2144 250
51 3300035118 Ga0373954_0230487 Ga0373954_0230487_118_870 250
52 3300035170 Ga0373943_0047569 Ga0373943_0047569_444_1196 250
53 3300035410 Ga0373924_0016924 Ga0373924_0016924_1717_2469 250
54 3300035724 Ga0373933_0027220 Ga0373933_0027220_482_1234 250
55 3300035725 Ga0373947_0202945 Ga0373947_0202945_390_1142 250
56 3300036401 Ga0373937_0021374 Ga0373937_0021374_2923_3675 250
57 3300037068 Ga0373925_0162198 Ga0373925_0162198_388_1140 250
58 3300037471 Ga0395905_0002029 Ga0395905_0002029_6035_6805 250
59 3300037471 Ga0395905_0136483 Ga0395905_0136483_791_1579 250
60 3300039145 Ga0237816_02393 Ga0237816_02393_213_965 250
61 3300044658 Ga0466972_0026071 Ga0466972_0026071_667_1443 250
62 3300046463 Ga0495653_0059773 Ga0495653_0059773_726_1478 250
63 3300046511 Ga0495608_0102997 Ga0495608_0102997_1046_1798 250
64 3300046559 Ga0495667_0020985 Ga0495667_0020985_3147_3899 250
65 3300046678 Ga0495599_0205748 Ga0495599_0205748_422_1174 250
66 3300046809 Ga0495600_0065357 Ga0495600_0065357_869_1621 250
67 3300048088 Ga0495602_0250382 Ga0495602_0250382_465_1217 250
68 3300048919 Ga0496116_0014717 Ga0496116_0014717_1089_1841 250
69 3300048919 Ga0496116_0158307 Ga0496116_0158307_272_1024 250
70 3300048920 Ga0496117_0020810 Ga0496117_0020810_3149_3901 250
71 3300048921 Ga0496118_0019252 Ga0496118_0019252_1373_2125 250
72 3300048921 Ga0496118_0037960 Ga0496118_0037960_2908_3660 250
73 3300048922 Ga0496119_0005139 Ga0496119_0005139_11700_12452 250
74 3300048923 Ga0496120_0002371 Ga0496120_0002371_13695_14447 250
75 3300048924 Ga0496121_0000153 Ga0496121_0000153_37526_38278 250
76 3300048925 Ga0496122_0005806 Ga0496122_0005806_1662_2414 250
77 3300048926 Ga0496123_0001621 Ga0496123_0001621_19667_20419 250
78 3300048926 Ga0496123_0184284 Ga0496123_0184284_288_1040 250
79 3300048928 Ga0496125_0002020 Ga0496125_0002020_18826_19578 250
80 3300048928 Ga0496125_0035119 Ga0496125_0035119_1577_2329 250
81 3300048929 Ga0496126_0004010 Ga0496126_0004010_3107_3859 250
82 3300048929 Ga0496126_0061983 Ga0496126_0061983_1720_2472 250
83 3300049823 Ga0501044_0483064 Ga0501044_0483064_123_875 250
84 3300053084 Ga0495595_0007398 Ga0495595_0007398_3584_4336 250
85 3300053085 Ga0495619_0046784 Ga0495619_0046784_1219_1971 250
86 iso_pu_bacteria 2643221660 2644337939 250
87 3300003347 JGI26128J50194_1001215 JGI26128J50194_10012152 251
88 3300005445 Ga0070708_100552951 Ga0070708_1005529511 251
89 3300025916 Ga0207663_10167349 Ga0207663_101673491 251
90 3300027526 Ga0209968_1000125 Ga0209968_100012512 251
91 3300027695 Ga0209966_1000014 Ga0209966_100001423 251
92 3300031730 Ga0307516_10256989 Ga0307516_102569892 251
93 3300036401 Ga0373937_0000868 Ga0373937_0000868_21151_21906 251
94 3300037068 Ga0373925_0024457 Ga0373925_0024457_3561_4316 251
95 3300037466 Ga0395898_0263189 Ga0395898_0263189_647_1402 251
96 3300042532 Ga0450893_0016915 Ga0450893_0016915_50_823 251
97 3300046462 Ga0495651_0047516 Ga0495651_0047516_929_1684 251
98 3300046463 Ga0495653_0114150 Ga0495653_0114150_437_1192 251
99 3300046543 Ga0495645_0094546 Ga0495645_0094546_769_1524 251
100 3300046558 Ga0495633_0077588 Ga0495633_0077588_482_1237 251
101 3300046689 Ga0495613_0000194 Ga0495613_0000194_43252_44007 251
102 3300047322 Ga0495680_0065158 Ga0495680_0065158_1308_2063 251
103 3300047470 Ga0495681_0000235 Ga0495681_0000235_12620_13375 251
104 3300048907 Ga0496104_0255500 Ga0496104_0255500_680_1444 251
105 3300048929 Ga0496126_0000674 Ga0496126_0000674_39217_39972 251
106 3300049823 Ga0501044_0241711 Ga0501044_0241711_181_936 251
107 3300053085 Ga0495619_0203955 Ga0495619_0203955_585_1340 251
108 iso_pu_bacteria 2643221585 2643933397 251
109 iso_pu_bacteria 2643221656 2644314646 251
110 iso_pu_bacteria 2919046199 2919047204 251
111 3300003794 Ga0055531_10003057 Ga0055531_100030577 252
112 3300005459 Ga0068867_100423804 Ga0068867_1004238041 252
113 3300006942 Ga0099824_1036877 Ga0099824_10368771 252
114 3300006944 Ga0099823_1007351 Ga0099823_10073517 252
115 3300009148 Ga0105243_10076147 Ga0105243_100761473 252
116 3300025242 Ga0209258_107176 Ga0209258_1071762 252
117 3300025298 Ga0209050_1001330 Ga0209050_100133021 252
118 3300025299 Ga0209256_1002204 Ga0209256_10022046 252
119 3300025303 Ga0209051_1006198 Ga0209051_10061986 252
120 3300025303 Ga0209051_1006392 Ga0209051_10063923 252
121 3300025304 Ga0209257_1002930 Ga0209257_100293010 252
122 3300026089 Ga0207648_10188918 Ga0207648_101889182 252
123 3300027296 Ga0209389_1010627 Ga0209389_10106273 252
124 3300028794 Ga0307515_10031735 Ga0307515_100317354 252
125 3300031548 Ga0307408_100000008 Ga0307408_100000008146 252
126 3300032005 Ga0307411_10002251 Ga0307411_100022517 252
127 3300035090 Ga0373949_0016668 Ga0373949_0016668_159_926 252
128 3300035114 Ga0373939_0000008 Ga0373939_0000008_71360_72127 252
129 3300035121 Ga0373960_0017521 Ga0373960_0017521_562_1329 252
130 3300035241 Ga0373961_0032476 Ga0373961_0032476_352_1119 252
131 3300035691 Ga0373931_0000533 Ga0373931_0000533_3097_3864 252
132 3300041997 Ga0439431_0028351 Ga0439431_0028351_391_1167 252
133 3300042120 Ga0450917_001487 Ga0450917_001487_405_1181 252
134 3300042126 Ga0450888_000345 Ga0450888_000345_380_1156 252
135 3300042127 Ga0450890_000453 Ga0450890_000453_1197_1973 252
136 3300042129 Ga0450891_001892 Ga0450891_001892_1315_2091 252
137 3300042130 Ga0450892_000938 Ga0450892_000938_525_1301 252
138 3300042137 Ga0450902_020831 Ga0450902_020831_59_835 252
139 3300042138 Ga0450903_012692 Ga0450903_012692_187_963 252
140 3300042144 Ga0450889_000368 Ga0450889_000368_501_1277 252
141 3300044656 Ga0466969_0066287 Ga0466969_0066287_65_847 252
142 3300044683 Ga0466965_0086906 Ga0466965_0086906_734_1516 252
143 3300044706 Ga0466964_0012661 Ga0466964_0012661_2204_2986 252
144 3300044712 Ga0453684_0418944 Ga0453684_0418944_46_804 252
145 3300044719 Ga0466971_0092622 Ga0466971_0092622_145_927 252
146 3300044735 Ga0466968_0069379 Ga0466968_0069379_100_882 252
147 3300044765 Ga0466970_0091955 Ga0466970_0091955_704_1486 252
148 3300044842 Ga0466957_0001959 Ga0466957_0001959_7613_8395 252
149 3300044901 Ga0466960_0173715 Ga0466960_0173715_376_1152 252
150 3300045049 Ga0466959_0003830 Ga0466959_0003830_5341_6123 252
151 3300045051 Ga0451576_0013050 Ga0451576_0013050_3012_3779 252
152 3300045836 Ga0466958_0120293 Ga0466958_0120293_114_896 252
153 3300045976 Ga0466967_0072378 Ga0466967_0072378_1591_2373 252
154 3300048927 Ga0496124_0116572 Ga0496124_0116572_1182_1964 252
155 3300049568 Ga0501031_0137856 Ga0501031_0137856_277_1035 252
156 3300049569 Ga0501032_0000911 Ga0501032_0000911_23019_23777 252
157 3300049570 Ga0501033_0000719 Ga0501033_0000719_2241_2999 252
158 3300049573 Ga0501037_0000007 Ga0501037_0000007_153634_154392 252
159 3300049574 Ga0501038_0253434 Ga0501038_0253434_97_855 252
160 3300049579 Ga0501043_0000061 Ga0501043_0000061_60997_61755 252
161 3300049581 Ga0501047_0176213 Ga0501047_0176213_417_1175 252
162 3300049583 Ga0501067_0032719 Ga0501067_0032719_1824_2582 252
163 3300049585 Ga0501069_0000050 Ga0501069_0000050_19170_19928 252
164 3300049586 Ga0501070_0000454 Ga0501070_0000454_5067_5825 252
165 3300049587 Ga0501071_0012231 Ga0501071_0012231_300_1058 252
166 3300049590 Ga0501074_0000052 Ga0501074_0000052_32761_33519 252
167 3300049654 Ga0501207_003074 Ga0501207_003074_1377_2150 252
168 3300049683 Ga0501253_005083 Ga0501253_005083_659_1432 252
169 3300049687 Ga0501258_001436 Ga0501258_001436_558_1331 252
170 3300049706 Ga0501229_000147 Ga0501229_000147_4528_5301 252
171 3300049742 Ga0501080_0017953 Ga0501080_0017953_2043_2801 252
172 3300049744 Ga0501083_0000469 Ga0501083_0000469_9944_10702 252
173 3300049759 Ga0501262_001215 Ga0501262_001215_706_1479 252
174 3300049771 Ga0501274_000800 Ga0501274_000800_209_982 252
175 3300049822 Ga0501035_0001792 Ga0501035_0001792_18837_19595 252
176 3300049822 Ga0501035_0224087 Ga0501035_0224087_232_990 252
177 3300049823 Ga0501044_0000156 Ga0501044_0000156_51336_52094 252
178 3300049823 Ga0501044_0084798 Ga0501044_0084798_836_1594 252
179 3300060353 Ga0501082_0016441 Ga0501082_0016441_367_1125 252
180 3300061719 Ga0466962_0038791 Ga0466962_0038791_1256_2038 252
181 3300005262 Ga0065165_1000354 Ga0065165_100035444 253
182 3300031730 Ga0307516_10003586 Ga0307516_1000358612 253
183 3300041451 Ga0451791_0633674 Ga0451791_0633674_198_971 253
184 3300041458 Ga0451798_1032401 Ga0451798_1032401_75_848 253
185 3300044656 Ga0466969_0007089 Ga0466969_0007089_4249_5043 253
186 3300044684 Ga0466966_0063266 Ga0466966_0063266_742_1536 253
187 3300044765 Ga0466970_0038173 Ga0466970_0038173_1291_2085 253
188 3300045049 Ga0466959_0156731 Ga0466959_0156731_571_1365 253
189 3300005353 Ga0070669_100241533 Ga0070669_1002415332 254
190 3300006353 Ga0075370_10018353 Ga0075370_100183532 254
191 3300009553 Ga0105249_10338226 Ga0105249_103382262 254
192 3300025907 Ga0207645_10088274 Ga0207645_100882742 254
193 3300025929 Ga0207664_10265981 Ga0207664_102659812 254
194 3300028786 Ga0307517_10040548 Ga0307517_100405484 254
195 3300037471 Ga0395905_0017190 Ga0395905_0017190_2069_2857 254
196 3300044656 Ga0466969_0000002 Ga0466969_0000002_41536_42300 254
197 3300044684 Ga0466966_0005727 Ga0466966_0005727_3820_4584 254
198 3300044684 Ga0466966_0037485 Ga0466966_0037485_1608_2372 254
199 3300044842 Ga0466957_0106179 Ga0466957_0106179_54_842 254
200 3300045049 Ga0466959_0110897 Ga0466959_0110897_679_1443 254
201 3300045976 Ga0466967_0454967 Ga0466967_0454967_23_811 254
202 3300048091 Ga0495626_0001523 Ga0495626_0001523_14325_15089 254
203 3300049579 Ga0501043_0359418 Ga0501043_0359418_60_824 254
204 3300049742 Ga0501080_0023567 Ga0501080_0023567_2084_2848 254
205 3300050493 nmdc:mga0k408_187592_c1 nmdc:mga0k408_187592_c1_156_929 254
206 3300050496 nmdc:mga07m45_17914_c1 nmdc:mga07m45_17914_c1_2873_3646 254
207 iso_pu_bacteria 2738541317 2738944943 254
208 iso_pu_bacteria 2913308742 2913309567 254
209 3300002704 JGI25155J39150_1000182 JGI25155J39150_100018214 255
210 3300002705 JGI25156J39149_1000837 JGI25156J39149_10008378 255
211 3300002705 JGI25156J39149_1006776 JGI25156J39149_10067763 255
212 3300002705 JGI25156J39149_1024503 JGI25156J39149_10245031 255
213 3300002705 JGI25156J39149_1028481 JGI25156J39149_10284811 255
214 3300002738 JGI25154J39366_1005792 JGI25154J39366_10057921 255
215 3300002741 JGI25157J39369_1000251 JGI25157J39369_100025111 255
216 3300003322 rootL2_10071278 rootL2_100712782 255
217 3300003752 Ga0055539_1000317 Ga0055539_100031717 255
218 3300003756 Ga0055533_1000028 Ga0055533_1000028228 255
219 3300003756 Ga0055533_1000057 Ga0055533_100005783 255
220 3300003759 Ga0055525_1000522 Ga0055525_10005225 255
221 3300003761 Ga0055535_1001176 Ga0055535_10011768 255
222 3300003761 Ga0055535_1010279 Ga0055535_10102792 255
223 3300003763 Ga0055529_1000331 Ga0055529_10003319 255
224 3300003775 Ga0055524_1000287 Ga0055524_100028727 255
225 3300003791 Ga0055530_10003706 Ga0055530_100037066 255
226 3300003792 Ga0055540_1000062 Ga0055540_1000062114 255
227 3300003794 Ga0055531_10008030 Ga0055531_100080303 255
228 3300005327 Ga0070658_10032932 Ga0070658_100329323 255
229 3300005327 Ga0070658_10049808 Ga0070658_100498082 255
230 3300005327 Ga0070658_10164305 Ga0070658_101643052 255
231 3300005330 Ga0070690_100005973 Ga0070690_1000059731 255
232 3300005334 Ga0068869_100105658 Ga0068869_1001056582 255
233 3300005339 Ga0070660_100065440 Ga0070660_1000654402 255
234 3300005339 Ga0070660_100411923 Ga0070660_1004119232 255
235 3300005344 Ga0070661_100265144 Ga0070661_1002651442 255
236 3300005355 Ga0070671_100014837 Ga0070671_1000148373 255
237 3300005539 Ga0068853_100170326 Ga0068853_1001703262 255
238 3300005563 Ga0068855_100008323 Ga0068855_1000083235 255
239 3300005563 Ga0068855_100068236 Ga0068855_1000682364 255
240 3300005577 Ga0068857_100000422 Ga0068857_10000042220 255
241 3300005578 Ga0068854_100011499 Ga0068854_1000114994 255
242 3300005614 Ga0068856_100004817 Ga0068856_1000048172 255
243 3300005719 Ga0068861_100043196 Ga0068861_1000431962 255
244 3300006946 Ga0079104_1000019 Ga0079104_1000019194 255
245 3300009093 Ga0105240_10086001 Ga0105240_100860014 255
246 3300009093 Ga0105240_10653362 Ga0105240_106533622 255
247 3300009174 Ga0105241_10066055 Ga0105241_100660552 255
248 3300009176 Ga0105242_10164372 Ga0105242_101643722 255
249 3300009177 Ga0105248_10021294 Ga0105248_100212942 255
250 3300009545 Ga0105237_10325595 Ga0105237_103255952 255
251 3300009551 Ga0105238_10088694 Ga0105238_100886943 255
252 3300010375 Ga0105239_10027021 Ga0105239_100270214 255
253 3300014325 Ga0163163_10540092 Ga0163163_105400922 255
254 3300021361 Ga0213872_10027005 Ga0213872_100270052 255
255 3300025226 Ga0209674_100007 Ga0209674_100007815 255
256 3300025230 Ga0209563_100033 Ga0209563_100033225 255
257 3300025231 Ga0207427_101232 Ga0207427_1012326 255
258 3300025242 Ga0209258_100353 Ga0209258_1003539 255
259 3300025242 Ga0209258_100475 Ga0209258_1004753 255
260 3300025246 Ga0209646_1000053 Ga0209646_1000053125 255
261 3300025250 Ga0209026_1000020 Ga0209026_1000020194 255
262 3300025253 Ga0209677_100132 Ga0209677_10013226 255
263 3300025253 Ga0209677_100161 Ga0209677_1001616 255
264 3300025253 Ga0209677_104352 Ga0209677_1043522 255
265 3300025254 Ga0209148_1009771 Ga0209148_10097712 255
266 3300025256 Ga0209759_1000017 Ga0209759_1000017125 255
267 3300025256 Ga0209759_1000913 Ga0209759_10009139 255
268 3300025256 Ga0209759_1001199 Ga0209759_10011995 255
269 3300025256 Ga0209759_1002284 Ga0209759_10022846 255
270 3300025256 Ga0209759_1008311 Ga0209759_10083112 255
271 3300025263 Ga0209565_1017960 Ga0209565_10179602 255
272 3300025272 Ga0209455_1000136 Ga0209455_1000136131 255
273 3300025295 Ga0209564_1000003 Ga0209564_1000003375 255
274 3300025298 Ga0209050_1000703 Ga0209050_100070340 255
275 3300025299 Ga0209256_1000024 Ga0209256_1000024169 255
276 3300025303 Ga0209051_1000063 Ga0209051_1000063113 255
277 3300025304 Ga0209257_1000118 Ga0209257_100011894 255
278 3300025909 Ga0207705_10044625 Ga0207705_100446252 255
279 3300025909 Ga0207705_10125539 Ga0207705_101255392 255
280 3300025909 Ga0207705_10266604 Ga0207705_102666041 255
281 3300025913 Ga0207695_10060918 Ga0207695_100609184 255
282 3300025913 Ga0207695_10110219 Ga0207695_101102192 255
283 3300025913 Ga0207695_10468010 Ga0207695_104680102 255
284 3300025919 Ga0207657_10065219 Ga0207657_100652194 255
285 3300025924 Ga0207694_10653421 Ga0207694_106534212 255
286 3300025941 Ga0207711_10054982 Ga0207711_100549822 255
287 3300025942 Ga0207689_10119528 Ga0207689_101195282 255
288 3300025944 Ga0207661_10082171 Ga0207661_100821713 255
289 3300025949 Ga0207667_10010190 Ga0207667_100101904 255
290 3300025949 Ga0207667_10031191 Ga0207667_100311915 255
291 3300025949 Ga0207667_10415291 Ga0207667_104152912 255
292 3300025981 Ga0207640_10017383 Ga0207640_100173833 255
293 3300026041 Ga0207639_10204495 Ga0207639_102044952 255
294 3300026041 Ga0207639_10441724 Ga0207639_104417242 255
295 3300026078 Ga0207702_10002918 Ga0207702_100029184 255
296 3300026116 Ga0207674_10001725 Ga0207674_1000172519 255
297 3300026118 Ga0207675_100032377 Ga0207675_1000323775 255
298 3300027111 Ga0209281_1000149 Ga0209281_100014999 255
299 3300028666 Ga0265336_10000012 Ga0265336_1000001296 255
300 3300029957 Ga0265324_10001037 Ga0265324_100010372 255
301 3300030521 Ga0307511_10062563 Ga0307511_100625632 255
302 3300031649 Ga0307514_10001730 Ga0307514_1000173018 255
303 3300031731 Ga0307405_10064548 Ga0307405_100645483 255
304 3300034820 Ga0373959_0005627 Ga0373959_0005627_843_1664 255
305 3300037466 Ga0395898_0008097 Ga0395898_0008097_10301_11098 255
306 3300038443 Ga0395901_0181036 Ga0395901_0181036_109_906 255
307 3300039447 Ga0436361_0026531 Ga0436361_0026531_4342_5148 255
308 3300039447 Ga0436361_0570177 Ga0436361_0570177_1964_2770 255
309 3300042115 Ga0450911_001627 Ga0450911_001627_4053_4844 255
310 3300044694 Ga0466963_0082950 Ga0466963_0082950_112_936 255
311 3300045051 Ga0451576_0034648 Ga0451576_0034648_4252_5052 255
312 3300046471 Ga0495650_0008300 Ga0495650_0008300_5190_6011 255
313 3300046506 Ga0495583_0000017 Ga0495583_0000017_47768_48586 255
314 3300046511 Ga0495608_0226875 Ga0495608_0226875_101_928 255
315 3300046694 Ga0495649_0000151 Ga0495649_0000151_38129_38947 255
316 3300046794 Ga0495589_0007070 Ga0495589_0007070_4331_5149 255
317 3300047323 Ga0495683_0051306 Ga0495683_0051306_479_1297 255
318 3300048905 Ga0496102_0001573 Ga0496102_0001573_17190_17966 255
319 3300048915 Ga0496112_0071329 Ga0496112_0071329_2283_3095 255
320 3300048917 Ga0496114_0001821 Ga0496114_0001821_13938_14729 255
321 3300048928 Ga0496125_0007916 Ga0496125_0007916_1422_2216 255
322 3300048928 Ga0496125_0027324 Ga0496125_0027324_410_1201 255
323 3300048929 Ga0496126_0097932 Ga0496126_0097932_446_1240 255
324 3300049568 Ga0501031_0117428 Ga0501031_0117428_350_1228 255
325 3300053080 Ga0500635_0000053 Ga0500635_0000053_42947_43798 255
326 3300053086 Ga0500578_0203658 Ga0500578_0203658_116_934 255
327 3300053136 Ga0500559_0008644 Ga0500559_0008644_45_866 255
328 3300055283 Ga0500661_016508 Ga0500661_016508_386_1198 255
329 iso_pu_bacteria 2887375801 2887376195 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

193

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

240

265

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7efo-assembly1.cif.gz_A lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.9333 10 250
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9255 8 242
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9249 10 238
6mit-assembly2.cif.gz_E lptbfgc from enterobacter cloacae 0.9236 10 252
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9225 10 238
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9378 9 251 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9332 8 234 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9291 7 73 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.928 10 235 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9271 10 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7K1BRM8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9769 6 105 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A3D4KYG8-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9711 6 80 GO:0005524
GO:0016887
AF-A0A527YQI0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9676 8 107 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7W0T098-F1-model_v4 ATP-binding cassette domain-containing protein 0.9667 6 108 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A4Q3MZI9-F1-model_v4 ATP-binding cassette domain-containing protein 0.9568 6 107 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.41 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map