F409539

General Info

Members Datasets Scaffolds Average Seq Length
329 271 658 377

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100037998|Ga0070674_1000379982
Length 380
Sequence MPVRDESPLLHTPLHALHVARGGKMVPFAGYEMPVQYAAGVLREHQHTRSAAGLFDVSHMGQLAVRAKSGKVEDAALALERLVPQDIVAVAPGRQRYAQFTNTAGGMLDDLMVANFGDHLFLVVNAACKTEDEAHLRAHLSDACVIESLADRALIALQGPKAEQVLADFADVTAMRFMDSGPRKVAGLDCFVSRSGYTGEDGFEISVPAEHAEALVKSLLDNTDVLPIGLGARDSLRLEAGLCLYGHDIDATTTPVEGALEWSVQKSRRNGGARAGGFPGAEEILAQFEKGAARRRVGLRPEGRAPVREGAILFADATSSDPIGKVTSGGFGPSLNAPVAMGYLPSSLAATGTQIFAEVRGQRLPLLVAAMPFAPNTYKR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
28 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
40 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
41 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
42 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
67 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
68 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
184 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
185 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
186 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
187 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
193 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
194 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
195 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
196 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
197 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
198 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
199 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
200 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
201 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
202 2643221651 Afipia sp. Root123D2 Isolate Unclassified
203 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
204 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
205 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
206 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
207 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
208 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
209 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
210 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
211 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
212 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
213 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
214 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
215 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
216 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
217 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
218 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
219 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
220 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
221 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
222 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
223 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
224 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
225 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
226 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
227 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
228 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
229 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
230 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
231 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
232 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
233 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
234 2904699407
235 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
236 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
237 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
238 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
239 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
240 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
241 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
242 2922368715
243 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
244 2922425934
245 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
246 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
247 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
248 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
249 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
250 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
251 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
252 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
253 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
254 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
255 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
256 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
257 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
258 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
259 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
260 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
261 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
262 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
263 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
264 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
265 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
266 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
267 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
268 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
269 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
270 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
271 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.38
Metatranscriptomes 0
Isolates 23.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 17.63
Rhizoplane 7.29
Rhizosphere 44.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100037998 3300005356 Bacteria 3241
2 JGI25151J46595_10002724 3300003187 Bacteria 10310
3 JGI25406J46586_10001646 3300003203 Bacteria 10551
4 JGI25153J46596_10005745 3300003215 Bacteria 6465
5 JGI25404J52841_10000644 3300003659 Bacteria 5303
6 Ga0055531_10001716 3300003794 Bacteria 15700
7 Ga0070661_100273384 3300005344 Bacteria 1309
8 Ga0070668_100141613 3300005347 Bacteria 1938
9 Ga0070668_100166340 3300005347 Bacteria 1792
10 Ga0070668_100278415 3300005347 Bacteria 1396
11 Ga0070669_100084920 3300005353 Bacteria 2363
12 Ga0070669_100132730 3300005353 Bacteria 1912
13 Ga0070713_100076545 3300005436 Bacteria 2842
14 Ga0070663_100059083 3300005455 Bacteria 2756
15 Ga0070663_100127983 3300005455 Bacteria 1925
16 Ga0070681_10097809 3300005458 Bacteria 2882
17 Ga0070681_10108764 3300005458 Bacteria 2712
18 Ga0070679_100088927 3300005530 Bacteria 3075
19 Ga0070672_100232662 3300005543 Bacteria 1548
20 Ga0070665_100009528 3300005548 Bacteria 9824
21 Ga0070665_100178045 3300005548 Bacteria 2127
22 Ga0070665_100364498 3300005548 Bacteria 1451
23 Ga0068855_100115160 3300005563 Bacteria 3082
24 Ga0070664_100052219 3300005564 Bacteria 3461
25 Ga0068866_10101559 3300005718 Bacteria 1587
26 Ga0081455_10011653 3300005937 Bacteria 8819
27 Ga0081455_10025146 3300005937 Bacteria 5501
28 Ga0081455_10026616 3300005937 Bacteria 5313
29 Ga0081538_10028442 3300005981 Bacteria 3844
30 Ga0081540_1000533 3300005983 Bacteria 37025
31 Ga0081540_1003248 3300005983 Bacteria 12929
32 Ga0081540_1014919 3300005983 Bacteria 4943
33 Ga0081540_1024938 3300005983 Bacteria 3456
34 Ga0081539_10000319 3300005985 Bacteria 106944
35 Ga0081539_10024493 3300005985 Bacteria 3912
36 Ga0081539_10068515 3300005985 Bacteria 1914
37 Ga0070717_10011078 3300006028 Bacteria 6833
38 Ga0075363_100025946 3300006048 Bacteria 2994
39 Ga0075362_10024173 3300006177 Bacteria 2576
40 Ga0075370_10038060 3300006353 Bacteria 2706
41 Ga0099824_1002235 3300006942 Bacteria 28253
42 Ga0099822_1006882 3300006943 Bacteria 14762
43 Ga0075435_100149363 3300007076 Bacteria 1964
44 Ga0105245_10113770 3300009098 Bacteria 2520
45 Ga0105242_10318781 3300009176 Bacteria 1425
46 Ga0105238_10167341 3300009551 Bacteria 2174
47 Ga0157374_10096142 3300013296 Bacteria 2833
48 Ga0157378_10056421 3300013297 Bacteria 3500
49 Ga0163162_10286887 3300013306 Bacteria 1778
50 Ga0157375_10250632 3300013308 Bacteria 1931
51 Ga0157375_10283083 3300013308 Bacteria 1821
52 Ga0163163_10162927 3300014325 Bacteria 2276
53 Ga0157376_10046774 3300014969 Bacteria 3570
54 Ga0214544_1000020 3300021320 Bacteria 178560
55 Ga0214542_1000024 3300021321 Bacteria 191218
56 Ga0214545_1000011 3300021324 Bacteria 190550
57 Ga0214543_1000033 3300021327 Bacteria 190419
58 Ga0209233_1002172 3300025261 Bacteria 7348
59 Ga0209455_1005408 3300025272 Bacteria 3951
60 Ga0209025_1000787 3300025294 Bacteria 52060
61 Ga0209758_1000484 3300025297 Bacteria 65301
62 Ga0209758_1011463 3300025297 Bacteria 5131
63 Ga0209256_1004112 3300025299 Bacteria 9421
64 Ga0207426_1038272 3300025302 Bacteria 1511
65 Ga0209257_1001136 3300025304 Bacteria 34058
66 Ga0207699_10170153 3300025906 Bacteria 1457
67 Ga0207695_10349103 3300025913 Bacteria 1367
68 Ga0207693_10005604 3300025915 Bacteria 10440
69 Ga0207663_10000136 3300025916 Bacteria 34085
70 Ga0207657_10105232 3300025919 Bacteria 2336
71 Ga0207649_10239135 3300025920 Bacteria 1303
72 Ga0207687_10098028 3300025927 Bacteria 2151
73 Ga0207669_10083399 3300025937 Bacteria 2055
74 Ga0207689_10118294 3300025942 Bacteria 2179
75 Ga0207679_10246692 3300025945 Bacteria 1516
76 Ga0207668_10085181 3300025972 Bacteria 2305
77 Ga0207668_10097417 3300025972 Bacteria 2176
78 Ga0207678_10025429 3300026067 Bacteria 5167
79 Ga0207678_10070566 3300026067 Bacteria 2995
80 Ga0207708_10052763 3300026075 Bacteria 3097
81 Ga0207702_10018516 3300026078 Bacteria 5762
82 Ga0207683_10095129 3300026121 Bacteria 2656
83 Ga0207683_10099596 3300026121 Bacteria 2594
84 Ga0207698_10055219 3300026142 Bacteria 3059
85 Ga0209589_1000018 3300027357 Bacteria 192614
86 Ga0209489_100026 3300027361 Bacteria 192614
87 Ga0209700_100035 3300027363 Bacteria 192614
88 Ga0209813_10009146 3300027866 Bacteria 2525
89 Ga0268266_10003688 3300028379 Bacteria 15110
90 Ga0268266_10074719 3300028379 Bacteria 2943
91 Ga0268266_10129418 3300028379 Bacteria 2256
92 Ga0265337_1029589 3300028556 Bacteria 1637
93 Ga0265334_10001906 3300028573 Bacteria 9885
94 Ga0265323_10001874 3300028653 Bacteria 9936
95 Ga0265336_10000106 3300028666 Bacteria 63839
96 Ga0307517_10000049 3300028786 Bacteria 160368
97 Ga0307517_10165632 3300028786 Bacteria 1469
98 Ga0265338_10000065 3300028800 Bacteria 188966
99 Ga0265324_10002676 3300029957 Bacteria 8890
100 Ga0307509_10225494 3300031507 Bacteria 1682
101 Ga0307508_10054710 3300031616 Bacteria 3537
102 Ga0265314_10013390 3300031711 Bacteria 6627
103 Ga0316576_10015064 3300031727 Bacteria 5178
104 Ga0307405_10127899 3300031731 Bacteria 1750
105 Ga0307413_10302985 3300031824 Bacteria 1213
106 Ga0307412_10121344 3300031911 Bacteria 1882
107 Ga0307411_10043403 3300032005 Bacteria 2876
108 Ga0307510_10024603 3300033180 Bacteria 6955
109 Ga0373943_0150471 3300035170 Bacteria 1261
110 Ga0373927_0027325 3300035695 Bacteria 3726
111 Ga0373927_0115311 3300035695 Bacteria 1751
112 Ga0373947_0079290 3300035725 Bacteria 2029
113 Ga0373925_0165476 3300037068 Bacteria 1744
114 Ga0395898_0133698 3300037466 Bacteria 2375
115 Ga0395898_0234577 3300037466 Bacteria 1750
116 Ga0395905_0064557 3300037471 Bacteria 3426
117 Ga0436365_1707337 3300039437 Bacteria 2912
118 Ga0436361_0889836 3300039447 Bacteria 2600
119 Ga0436361_0952525 3300039447 Bacteria 1336
120 Ga0466972_0000376 3300044658 Bacteria 23950
121 Ga0466960_0167509 3300044901 Bacteria 1184
122 Ga0466967_0058260 3300045976 Bacteria 3414
123 Ga0495603_0014373 3300046455 Bacteria 4788
124 Ga0495603_0014634 3300046455 Bacteria 4743
125 Ga0495603_0014979 3300046455 Bacteria 4688
126 Ga0495629_0040867 3300046459 Bacteria 3263
127 Ga0495638_0056333 3300046460 Bacteria 2439
128 Ga0495650_0062815 3300046471 Bacteria 1483
129 Ga0495639_0049373 3300046475 Bacteria 1910
130 Ga0495585_0134105 3300046492 Bacteria 1301
131 Ga0495606_0007850 3300046507 Bacteria 9420
132 Ga0495610_0062565 3300046512 Bacteria 1765
133 Ga0495645_0099304 3300046543 Bacteria 2071
134 Ga0495656_0005814 3300046615 Bacteria 4285
135 Ga0495656_0107331 3300046615 Bacteria 1300
136 Ga0495668_0073607 3300046616 Bacteria 1876
137 Ga0495668_0078445 3300046616 Bacteria 1813
138 Ga0495588_0046895 3300046674 Bacteria 2217
139 Ga0495623_0116121 3300046679 Bacteria 1617
140 Ga0495647_0035017 3300046681 Bacteria 1884
141 Ga0495669_0011937 3300046684 Bacteria 3695
142 Ga0495672_0006823 3300047320 Bacteria 8724
143 Ga0495672_0022348 3300047320 Bacteria 4113
144 Ga0495676_0090311 3300047321 Bacteria 2293
145 Ga0495685_024738 3300047447 Bacteria 2067
146 Ga0495686_0081895 3300047472 Bacteria 1970
147 Ga0495686_0137192 3300047472 Bacteria 1446
148 Ga0495626_0135206 3300048091 Bacteria 1049
149 Ga0496100_0046021 3300048903 Bacteria 2803
150 Ga0496100_0050707 3300048903 Bacteria 2690
151 Ga0496100_0071267 3300048903 Bacteria 2320
152 Ga0496100_0161176 3300048903 Bacteria 1608
153 Ga0496101_0031805 3300048904 Bacteria 3712
154 Ga0496102_0218381 3300048905 Bacteria 1797
155 Ga0496102_0235381 3300048905 Bacteria 1727
156 Ga0496102_0256562 3300048905 Bacteria 1648
157 Ga0496104_0051847 3300048907 Bacteria 3874
158 Ga0496104_0095862 3300048907 Bacteria 2838
159 Ga0496105_0025832 3300048908 Bacteria 4784
160 Ga0496106_0034402 3300048909 Bacteria 3783
161 Ga0496106_0059950 3300048909 Bacteria 2884
162 Ga0496108_0003043 3300048911 Bacteria 13477
163 Ga0496109_0009711 3300048912 Bacteria 8213
164 Ga0496110_0004491 3300048913 Bacteria 10821
165 Ga0496110_0088768 3300048913 Bacteria 2762
166 Ga0496111_0031327 3300048914 Bacteria 3788
167 Ga0496112_0012428 3300048915 Bacteria 7827
168 Ga0496112_0071634 3300048915 Bacteria 3425
169 Ga0496112_0099111 3300048915 Bacteria 2884
170 Ga0496115_0002909 3300048918 Bacteria 12354
171 Ga0496115_0087510 3300048918 Bacteria 2542
172 Ga0496118_0045610 3300048921 Bacteria 3419
173 Ga0496119_0111671 3300048922 Bacteria 1516
174 Ga0496121_0036041 3300048924 Bacteria 4417
175 Ga0496121_0120478 3300048924 Bacteria 1982
176 Ga0496121_0157290 3300048924 Bacteria 1666
177 Ga0496123_0003753 3300048926 Bacteria 16655
178 Ga0496124_0080396 3300048927 Bacteria 2682
179 Ga0496125_0001650 3300048928 Bacteria 31436
180 Ga0496125_0077973 3300048928 Bacteria 2550
181 Ga0496126_0010555 3300048929 Bacteria 9662
182 Ga0496126_0046424 3300048929 Bacteria 3984
183 Ga0496126_0065857 3300048929 Bacteria 3240
184 Ga0496126_0106374 3300048929 Bacteria 2448
185 Ga0496126_0126493 3300048929 Bacteria 2212
186 Ga0501033_0004826 3300049570 Bacteria 10758
187 Ga0501033_0092615 3300049570 Bacteria 2210
188 Ga0501036_0126030 3300049572 Bacteria 2163
189 Ga0501037_0029042 3300049573 Bacteria 4084
190 Ga0501038_0011478 3300049574 Bacteria 8081
191 Ga0501039_0020361 3300049575 Bacteria 5084
192 Ga0501042_0042559 3300049578 Bacteria 3233
193 Ga0501047_0018274 3300049581 Bacteria 6718
194 Ga0501047_0027982 3300049581 Bacteria 5432
195 Ga0501048_0009900 3300049582 Bacteria 7145
196 Ga0501067_0012611 3300049583 Bacteria 4690
197 Ga0501068_0015381 3300049584 Bacteria 4392
198 Ga0501069_0029662 3300049585 Bacteria 3002
199 Ga0501070_0019003 3300049586 Bacteria 5764
200 Ga0501071_0036287 3300049587 Bacteria 3515
201 Ga0501072_0011011 3300049588 Bacteria 6900
202 Ga0501076_0073865 3300049592 Bacteria 2731
203 Ga0501077_0151916 3300049593 Bacteria 1469
204 Ga0501079_0009379 3300049741 Bacteria 7416
205 Ga0501083_0043137 3300049744 Bacteria 3056
206 Ga0501035_0024312 3300049822 Bacteria 5556
207 Ga0501045_0025628 3300049824 Bacteria 4240
208 nmdc:mga03n38_55026_c1 3300050490 Bacteria 1791
209 nmdc:mga03n38_8070_c1 3300050490 Bacteria 3758
210 nmdc:mga00v17_196841_c1 3300050491 Bacteria 1302
211 nmdc:mga0yw44_37619_c1 3300050492 Bacteria 2858
212 nmdc:mga06z11_13068_c1 3300050494 Bacteria 3633
213 nmdc:mga04h51_30117_c1 3300050495 Bacteria 1706
214 nmdc:mga07m45_44386_c1 3300050496 Bacteria 2495
215 nmdc:mga09592_153154_c1 3300050508 Bacteria 1989
216 Ga0495655_0030096 3300053083 Bacteria 1311
217 Ga0495655_0048031 3300053083 Bacteria 1119
218 Ga0495619_0080719 3300053085 Bacteria 2189
219 Ga0500643_000019 3300053087 Bacteria 294301
220 Ga0500647_0016319 3300053091 Bacteria 3411
221 Ga0500583_0094462 3300053092 Bacteria 1458
222 Ga0500651_0090671 3300053093 Bacteria 1882
223 Ga0500641_0021282 3300053096 Bacteria 2470
224 Ga0500554_004284 3300053102 Bacteria 3010
225 Ga0500554_006809 3300053102 Bacteria 2590
226 Ga0500555_012727 3300053103 Bacteria 2422
227 Ga0500572_000178 3300053111 Bacteria 22343
228 Ga0500595_003316 3300053119 Bacteria 7570
229 Ga0500595_008308 3300053119 Bacteria 4248
230 Ga0500642_0000228 3300053130 Bacteria 22034
231 Ga0500559_0002150 3300053136 Bacteria 10482
232 Ga0500568_0020102 3300053139 Bacteria 2895
233 Ga0500603_000282 3300053150 Bacteria 13460
234 Ga0500603_011894 3300053150 Bacteria 1990
235 Ga0500616_0000084 3300053153 Bacteria 195562
236 Ga0500622_0006086 3300053156 Bacteria 7086
237 Ga0500638_051677 3300053162 Bacteria 1986
238 Ga0500638_069004 3300053162 Bacteria 1691
239 Ga0500636_0113366 3300053177 Bacteria 1529
240 Ga0500637_0000520 3300053178 Bacteria 15017
241 Ga0500637_0005157 3300053178 Bacteria 6298
242 Ga0500576_010807 3300053725 Bacteria 4039
243 Ga0500609_002310 3300053731 Bacteria 2721
244 Ga0500596_003890 3300053735 Bacteria 2793
245 Ga0500601_001611 3300053737 Bacteria 2442
246 Ga0501084_0034764 3300054114 Bacteria 4214
247 Ga0500661_004207 3300055283 Bacteria 2693
248 Ga0501082_0043704 3300060353 Bacteria 3864
249 Ga0530510_0136404 3300061734 Bacteria 1807
250 2507510119 2507262055 Bacteria 8048963
251 2513648912 2513237095 Bacteria 8976980
252 2513673106 2513237098 Bacteria 9902361
253 2513697033 2513237101 Bacteria 7952346
254 2513891992 2513237141 Bacteria 8496279
255 2513922999 2513237145 Bacteria 8979722
256 2524439143 2524023205 Bacteria 8918781
257 2524467114 2524023210 Bacteria 9029266
258 2524540706 2524023228 Bacteria 10118060
259 2617379044 2617270741 Bacteria 8201522
260 2644287766 2643221651 Bacteria 4798932
261 2671122926 2667528175 Bacteria 7532676
262 2728748054 2728368998 Bacteria 8720350
263 2793072821 2791355197 Bacteria 8420563
264 2824661180 2824653114 Bacteria 8493680
265 2824664984 2824661429 Bacteria 9877870
266 2824699598 2824696289 Bacteria 8335049
267 2824753431 2824746037 Bacteria 7911610
268 2824761371 2824753945 Bacteria 9787441
269 2824771548 2824763712 Bacteria 9792355
270 2841959389 2841957949 Bacteria 8652217
271 2844317649 2844315083 Bacteria 8138177
272 2847945026 2847939898 Bacteria 8606328
273 2857509862 2857509624 Bacteria 7472071
274 2874593317 2874590934 Bacteria 8299676
275 2874610558 2874604998 Bacteria 7834745
276 2874618136 2874612657 Bacteria 8252029
277 2876766774 2876761206 Bacteria 10111113
278 2876773357 2876771140 Bacteria 8287509
279 2876810241 2876808645 Bacteria 8824342
280 2876821310 2876818435 Bacteria 8274608
281 2879077273 2879074833 Bacteria 8279565
282 2879107642 2879099564 Bacteria 10442239
283 2879111750 2879110137 Bacteria 8907982
284 2885368844 2885366525 Bacteria 8326213
285 2885379965 2885374607 Bacteria 8927485
286 2885389022 2885383462 Bacteria 9473874
287 2885417441 2885409591 Bacteria 9235467
288 2888382364 2888378607 Bacteria 9652610
289 2888388332 2888388044 Bacteria 7304136
290 2903749543 2903748898 Bacteria 9972761
291 2903774650 2903768456 Bacteria 9749579
292 2904700639
293 2904718576 2904711408 Bacteria 9771557
294 2906608751 2906602504 Bacteria 8295279
295 2906636017 2906635258 Bacteria 8601019
296 2906663915 2906660503 Bacteria 8595048
297 2908744339 2908739725 Bacteria 8628932
298 2908778614 2908775508 Bacteria 8092255
299 2922362289 2922361189 Bacteria 7436256
300 2922375592
301 2922387957 2922386360 Bacteria 7017218
302 2922428500
303 2929616331 2929615660 Bacteria 9193770
304 2929625075 2929624759 Bacteria 9339455
305 2933578386 2933577622 Bacteria 9116884
306 2935634484 2935630451 Bacteria 8169952
307 2935677164 2935675223 Bacteria 9928132
308 2935839131 2935837841 Bacteria 9454360
309 2935999600 2935992306 Bacteria 9802711
310 2941508970 2941507105 Bacteria 8166816
311 2941516799 2941515067 Bacteria 8166720
312 2941525106 2941523033 Bacteria 8169134
313 2941536294 2941531003 Bacteria 7653939
314 2941539821 2941538514 Bacteria 9402094
315 2989353289 2989349275 Bacteria 6349068
316 3005478625 3005474847 Bacteria 9259049
317 8006927728 8006926726 Bacteria 6749210
318 8006942736 8006933436 Bacteria 10410654
319 8006964873 8006964411 Bacteria 8966052
320 8006982459 8006973647 Bacteria 10679141
321 8006991733 8006984368 Bacteria 9651211
322 8006995598 8006994254 Bacteria 8309700
323 8019558501 8019555841 Bacteria 9642137
324 8019566797 8019565922 Bacteria 9639779
325 8054559655 8054558443 Bacteria 5204801
326 8055747977 8055742211 Bacteria 9226248
327 8056676349 8056673599 Bacteria 7871253
328 8056685030 8056681323 Bacteria 8472857
329 8056691816 8056689827 Bacteria 6712655
330 Ga0070674_100037998
331 JGI25151J46595_10002724
332 JGI25406J46586_10001646
333 JGI25153J46596_10005745
334 JGI25404J52841_10000644
335 Ga0055531_10001716
336 Ga0070661_100273384
337 Ga0070668_100141613
338 Ga0070668_100166340
339 Ga0070668_100278415
340 Ga0070669_100084920
341 Ga0070669_100132730
342 Ga0070713_100076545
343 Ga0070663_100059083
344 Ga0070663_100127983
345 Ga0070681_10097809
346 Ga0070681_10108764
347 Ga0070679_100088927
348 Ga0070672_100232662
349 Ga0070665_100009528
350 Ga0070665_100178045
351 Ga0070665_100364498
352 Ga0068855_100115160
353 Ga0070664_100052219
354 Ga0068866_10101559
355 Ga0081455_10011653
356 Ga0081455_10025146
357 Ga0081455_10026616
358 Ga0081538_10028442
359 Ga0081540_1000533
360 Ga0081540_1003248
361 Ga0081540_1014919
362 Ga0081540_1024938
363 Ga0081539_10000319
364 Ga0081539_10024493
365 Ga0081539_10068515
366 Ga0070717_10011078
367 Ga0075363_100025946
368 Ga0075362_10024173
369 Ga0075370_10038060
370 Ga0099824_1002235
371 Ga0099822_1006882
372 Ga0075435_100149363
373 Ga0105245_10113770
374 Ga0105242_10318781
375 Ga0105238_10167341
376 Ga0157374_10096142
377 Ga0157378_10056421
378 Ga0163162_10286887
379 Ga0157375_10250632
380 Ga0157375_10283083
381 Ga0163163_10162927
382 Ga0157376_10046774
383 Ga0214544_1000020
384 Ga0214542_1000024
385 Ga0214545_1000011
386 Ga0214543_1000033
387 Ga0209233_1002172
388 Ga0209455_1005408
389 Ga0209025_1000787
390 Ga0209758_1000484
391 Ga0209758_1011463
392 Ga0209256_1004112
393 Ga0207426_1038272
394 Ga0209257_1001136
395 Ga0207699_10170153
396 Ga0207695_10349103
397 Ga0207693_10005604
398 Ga0207663_10000136
399 Ga0207657_10105232
400 Ga0207649_10239135
401 Ga0207687_10098028
402 Ga0207669_10083399
403 Ga0207689_10118294
404 Ga0207679_10246692
405 Ga0207668_10085181
406 Ga0207668_10097417
407 Ga0207678_10025429
408 Ga0207678_10070566
409 Ga0207708_10052763
410 Ga0207702_10018516
411 Ga0207683_10095129
412 Ga0207683_10099596
413 Ga0207698_10055219
414 Ga0209589_1000018
415 Ga0209489_100026
416 Ga0209700_100035
417 Ga0209813_10009146
418 Ga0268266_10003688
419 Ga0268266_10074719
420 Ga0268266_10129418
421 Ga0265337_1029589
422 Ga0265334_10001906
423 Ga0265323_10001874
424 Ga0265336_10000106
425 Ga0307517_10000049
426 Ga0307517_10165632
427 Ga0265338_10000065
428 Ga0265324_10002676
429 Ga0307509_10225494
430 Ga0307508_10054710
431 Ga0265314_10013390
432 Ga0316576_10015064
433 Ga0307405_10127899
434 Ga0307413_10302985
435 Ga0307412_10121344
436 Ga0307411_10043403
437 Ga0307510_10024603
438 Ga0373943_0150471
439 Ga0373927_0027325
440 Ga0373927_0115311
441 Ga0373947_0079290
442 Ga0373925_0165476
443 Ga0395898_0133698
444 Ga0395898_0234577
445 Ga0395905_0064557
446 Ga0436365_1707337
447 Ga0436361_0889836
448 Ga0436361_0952525
449 Ga0466972_0000376
450 Ga0466960_0167509
451 Ga0466967_0058260
452 Ga0495603_0014373
453 Ga0495603_0014634
454 Ga0495603_0014979
455 Ga0495629_0040867
456 Ga0495638_0056333
457 Ga0495650_0062815
458 Ga0495639_0049373
459 Ga0495585_0134105
460 Ga0495606_0007850
461 Ga0495610_0062565
462 Ga0495645_0099304
463 Ga0495656_0005814
464 Ga0495656_0107331
465 Ga0495668_0073607
466 Ga0495668_0078445
467 Ga0495588_0046895
468 Ga0495623_0116121
469 Ga0495647_0035017
470 Ga0495669_0011937
471 Ga0495672_0006823
472 Ga0495672_0022348
473 Ga0495676_0090311
474 Ga0495685_024738
475 Ga0495686_0081895
476 Ga0495686_0137192
477 Ga0495626_0135206
478 Ga0496100_0046021
479 Ga0496100_0050707
480 Ga0496100_0071267
481 Ga0496100_0161176
482 Ga0496101_0031805
483 Ga0496102_0218381
484 Ga0496102_0235381
485 Ga0496102_0256562
486 Ga0496104_0051847
487 Ga0496104_0095862
488 Ga0496105_0025832
489 Ga0496106_0034402
490 Ga0496106_0059950
491 Ga0496108_0003043
492 Ga0496109_0009711
493 Ga0496110_0004491
494 Ga0496110_0088768
495 Ga0496111_0031327
496 Ga0496112_0012428
497 Ga0496112_0071634
498 Ga0496112_0099111
499 Ga0496115_0002909
500 Ga0496115_0087510
501 Ga0496118_0045610
502 Ga0496119_0111671
503 Ga0496121_0036041
504 Ga0496121_0120478
505 Ga0496121_0157290
506 Ga0496123_0003753
507 Ga0496124_0080396
508 Ga0496125_0001650
509 Ga0496125_0077973
510 Ga0496126_0010555
511 Ga0496126_0046424
512 Ga0496126_0065857
513 Ga0496126_0106374
514 Ga0496126_0126493
515 Ga0501033_0004826
516 Ga0501033_0092615
517 Ga0501036_0126030
518 Ga0501037_0029042
519 Ga0501038_0011478
520 Ga0501039_0020361
521 Ga0501042_0042559
522 Ga0501047_0018274
523 Ga0501047_0027982
524 Ga0501048_0009900
525 Ga0501067_0012611
526 Ga0501068_0015381
527 Ga0501069_0029662
528 Ga0501070_0019003
529 Ga0501071_0036287
530 Ga0501072_0011011
531 Ga0501076_0073865
532 Ga0501077_0151916
533 Ga0501079_0009379
534 Ga0501083_0043137
535 Ga0501035_0024312
536 Ga0501045_0025628
537 nmdc:mga03n38_55026_c1
538 nmdc:mga03n38_8070_c1
539 nmdc:mga00v17_196841_c1
540 nmdc:mga0yw44_37619_c1
541 nmdc:mga06z11_13068_c1
542 nmdc:mga04h51_30117_c1
543 nmdc:mga07m45_44386_c1
544 nmdc:mga09592_153154_c1
545 Ga0495655_0030096
546 Ga0495655_0048031
547 Ga0495619_0080719
548 Ga0500643_000019
549 Ga0500647_0016319
550 Ga0500583_0094462
551 Ga0500651_0090671
552 Ga0500641_0021282
553 Ga0500554_004284
554 Ga0500554_006809
555 Ga0500555_012727
556 Ga0500572_000178
557 Ga0500595_003316
558 Ga0500595_008308
559 Ga0500642_0000228
560 Ga0500559_0002150
561 Ga0500568_0020102
562 Ga0500603_000282
563 Ga0500603_011894
564 Ga0500616_0000084
565 Ga0500622_0006086
566 Ga0500638_051677
567 Ga0500638_069004
568 Ga0500636_0113366
569 Ga0500637_0000520
570 Ga0500637_0005157
571 Ga0500576_010807
572 Ga0500609_002310
573 Ga0500596_003890
574 Ga0500601_001611
575 Ga0501084_0034764
576 Ga0500661_004207
577 Ga0501082_0043704
578 Ga0530510_0136404
579 2507510119
580 2513648912
581 2513673106
582 2513697033
583 2513891992
584 2513922999
585 2524439143
586 2524467114
587 2524540706
588 2617379044
589 2644287766
590 2671122926
591 2728748054
592 2793072821
593 2824661180
594 2824664984
595 2824699598
596 2824753431
597 2824761371
598 2824771548
599 2841959389
600 2844317649
601 2847945026
602 2857509862
603 2874593317
604 2874610558
605 2874618136
606 2876766774
607 2876773357
608 2876810241
609 2876821310
610 2879077273
611 2879107642
612 2879111750
613 2885368844
614 2885379965
615 2885389022
616 2885417441
617 2888382364
618 2888388332
619 2903749543
620 2903774650
621 2904700639
622 2904718576
623 2906608751
624 2906636017
625 2906663915
626 2908744339
627 2908778614
628 2922362289
629 2922375592
630 2922387957
631 2922428500
632 2929616331
633 2929625075
634 2933578386
635 2935634484
636 2935677164
637 2935839131
638 2935999600
639 2941508970
640 2941516799
641 2941525106
642 2941536294
643 2941539821
644 2989353289
645 3005478625
646 8006927728
647 8006942736
648 8006964873
649 8006982459
650 8006991733
651 8006995598
652 8019558501
653 8019566797
654 8054559655
655 8055747977
656 8056676349
657 8056685030
658 8056691816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

14

263

0.96

PF08669

GCV_T_C

Glycine cleavage T-protein C-terminal barrel domain

294

374

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsr-assembly1.cif.gz_A crystal structure of human t-protein of glycine cleavage system 0.904 7 377
3gir-assembly1.cif.gz_A crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae 0.8976 6 379
3gir-assembly1.cif.gz_A crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae 0.8953 6 379
1wsr-assembly1.cif.gz_A crystal structure of human t-protein of glycine cleavage system 0.8924 7 377
1woo-assembly1.cif.gz_A crystal structure of t-protein of the glycine cleavage system 0.8863 8 379
ID Description Score Start End Superfamily
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9093 57 145 3.30.70.1400
af_A9C3Q7_322_398_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.9086 291 368 2.40.30.110
af_O14110_304_377_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.9083 293 368 2.40.30.110
3girA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9044 60 144 3.30.70.1400
af_Q54DD3_316_392_2.40.30.110 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Aminomethyltransferase beta-barrel domains 0.9039 291 368 2.40.30.110
ID Description Score Start End GO Terms
AF-A0A356QEN8-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT (EC 2.1.2.10) 0.9723 42 221 GO:0004047
GO:0008168
GO:0032259
AF-A0A356QEN8-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT (EC 2.1.2.10) 0.9669 42 221 GO:0004047
GO:0008168
GO:0032259
AF-A0A660MPL8-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT (EC 2.1.2.10) 0.9651 5 195 GO:0004047
GO:0008168
GO:0032259
AF-A0A660MH42-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT (EC 2.1.2.10) 0.9649 5 203 GO:0004047
GO:0008168
GO:0032259
AF-A0A7Y7M6J1-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT (EC 2.1.2.10) 0.9613 4 162 GO:0004047
GO:0008168
GO:0032259

Map