F409362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 194 | 304 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0018988|Ga0466972_0018988_827_1072 |
| Length | 71 |
| Sequence | MTDCGCDKAKAELEEYLRNELCSEDAAGCSDEAHVHVVLTEAVQRACKETAPETLRTEVLMRIRSFQASVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 3 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 4 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 5 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 6 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 7 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 8 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 9 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 10 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 11 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 12 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 13 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 14 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 15 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 16 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 17 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 18 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 19 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 20 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 21 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 22 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 33 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 74 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 126 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 127 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 134 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 157 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 162 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 165 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 166 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 190 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 192 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 193 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 194 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.1 |
| Metatranscriptomes | 11.28 |
| Isolates | 7.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 4.27 |
| Nodule | 0 |
| Rhizoplane | 7.62 |
| Rhizosphere | 73.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10033442 | 3300001979 | Bacteria | 1632 |
| 2 | JGI24739J22299_10067158 | 3300001989 | Bacteria | 1121 |
| 3 | JGI24737J22298_10026599 | 3300001990 | Bacteria | 1827 |
| 4 | JGI24735J21928_10001873 | 3300002067 | Bacteria | 7378 |
| 5 | JGI24735J21928_10217997 | 3300002067 | Bacteria | 554 |
| 6 | JGI24738J21930_10098915 | 3300002075 | Bacteria | 622 |
| 7 | Ga0006778J45830_1064922 | 3300003162 | Bacteria | 576 |
| 8 | Ga0006759J45824_1040136 | 3300003163 | Bacteria | 1087 |
| 9 | rootH1_10028438 | 3300003316 | Bacteria | 4544 |
| 10 | rootH1_10028438 | 3300003323 | Bacteria | 1649 |
| 11 | Ga0007416J51690_1012623 | 3300003577 | Bacteria | 809 |
| 12 | Ga0006562J51391_1032259 | 3300003578 | Bacteria | 14220 |
| 13 | Ga0006562J51391_1032261 | 3300003578 | Bacteria | 11320 |
| 14 | Ga0032354_1067602 | 3300003693 | Bacteria | 628 |
| 15 | Ga0055539_1000027 | 3300003752 | Bacteria | 258020 |
| 16 | Ga0055533_1000020 | 3300003756 | Bacteria | 353998 |
| 17 | Ga0058861_11708186 | 3300004800 | Bacteria | 615 |
| 18 | Ga0065714_10069957 | 3300005288 | Bacteria | 4020 |
| 19 | Ga0065714_10115003 | 3300005288 | Bacteria | 1411 |
| 20 | Ga0065714_10199479 | 3300005288 | Bacteria | 900 |
| 21 | Ga0065714_10407926 | 3300005288 | Bacteria | 583 |
| 22 | Ga0070658_10050727 | 3300005327 | Bacteria | 3363 |
| 23 | Ga0070658_10142100 | 3300005327 | Bacteria | 2006 |
| 24 | Ga0070682_100281146 | 3300005337 | Bacteria | 1213 |
| 25 | Ga0070659_100011520 | 3300005366 | Bacteria | 6542 |
| 26 | Ga0070659_101014368 | 3300005366 | Bacteria | 729 |
| 27 | Ga0070663_101120548 | 3300005455 | Bacteria | 689 |
| 28 | Ga0070663_102134689 | 3300005455 | Bacteria | 505 |
| 29 | Ga0070678_100033456 | 3300005456 | Bacteria | 3569 |
| 30 | Ga0070685_10734558 | 3300005466 | Bacteria | 722 |
| 31 | Ga0068853_101123593 | 3300005539 | Bacteria | 758 |
| 32 | Ga0070696_101848899 | 3300005546 | Bacteria | 522 |
| 33 | Ga0068855_100054400 | 3300005563 | Bacteria | 4704 |
| 34 | Ga0068857_100254047 | 3300005577 | Bacteria | 1612 |
| 35 | Ga0068857_101838425 | 3300005577 | Bacteria | 593 |
| 36 | Ga0068856_101518089 | 3300005614 | Bacteria | 684 |
| 37 | Ga0068861_100045958 | 3300005719 | Bacteria | 3291 |
| 38 | Ga0068863_101608107 | 3300005841 | Bacteria | 659 |
| 39 | Ga0068862_100127046 | 3300005844 | Bacteria | 2252 |
| 40 | Ga0075364_10883182 | 3300006051 | Bacteria | 609 |
| 41 | Ga0075369_10094728 | 3300006186 | Bacteria | 1335 |
| 42 | Ga0111539_10905102 | 3300009094 | Bacteria | 1026 |
| 43 | Ga0105243_10153344 | 3300009148 | Bacteria | 1979 |
| 44 | Ga0105238_11247463 | 3300009551 | Bacteria | 768 |
| 45 | Ga0105249_10527299 | 3300009553 | Bacteria | 1229 |
| 46 | Ga0105239_11021299 | 3300010375 | Bacteria | 951 |
| 47 | Ga0105246_10542761 | 3300011119 | Bacteria | 995 |
| 48 | Ga0154012_146067 | 3300013059 | Bacteria | 1226 |
| 49 | Ga0154010_110445 | 3300013062 | Bacteria | 1164 |
| 50 | Ga0157371_10276854 | 3300013102 | Bacteria | 1212 |
| 51 | Ga0157371_10797031 | 3300013102 | Bacteria | 712 |
| 52 | Ga0157370_10066733 | 3300013104 | Bacteria | 3402 |
| 53 | Ga0157370_10410155 | 3300013104 | Bacteria | 1247 |
| 54 | Ga0157369_10000103 | 3300013105 | Bacteria | 118273 |
| 55 | Ga0157369_10150744 | 3300013105 | Bacteria | 2457 |
| 56 | Ga0157369_11175084 | 3300013105 | Bacteria | 783 |
| 57 | Ga0157369_11782457 | 3300013105 | Bacteria | 625 |
| 58 | Ga0163162_10412453 | 3300013306 | Bacteria | 1483 |
| 59 | Ga0163162_11554975 | 3300013306 | Bacteria | 754 |
| 60 | Ga0157372_11197366 | 3300013307 | Bacteria | 878 |
| 61 | Ga0157372_12366871 | 3300013307 | Bacteria | 610 |
| 62 | Ga0157375_12652254 | 3300013308 | Unclassified | 599 |
| 63 | Ga0163163_10850292 | 3300014325 | Bacteria | 976 |
| 64 | Ga0157380_10014176 | 3300014326 | Bacteria | 5829 |
| 65 | Ga0197907_10611759 | 3300020069 | Bacteria | 1077 |
| 66 | Ga0197907_11048472 | 3300020069 | Bacteria | 504 |
| 67 | Ga0206356_10087887 | 3300020070 | Bacteria | 911 |
| 68 | Ga0206349_1565693 | 3300020075 | Bacteria | 662 |
| 69 | Ga0206349_1763143 | 3300020075 | Bacteria | 1985 |
| 70 | Ga0206355_1084907 | 3300020076 | Bacteria | 1700 |
| 71 | Ga0206355_1150177 | 3300020076 | Bacteria | 658 |
| 72 | Ga0206355_1217027 | 3300020076 | Bacteria | 2054 |
| 73 | Ga0206355_1500899 | 3300020076 | Bacteria | 1013 |
| 74 | Ga0206351_10042865 | 3300020077 | Bacteria | 971 |
| 75 | Ga0206351_10250689 | 3300020077 | Bacteria | 1386 |
| 76 | Ga0206351_10258678 | 3300020077 | Bacteria | 1361 |
| 77 | Ga0206351_10311684 | 3300020077 | Bacteria | 1394 |
| 78 | Ga0206351_10801304 | 3300020077 | Bacteria | 607 |
| 79 | Ga0206352_10227677 | 3300020078 | Bacteria | 610 |
| 80 | Ga0206352_10595782 | 3300020078 | Bacteria | 1224 |
| 81 | Ga0206350_10391679 | 3300020080 | Bacteria | 1110 |
| 82 | Ga0206354_10055379 | 3300020081 | Bacteria | 8489 |
| 83 | Ga0206353_10131355 | 3300020082 | Bacteria | 10073 |
| 84 | Ga0206353_10225926 | 3300020082 | Bacteria | 2084 |
| 85 | Ga0154015_1015292 | 3300020610 | Bacteria | 1117 |
| 86 | Ga0154015_1104577 | 3300020610 | Bacteria | 1343 |
| 87 | Ga0154015_1119081 | 3300020610 | Bacteria | 999 |
| 88 | Ga0154015_1216335 | 3300020610 | Bacteria | 1384 |
| 89 | Ga0224712_10016598 | 3300022467 | Bacteria | 2423 |
| 90 | Ga0224712_10092639 | 3300022467 | Bacteria | 1269 |
| 91 | Ga0224712_10177316 | 3300022467 | Bacteria | 958 |
| 92 | Ga0209566_100043 | 3300025225 | Bacteria | 266609 |
| 93 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 94 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 95 | Ga0209563_102996 | 3300025230 | Bacteria | 3625 |
| 96 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 97 | Ga0209455_1001354 | 3300025272 | Bacteria | 11245 |
| 98 | Ga0209051_1086170 | 3300025303 | Bacteria | 889 |
| 99 | Ga0207688_10235677 | 3300025901 | Bacteria | 1106 |
| 100 | Ga0207647_10074902 | 3300025904 | Bacteria | 2038 |
| 101 | Ga0207647_10085598 | 3300025904 | Bacteria | 1885 |
| 102 | Ga0207647_10152327 | 3300025904 | Bacteria | 1351 |
| 103 | Ga0207647_10613550 | 3300025904 | Bacteria | 599 |
| 104 | Ga0207645_10631317 | 3300025907 | Bacteria | 728 |
| 105 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 106 | Ga0207705_10092369 | 3300025909 | Bacteria | 2217 |
| 107 | Ga0207705_10151685 | 3300025909 | Bacteria | 1737 |
| 108 | Ga0207705_11380790 | 3300025909 | Bacteria | 536 |
| 109 | Ga0207694_10530472 | 3300025924 | Bacteria | 987 |
| 110 | Ga0207659_10332892 | 3300025926 | Bacteria | 1256 |
| 111 | Ga0207690_10053931 | 3300025932 | Bacteria | 2700 |
| 112 | Ga0207690_10603774 | 3300025932 | Bacteria | 896 |
| 113 | Ga0207709_10228219 | 3300025935 | Bacteria | 1347 |
| 114 | Ga0207667_10181444 | 3300025949 | Bacteria | 2161 |
| 115 | Ga0207712_10474090 | 3300025961 | Bacteria | 1065 |
| 116 | Ga0207668_10014251 | 3300025972 | Bacteria | 4918 |
| 117 | Ga0207639_10979536 | 3300026041 | Bacteria | 792 |
| 118 | Ga0207678_10015816 | 3300026067 | Bacteria | 6632 |
| 119 | Ga0207678_11062303 | 3300026067 | Bacteria | 717 |
| 120 | Ga0207708_11175379 | 3300026075 | Bacteria | 670 |
| 121 | Ga0207702_11205949 | 3300026078 | Bacteria | 751 |
| 122 | Ga0207641_10742929 | 3300026088 | Bacteria | 968 |
| 123 | Ga0207675_100034576 | 3300026118 | Bacteria | 4712 |
| 124 | Ga0207683_10340037 | 3300026121 | Bacteria | 1376 |
| 125 | Ga0268265_10292833 | 3300028380 | Bacteria | 1462 |
| 126 | Ga0307408_100533396 | 3300031548 | Bacteria | 1033 |
| 127 | Ga0307408_101791030 | 3300031548 | Bacteria | 587 |
| 128 | Ga0307405_10179911 | 3300031731 | Bacteria | 1517 |
| 129 | Ga0307410_10243120 | 3300031852 | Bacteria | 1396 |
| 130 | Ga0307410_10759550 | 3300031852 | Bacteria | 822 |
| 131 | Ga0307410_11303215 | 3300031852 | Bacteria | 635 |
| 132 | Ga0307406_11885595 | 3300031901 | Bacteria | 533 |
| 133 | Ga0307412_10185162 | 3300031911 | Bacteria | 1570 |
| 134 | Ga0307412_11386261 | 3300031911 | Bacteria | 636 |
| 135 | Ga0307412_11564496 | 3300031911 | Bacteria | 601 |
| 136 | Ga0307409_100147946 | 3300031995 | Bacteria | 2034 |
| 137 | Ga0307409_101681495 | 3300031995 | Bacteria | 663 |
| 138 | Ga0307409_102725409 | 3300031995 | Bacteria | 522 |
| 139 | Ga0307416_101286910 | 3300032002 | Bacteria | 837 |
| 140 | Ga0307414_10878450 | 3300032004 | Bacteria | 821 |
| 141 | Ga0307414_10939227 | 3300032004 | Bacteria | 794 |
| 142 | Ga0307414_11200259 | 3300032004 | Bacteria | 702 |
| 143 | Ga0307411_11520403 | 3300032005 | Bacteria | 616 |
| 144 | Ga0307415_100449818 | 3300032126 | Bacteria | 1113 |
| 145 | Ga0307415_100467378 | 3300032126 | Bacteria | 1095 |
| 146 | Ga0395899_0004424 | 3300037312 | Bacteria | 10959 |
| 147 | Ga0395899_0180964 | 3300037312 | Bacteria | 1480 |
| 148 | Ga0395899_0656821 | 3300037312 | Bacteria | 662 |
| 149 | Ga0395900_0016126 | 3300037418 | Bacteria | 7611 |
| 150 | Ga0395900_0068375 | 3300037418 | Bacteria | 3650 |
| 151 | Ga0395898_0000098 | 3300037466 | Bacteria | 229806 |
| 152 | Ga0395898_0691985 | 3300037466 | Bacteria | 961 |
| 153 | Ga0395901_0219619 | 3300038443 | Bacteria | 1987 |
| 154 | Ga0439465_0020834 | 3300041413 | Bacteria | 2055 |
| 155 | Ga0439465_0237709 | 3300041413 | Bacteria | 671 |
| 156 | Ga0451791_0450400 | 3300041451 | Bacteria | 582 |
| 157 | Ga0451791_1412632 | 3300041451 | Bacteria | 1539 |
| 158 | Ga0451793_1722092 | 3300041452 | Bacteria | 1446 |
| 159 | Ga0451797_0203594 | 3300041453 | Bacteria | 1851 |
| 160 | Ga0451807_2544469 | 3300041486 | Bacteria | 557 |
| 161 | Ga0451837_1079651 | 3300041494 | Bacteria | 899 |
| 162 | Ga0451839_0255006 | 3300041496 | Bacteria | 698 |
| 163 | Ga0466969_0282518 | 3300044656 | Bacteria | 751 |
| 164 | Ga0466972_0018988 | 3300044658 | Bacteria | 3436 |
| 165 | Ga0466972_0025736 | 3300044658 | Bacteria | 2915 |
| 166 | Ga0466972_0103350 | 3300044658 | Bacteria | 1348 |
| 167 | Ga0466972_0253055 | 3300044658 | Bacteria | 823 |
| 168 | Ga0466972_0413720 | 3300044658 | Bacteria | 632 |
| 169 | Ga0466965_0026140 | 3300044683 | Bacteria | 2829 |
| 170 | Ga0466965_0042727 | 3300044683 | Bacteria | 2237 |
| 171 | Ga0466965_0245859 | 3300044683 | Bacteria | 958 |
| 172 | Ga0466966_0074631 | 3300044684 | Bacteria | 2119 |
| 173 | Ga0466966_0152616 | 3300044684 | Bacteria | 1408 |
| 174 | Ga0466961_0026471 | 3300044693 | Bacteria | 3729 |
| 175 | Ga0466961_0037343 | 3300044693 | Bacteria | 3116 |
| 176 | Ga0466961_0198606 | 3300044693 | Bacteria | 1241 |
| 177 | Ga0466963_0245824 | 3300044694 | Bacteria | 1255 |
| 178 | Ga0466971_0085645 | 3300044719 | Bacteria | 1440 |
| 179 | Ga0466968_0016840 | 3300044735 | Bacteria | 2914 |
| 180 | Ga0466968_0029745 | 3300044735 | Bacteria | 2260 |
| 181 | Ga0466970_0002161 | 3300044765 | Bacteria | 9490 |
| 182 | Ga0466970_0023191 | 3300044765 | Bacteria | 3240 |
| 183 | Ga0466970_0054357 | 3300044765 | Bacteria | 2138 |
| 184 | Ga0466970_0070130 | 3300044765 | Bacteria | 1884 |
| 185 | Ga0466970_0083981 | 3300044765 | Bacteria | 1723 |
| 186 | Ga0466970_0177162 | 3300044765 | Bacteria | 1182 |
| 187 | Ga0466970_0970539 | 3300044765 | Bacteria | 501 |
| 188 | Ga0466957_0036016 | 3300044842 | Bacteria | 2972 |
| 189 | Ga0466957_0042923 | 3300044842 | Bacteria | 2737 |
| 190 | Ga0466960_0011963 | 3300044901 | Bacteria | 3650 |
| 191 | Ga0466960_0016118 | 3300044901 | Bacteria | 3235 |
| 192 | Ga0466959_0000751 | 3300045049 | Bacteria | 19010 |
| 193 | Ga0466959_0048995 | 3300045049 | Bacteria | 3103 |
| 194 | Ga0466959_0268110 | 3300045049 | Bacteria | 1174 |
| 195 | Ga0466958_0049970 | 3300045836 | Bacteria | 2531 |
| 196 | Ga0466958_1119700 | 3300045836 | Bacteria | 514 |
| 197 | Ga0495638_0487107 | 3300046460 | Bacteria | 623 |
| 198 | Ga0495650_0130132 | 3300046471 | Bacteria | 919 |
| 199 | Ga0495620_0228926 | 3300046515 | Bacteria | 711 |
| 200 | Ga0496101_0070209 | 3300048904 | Bacteria | 2564 |
| 201 | Ga0496101_0872280 | 3300048904 | Bacteria | 709 |
| 202 | Ga0496102_0058092 | 3300048905 | Bacteria | 3534 |
| 203 | Ga0496102_0131924 | 3300048905 | Bacteria | 2339 |
| 204 | Ga0496102_1490608 | 3300048905 | Bacteria | 595 |
| 205 | Ga0496102_1506352 | 3300048905 | Bacteria | 591 |
| 206 | Ga0496103_0210207 | 3300048906 | Bacteria | 1251 |
| 207 | Ga0496103_0441758 | 3300048906 | Bacteria | 835 |
| 208 | Ga0496104_0007959 | 3300048907 | Bacteria | 9398 |
| 209 | Ga0496104_0717022 | 3300048907 | Bacteria | 908 |
| 210 | Ga0496105_0013865 | 3300048908 | Bacteria | 6402 |
| 211 | Ga0496105_1044160 | 3300048908 | Bacteria | 609 |
| 212 | Ga0496106_0479776 | 3300048909 | Bacteria | 999 |
| 213 | Ga0496107_0446015 | 3300048910 | Bacteria | 961 |
| 214 | Ga0496110_0494941 | 3300048913 | Bacteria | 1113 |
| 215 | Ga0496111_0520197 | 3300048914 | Bacteria | 875 |
| 216 | Ga0496113_0178873 | 3300048916 | Bacteria | 1681 |
| 217 | Ga0496113_0398186 | 3300048916 | Bacteria | 1105 |
| 218 | Ga0496114_0245382 | 3300048917 | Bacteria | 1575 |
| 219 | Ga0496115_0103322 | 3300048918 | Bacteria | 2337 |
| 220 | Ga0496116_0084133 | 3300048919 | Bacteria | 1961 |
| 221 | Ga0496117_0000214 | 3300048920 | Bacteria | 111723 |
| 222 | Ga0496117_0005473 | 3300048920 | Bacteria | 13313 |
| 223 | Ga0496117_0043064 | 3300048920 | Bacteria | 3287 |
| 224 | Ga0496117_0058541 | 3300048920 | Bacteria | 2667 |
| 225 | Ga0496117_0148430 | 3300048920 | Bacteria | 1392 |
| 226 | Ga0496117_0191100 | 3300048920 | Bacteria | 1166 |
| 227 | Ga0496118_0004236 | 3300048921 | Bacteria | 17207 |
| 228 | Ga0496118_0145186 | 3300048921 | Bacteria | 1495 |
| 229 | Ga0496118_0193760 | 3300048921 | Bacteria | 1212 |
| 230 | Ga0496118_0235731 | 3300048921 | Bacteria | 1052 |
| 231 | Ga0496119_0141387 | 3300048922 | Bacteria | 1299 |
| 232 | Ga0496119_0222771 | 3300048922 | Bacteria | 964 |
| 233 | Ga0496119_0245502 | 3300048922 | Bacteria | 905 |
| 234 | Ga0496120_0035722 | 3300048923 | Bacteria | 2965 |
| 235 | Ga0496120_0087542 | 3300048923 | Bacteria | 1672 |
| 236 | Ga0496120_0090965 | 3300048923 | Bacteria | 1630 |
| 237 | Ga0496120_0351098 | 3300048923 | Bacteria | 662 |
| 238 | Ga0496121_0076212 | 3300048924 | Bacteria | 2675 |
| 239 | Ga0496122_0007228 | 3300048925 | Bacteria | 12423 |
| 240 | Ga0496122_0074501 | 3300048925 | Bacteria | 2401 |
| 241 | Ga0496122_0128019 | 3300048925 | Bacteria | 1621 |
| 242 | Ga0496122_0200101 | 3300048925 | Bacteria | 1169 |
| 243 | Ga0496122_0279944 | 3300048925 | Bacteria | 912 |
| 244 | Ga0496123_0031836 | 3300048926 | Bacteria | 3829 |
| 245 | Ga0496123_0075944 | 3300048926 | Bacteria | 2071 |
| 246 | Ga0496123_0143991 | 3300048926 | Bacteria | 1298 |
| 247 | Ga0496124_0000037 | 3300048927 | Bacteria | 317430 |
| 248 | Ga0496124_0014081 | 3300048927 | Bacteria | 7756 |
| 249 | Ga0496124_0186511 | 3300048927 | Bacteria | 1591 |
| 250 | Ga0496125_0320415 | 3300048928 | Bacteria | 940 |
| 251 | Ga0496126_0001681 | 3300048929 | Bacteria | 33084 |
| 252 | Ga0496126_0215889 | 3300048929 | Bacteria | 1613 |
| 253 | Ga0496126_0930881 | 3300048929 | Bacteria | 657 |
| 254 | Ga0496126_0986945 | 3300048929 | Bacteria | 633 |
| 255 | Ga0501031_0028007 | 3300049568 | Bacteria | 3672 |
| 256 | Ga0501032_0039750 | 3300049569 | Bacteria | 3198 |
| 257 | Ga0501033_0006733 | 3300049570 | Bacteria | 8975 |
| 258 | Ga0501033_0244436 | 3300049570 | Bacteria | 1273 |
| 259 | Ga0501034_0003150 | 3300049571 | Bacteria | 18978 |
| 260 | Ga0501034_0008918 | 3300049571 | Bacteria | 10542 |
| 261 | Ga0501034_0362823 | 3300049571 | Bacteria | 1376 |
| 262 | Ga0501037_0014170 | 3300049573 | Bacteria | 5869 |
| 263 | Ga0501037_0357070 | 3300049573 | Bacteria | 1007 |
| 264 | Ga0501037_0391617 | 3300049573 | Bacteria | 954 |
| 265 | Ga0501038_0007553 | 3300049574 | Bacteria | 10022 |
| 266 | Ga0501038_0027818 | 3300049574 | Bacteria | 5025 |
| 267 | Ga0501038_0279350 | 3300049574 | Bacteria | 1315 |
| 268 | Ga0501039_0011105 | 3300049575 | Bacteria | 6864 |
| 269 | Ga0501040_0364895 | 3300049576 | Bacteria | 1035 |
| 270 | Ga0501043_0068543 | 3300049579 | Bacteria | 2785 |
| 271 | Ga0501043_0382961 | 3300049579 | Bacteria | 1065 |
| 272 | Ga0501046_0004157 | 3300049580 | Bacteria | 13178 |
| 273 | Ga0501046_0060309 | 3300049580 | Bacteria | 2968 |
| 274 | Ga0501046_0768503 | 3300049580 | Bacteria | 676 |
| 275 | Ga0501047_0008677 | 3300049581 | Bacteria | 9597 |
| 276 | Ga0501047_0047602 | 3300049581 | Bacteria | 4141 |
| 277 | Ga0501047_0126876 | 3300049581 | Bacteria | 2432 |
| 278 | Ga0501047_0189042 | 3300049581 | Bacteria | 1923 |
| 279 | Ga0501047_0376318 | 3300049581 | Bacteria | 1255 |
| 280 | Ga0501047_1195988 | 3300049581 | Bacteria | 574 |
| 281 | Ga0501048_0002778 | 3300049582 | Bacteria | 13359 |
| 282 | Ga0501048_0304124 | 3300049582 | Bacteria | 1135 |
| 283 | Ga0501068_0023750 | 3300049584 | Bacteria | 3595 |
| 284 | Ga0501070_0000044 | 3300049586 | Bacteria | 108859 |
| 285 | Ga0501070_0016335 | 3300049586 | Bacteria | 6234 |
| 286 | Ga0501070_0222030 | 3300049586 | Bacteria | 1549 |
| 287 | Ga0501071_0417839 | 3300049587 | Bacteria | 1025 |
| 288 | Ga0501072_0893177 | 3300049588 | Bacteria | 694 |
| 289 | Ga0501080_0290556 | 3300049742 | Bacteria | 1484 |
| 290 | Ga0501035_0017915 | 3300049822 | Bacteria | 6532 |
| 291 | Ga0501035_0029829 | 3300049822 | Bacteria | 4974 |
| 292 | Ga0501035_0090933 | 3300049822 | Bacteria | 2687 |
| 293 | Ga0501044_0006111 | 3300049823 | Bacteria | 13288 |
| 294 | Ga0501044_0073054 | 3300049823 | Bacteria | 3486 |
| 295 | Ga0501044_0507753 | 3300049823 | Bacteria | 1106 |
| 296 | Ga0501044_0817773 | 3300049823 | Bacteria | 810 |
| 297 | Ga0501045_0024463 | 3300049824 | Bacteria | 4336 |
| 298 | Ga0501045_0818078 | 3300049824 | Bacteria | 686 |
| 299 | nmdc:mga08y16_426833_c1 | 3300050511 | Bacteria | 1354 |
| 300 | nmdc:mga0sz30_40146_c1 | 3300050516 | Bacteria | 1300 |
| 301 | Ga0500573_0017767 | 3300053140 | Bacteria | 4051 |
| 302 | Ga0500616_0000021 | 3300053153 | Bacteria | 484527 |
| 303 | Ga0587071_116199 | 3300060344 | Bacteria | 634 |
| 304 | Ga0466962_0018951 | 3300061719 | Bacteria | 3306 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049824 | Ga0501045_0818078 | Ga0501045_0818078_24_236 | 70 |
| 2 | 3300044658 | Ga0466972_0018988 | Ga0466972_0018988_827_1072 | 71 |
| 3 | 3300044683 | Ga0466965_0026140 | Ga0466965_0026140_851_1096 | 71 |
| 4 | 3300044684 | Ga0466966_0074631 | Ga0466966_0074631_378_623 | 71 |
| 5 | 3300044693 | Ga0466961_0037343 | Ga0466961_0037343_2351_2596 | 71 |
| 6 | 3300044694 | Ga0466963_0245824 | Ga0466963_0245824_231_476 | 71 |
| 7 | 3300044719 | Ga0466971_0085645 | Ga0466971_0085645_1150_1395 | 71 |
| 8 | 3300044735 | Ga0466968_0016840 | Ga0466968_0016840_59_304 | 71 |
| 9 | 3300044765 | Ga0466970_0083981 | Ga0466970_0083981_175_420 | 71 |
| 10 | 3300044842 | Ga0466957_0036016 | Ga0466957_0036016_845_1090 | 71 |
| 11 | 3300044901 | Ga0466960_0016118 | Ga0466960_0016118_967_1212 | 71 |
| 12 | 3300045049 | Ga0466959_0048995 | Ga0466959_0048995_835_1080 | 71 |
| 13 | 3300045836 | Ga0466958_0049970 | Ga0466958_0049970_1732_1977 | 71 |
| 14 | 3300061719 | Ga0466962_0018951 | Ga0466962_0018951_274_519 | 71 |
| 15 | iso_pu_bacteria | 2585428094 | 2587864810 | 75 |
| 16 | iso_pu_bacteria | 2643221649 | 2644277541 | 75 |
| 17 | iso_pu_bacteria | 2844852863 | 2844855754 | 75 |
| 18 | iso_pu_bacteria | 8056037122 | 8056039622 | 75 |
| 19 | iso_pu_bacteria | 8057345674 | 8057348484 | 75 |
| 20 | iso_pu_bacteria | 2643221572 | 2643874669 | 76 |
| 21 | iso_pu_bacteria | 2643221669 | 2644381725 | 76 |
| 22 | iso_pu_bacteria | 2751185788 | 2753302376 | 76 |
| 23 | iso_pu_bacteria | 2857729791 | 2857732255 | 76 |
| 24 | iso_pu_bacteria | 2895660088 | 2895662960 | 76 |
| 25 | iso_pu_bacteria | 2904430863 | 2904432849 | 76 |
| 26 | iso_pu_bacteria | 2904501621 | 2904503301 | 76 |
| 27 | iso_pu_bacteria | 2908674828 | 2908675522 | 76 |
| 28 | iso_pu_bacteria | 2909074476 | 2909074578 | 76 |
| 29 | iso_pu_bacteria | 2919039151 | 2919041409 | 76 |
| 30 | iso_pu_bacteria | 2919042368 | 2919045534 | 76 |
| 31 | iso_pu_bacteria | 2928104781 | 2928108183 | 76 |
| 32 | iso_pu_bacteria | 2928121344 | 2928124853 | 76 |
| 33 | iso_pu_bacteria | 2928500415 | 2928500506 | 76 |
| 34 | iso_pu_bacteria | 2939660829 | 2939663095 | 76 |
| 35 | iso_pu_bacteria | 2964326757 | 2964329066 | 76 |
| 36 | iso_pu_bacteria | 2966921586 | 2966921821 | 76 |
| 37 | iso_pu_bacteria | 2966924647 | 2966926208 | 76 |
| 38 | iso_pu_bacteria | 2984551494 | 2984554543 | 76 |
| 39 | iso_pu_bacteria | 8046352972 | 8046355800 | 76 |
| 40 | 3300048929 | Ga0496126_0930881 | Ga0496126_0930881_44_277 | 77 |
| 41 | 3300049822 | Ga0501035_0090933 | Ga0501035_0090933_1715_1960 | 77 |
| 42 | 3300048923 | Ga0496120_0351098 | Ga0496120_0351098_380_616 | 78 |
| 43 | 3300003162 | Ga0006778J45830_1064922 | Ga0006778J45830_10649222 | 79 |
| 44 | 3300003163 | Ga0006759J45824_1040136 | Ga0006759J45824_10401362 | 79 |
| 45 | 3300005288 | Ga0065714_10199479 | Ga0065714_101994792 | 79 |
| 46 | 3300005455 | Ga0070663_102134689 | Ga0070663_1021346892 | 79 |
| 47 | 3300005466 | Ga0070685_10734558 | Ga0070685_107345582 | 79 |
| 48 | 3300006186 | Ga0075369_10094728 | Ga0075369_100947282 | 79 |
| 49 | 3300041494 | Ga0451837_1079651 | Ga0451837_1079651_542_784 | 79 |
| 50 | 3300048920 | Ga0496117_0000214 | Ga0496117_0000214_80529_80768 | 79 |
| 51 | 3300048925 | Ga0496122_0007228 | Ga0496122_0007228_6663_6902 | 79 |
| 52 | 3300048926 | Ga0496123_0031836 | Ga0496123_0031836_3024_3263 | 79 |
| 53 | 3300049574 | Ga0501038_0279350 | Ga0501038_0279350_608_847 | 79 |
| 54 | 3300049579 | Ga0501043_0382961 | Ga0501043_0382961_167_406 | 79 |
| 55 | 3300049580 | Ga0501046_0768503 | Ga0501046_0768503_363_602 | 79 |
| 56 | 3300049581 | Ga0501047_0126876 | Ga0501047_0126876_371_613 | 79 |
| 57 | 3300049581 | Ga0501047_0376318 | Ga0501047_0376318_807_1046 | 79 |
| 58 | 3300049581 | Ga0501047_1195988 | Ga0501047_1195988_162_401 | 79 |
| 59 | 3300049823 | Ga0501044_0507753 | Ga0501044_0507753_206_445 | 79 |
| 60 | 3300049823 | Ga0501044_0817773 | Ga0501044_0817773_235_477 | 79 |
| 61 | 3300050516 | nmdc:mga0sz30_40146_c1 | nmdc:mga0sz30_40146_c1_963_1202 | 79 |
| 62 | 3300053153 | Ga0500616_0000021 | Ga0500616_0000021_75616_75855 | 79 |
| 63 | 3300003323 | rootH1_10028438 | rootH1_100284383 | 80 |
| 64 | 3300004800 | Ga0058861_11708186 | Ga0058861_117081861 | 80 |
| 65 | 3300005288 | Ga0065714_10069957 | Ga0065714_100699574 | 80 |
| 66 | 3300005288 | Ga0065714_10115003 | Ga0065714_101150033 | 80 |
| 67 | 3300005288 | Ga0065714_10407926 | Ga0065714_104079261 | 80 |
| 68 | 3300005327 | Ga0070658_10142100 | Ga0070658_101421004 | 80 |
| 69 | 3300005366 | Ga0070659_100011520 | Ga0070659_1000115202 | 80 |
| 70 | 3300005366 | Ga0070659_101014368 | Ga0070659_1010143681 | 80 |
| 71 | 3300005455 | Ga0070663_101120548 | Ga0070663_1011205482 | 80 |
| 72 | 3300005456 | Ga0070678_100033456 | Ga0070678_1000334562 | 80 |
| 73 | 3300005546 | Ga0070696_101848899 | Ga0070696_1018488992 | 80 |
| 74 | 3300005563 | Ga0068855_100054400 | Ga0068855_1000544002 | 80 |
| 75 | 3300005577 | Ga0068857_100254047 | Ga0068857_1002540472 | 80 |
| 76 | 3300005719 | Ga0068861_100045958 | Ga0068861_1000459582 | 80 |
| 77 | 3300005841 | Ga0068863_101608107 | Ga0068863_1016081071 | 80 |
| 78 | 3300005844 | Ga0068862_100127046 | Ga0068862_1001270463 | 80 |
| 79 | 3300006051 | Ga0075364_10883182 | Ga0075364_108831822 | 80 |
| 80 | 3300009094 | Ga0111539_10905102 | Ga0111539_109051022 | 80 |
| 81 | 3300009148 | Ga0105243_10153344 | Ga0105243_101533443 | 80 |
| 82 | 3300009551 | Ga0105238_11247463 | Ga0105238_112474632 | 80 |
| 83 | 3300009553 | Ga0105249_10527299 | Ga0105249_105272992 | 80 |
| 84 | 3300011119 | Ga0105246_10542761 | Ga0105246_105427612 | 80 |
| 85 | 3300013102 | Ga0157371_10797031 | Ga0157371_107970312 | 80 |
| 86 | 3300013104 | Ga0157370_10066733 | Ga0157370_100667332 | 80 |
| 87 | 3300013105 | Ga0157369_10000103 | Ga0157369_1000010384 | 80 |
| 88 | 3300013306 | Ga0163162_10412453 | Ga0163162_104124533 | 80 |
| 89 | 3300013306 | Ga0163162_11554975 | Ga0163162_115549752 | 80 |
| 90 | 3300013308 | Ga0157375_12652254 | Ga0157375_126522542 | 80 |
| 91 | 3300014325 | Ga0163163_10850292 | Ga0163163_108502922 | 80 |
| 92 | 3300014326 | Ga0157380_10014176 | Ga0157380_100141762 | 80 |
| 93 | 3300020069 | Ga0197907_10611759 | Ga0197907_106117592 | 80 |
| 94 | 3300020069 | Ga0197907_11048472 | Ga0197907_110484722 | 80 |
| 95 | 3300020076 | Ga0206355_1084907 | Ga0206355_10849072 | 80 |
| 96 | 3300020076 | Ga0206355_1217027 | Ga0206355_12170272 | 80 |
| 97 | 3300020077 | Ga0206351_10042865 | Ga0206351_100428651 | 80 |
| 98 | 3300020077 | Ga0206351_10801304 | Ga0206351_108013042 | 80 |
| 99 | 3300020080 | Ga0206350_10391679 | Ga0206350_103916792 | 80 |
| 100 | 3300020610 | Ga0154015_1015292 | Ga0154015_10152922 | 80 |
| 101 | 3300025901 | Ga0207688_10235677 | Ga0207688_102356772 | 80 |
| 102 | 3300025904 | Ga0207647_10085598 | Ga0207647_100855983 | 80 |
| 103 | 3300025907 | Ga0207645_10631317 | Ga0207645_106313172 | 80 |
| 104 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011780 | 80 |
| 105 | 3300025909 | Ga0207705_10151685 | Ga0207705_101516853 | 80 |
| 106 | 3300025909 | Ga0207705_11380790 | Ga0207705_113807902 | 80 |
| 107 | 3300025924 | Ga0207694_10530472 | Ga0207694_105304722 | 80 |
| 108 | 3300025926 | Ga0207659_10332892 | Ga0207659_103328922 | 80 |
| 109 | 3300025932 | Ga0207690_10053931 | Ga0207690_100539313 | 80 |
| 110 | 3300025932 | Ga0207690_10603774 | Ga0207690_106037741 | 80 |
| 111 | 3300025935 | Ga0207709_10228219 | Ga0207709_102282192 | 80 |
| 112 | 3300025949 | Ga0207667_10181444 | Ga0207667_101814443 | 80 |
| 113 | 3300025961 | Ga0207712_10474090 | Ga0207712_104740902 | 80 |
| 114 | 3300025972 | Ga0207668_10014251 | Ga0207668_100142515 | 80 |
| 115 | 3300026067 | Ga0207678_10015816 | Ga0207678_100158163 | 80 |
| 116 | 3300026067 | Ga0207678_11062303 | Ga0207678_110623031 | 80 |
| 117 | 3300026075 | Ga0207708_11175379 | Ga0207708_111753792 | 80 |
| 118 | 3300026088 | Ga0207641_10742929 | Ga0207641_107429291 | 80 |
| 119 | 3300026118 | Ga0207675_100034576 | Ga0207675_1000345762 | 80 |
| 120 | 3300026121 | Ga0207683_10340037 | Ga0207683_103400372 | 80 |
| 121 | 3300028380 | Ga0268265_10292833 | Ga0268265_102928331 | 80 |
| 122 | 3300031548 | Ga0307408_100533396 | Ga0307408_1005333962 | 80 |
| 123 | 3300031548 | Ga0307408_101791030 | Ga0307408_1017910302 | 80 |
| 124 | 3300031731 | Ga0307405_10179911 | Ga0307405_101799112 | 80 |
| 125 | 3300031852 | Ga0307410_10243120 | Ga0307410_102431202 | 80 |
| 126 | 3300031852 | Ga0307410_10759550 | Ga0307410_107595502 | 80 |
| 127 | 3300031852 | Ga0307410_11303215 | Ga0307410_113032152 | 80 |
| 128 | 3300031901 | Ga0307406_11885595 | Ga0307406_118855952 | 80 |
| 129 | 3300031911 | Ga0307412_10185162 | Ga0307412_101851622 | 80 |
| 130 | 3300031911 | Ga0307412_11386261 | Ga0307412_113862611 | 80 |
| 131 | 3300031911 | Ga0307412_11564496 | Ga0307412_115644962 | 80 |
| 132 | 3300031995 | Ga0307409_100147946 | Ga0307409_1001479462 | 80 |
| 133 | 3300031995 | Ga0307409_101681495 | Ga0307409_1016814952 | 80 |
| 134 | 3300031995 | Ga0307409_102725409 | Ga0307409_1027254091 | 80 |
| 135 | 3300032002 | Ga0307416_101286910 | Ga0307416_1012869102 | 80 |
| 136 | 3300032004 | Ga0307414_10878450 | Ga0307414_108784502 | 80 |
| 137 | 3300032004 | Ga0307414_10939227 | Ga0307414_109392272 | 80 |
| 138 | 3300032004 | Ga0307414_11200259 | Ga0307414_112002592 | 80 |
| 139 | 3300032005 | Ga0307411_11520403 | Ga0307411_115204032 | 80 |
| 140 | 3300032126 | Ga0307415_100449818 | Ga0307415_1004498181 | 80 |
| 141 | 3300032126 | Ga0307415_100467378 | Ga0307415_1004673782 | 80 |
| 142 | 3300041413 | Ga0439465_0020834 | Ga0439465_0020834_843_1097 | 80 |
| 143 | 3300041413 | Ga0439465_0237709 | Ga0439465_0237709_37_294 | 80 |
| 144 | 3300041451 | Ga0451791_0450400 | Ga0451791_0450400_326_568 | 80 |
| 145 | 3300041451 | Ga0451791_1412632 | Ga0451791_1412632_1101_1352 | 80 |
| 146 | 3300041452 | Ga0451793_1722092 | Ga0451793_1722092_357_599 | 80 |
| 147 | 3300041453 | Ga0451797_0203594 | Ga0451797_0203594_1363_1614 | 80 |
| 148 | 3300041486 | Ga0451807_2544469 | Ga0451807_2544469_304_546 | 80 |
| 149 | 3300041496 | Ga0451839_0255006 | Ga0451839_0255006_222_473 | 80 |
| 150 | 3300044656 | Ga0466969_0282518 | Ga0466969_0282518_374_616 | 80 |
| 151 | 3300044735 | Ga0466968_0029745 | Ga0466968_0029745_176_418 | 80 |
| 152 | 3300044765 | Ga0466970_0023191 | Ga0466970_0023191_174_416 | 80 |
| 153 | 3300044765 | Ga0466970_0177162 | Ga0466970_0177162_668_916 | 80 |
| 154 | 3300046460 | Ga0495638_0487107 | Ga0495638_0487107_285_542 | 80 |
| 155 | 3300046471 | Ga0495650_0130132 | Ga0495650_0130132_613_855 | 80 |
| 156 | 3300046515 | Ga0495620_0228926 | Ga0495620_0228926_83_325 | 80 |
| 157 | 3300048904 | Ga0496101_0872280 | Ga0496101_0872280_328_570 | 80 |
| 158 | 3300048905 | Ga0496102_0131924 | Ga0496102_0131924_1492_1734 | 80 |
| 159 | 3300048905 | Ga0496102_1490608 | Ga0496102_1490608_133_390 | 80 |
| 160 | 3300048906 | Ga0496103_0441758 | Ga0496103_0441758_252_494 | 80 |
| 161 | 3300048907 | Ga0496104_0717022 | Ga0496104_0717022_64_306 | 80 |
| 162 | 3300048908 | Ga0496105_1044160 | Ga0496105_1044160_272_514 | 80 |
| 163 | 3300048916 | Ga0496113_0178873 | Ga0496113_0178873_133_390 | 80 |
| 164 | 3300048920 | Ga0496117_0005473 | Ga0496117_0005473_8673_8915 | 80 |
| 165 | 3300048920 | Ga0496117_0191100 | Ga0496117_0191100_728_979 | 80 |
| 166 | 3300048921 | Ga0496118_0004236 | Ga0496118_0004236_8273_8515 | 80 |
| 167 | 3300048921 | Ga0496118_0235731 | Ga0496118_0235731_183_434 | 80 |
| 168 | 3300048922 | Ga0496119_0222771 | Ga0496119_0222771_85_327 | 80 |
| 169 | 3300048922 | Ga0496119_0245502 | Ga0496119_0245502_50_292 | 80 |
| 170 | 3300048923 | Ga0496120_0035722 | Ga0496120_0035722_2121_2363 | 80 |
| 171 | 3300048923 | Ga0496120_0090965 | Ga0496120_0090965_10_252 | 80 |
| 172 | 3300048925 | Ga0496122_0074501 | Ga0496122_0074501_312_554 | 80 |
| 173 | 3300048925 | Ga0496122_0200101 | Ga0496122_0200101_451_693 | 80 |
| 174 | 3300048925 | Ga0496122_0279944 | Ga0496122_0279944_50_313 | 80 |
| 175 | 3300048926 | Ga0496123_0075944 | Ga0496123_0075944_27_290 | 80 |
| 176 | 3300048926 | Ga0496123_0143991 | Ga0496123_0143991_400_651 | 80 |
| 177 | 3300048927 | Ga0496124_0000037 | Ga0496124_0000037_32876_33118 | 80 |
| 178 | 3300048927 | Ga0496124_0014081 | Ga0496124_0014081_6892_7134 | 80 |
| 179 | 3300048927 | Ga0496124_0186511 | Ga0496124_0186511_1193_1435 | 80 |
| 180 | 3300048928 | Ga0496125_0320415 | Ga0496125_0320415_49_309 | 80 |
| 181 | 3300048929 | Ga0496126_0001681 | Ga0496126_0001681_7594_7836 | 80 |
| 182 | 3300048929 | Ga0496126_0215889 | Ga0496126_0215889_955_1197 | 80 |
| 183 | 3300048929 | Ga0496126_0986945 | Ga0496126_0986945_167_418 | 80 |
| 184 | 3300049568 | Ga0501031_0028007 | Ga0501031_0028007_2846_3088 | 80 |
| 185 | 3300049569 | Ga0501032_0039750 | Ga0501032_0039750_2778_3020 | 80 |
| 186 | 3300049570 | Ga0501033_0006733 | Ga0501033_0006733_5503_5745 | 80 |
| 187 | 3300049571 | Ga0501034_0003150 | Ga0501034_0003150_2895_3137 | 80 |
| 188 | 3300049571 | Ga0501034_0008918 | Ga0501034_0008918_4441_4695 | 80 |
| 189 | 3300049573 | Ga0501037_0014170 | Ga0501037_0014170_4925_5167 | 80 |
| 190 | 3300049573 | Ga0501037_0357070 | Ga0501037_0357070_387_641 | 80 |
| 191 | 3300049574 | Ga0501038_0007553 | Ga0501038_0007553_1499_1741 | 80 |
| 192 | 3300049575 | Ga0501039_0011105 | Ga0501039_0011105_5502_5744 | 80 |
| 193 | 3300049576 | Ga0501040_0364895 | Ga0501040_0364895_25_267 | 80 |
| 194 | 3300049579 | Ga0501043_0068543 | Ga0501043_0068543_194_436 | 80 |
| 195 | 3300049580 | Ga0501046_0004157 | Ga0501046_0004157_7381_7623 | 80 |
| 196 | 3300049580 | Ga0501046_0060309 | Ga0501046_0060309_2695_2949 | 80 |
| 197 | 3300049581 | Ga0501047_0008677 | Ga0501047_0008677_7252_7506 | 80 |
| 198 | 3300049581 | Ga0501047_0047602 | Ga0501047_0047602_3875_4117 | 80 |
| 199 | 3300049581 | Ga0501047_0189042 | Ga0501047_0189042_1499_1741 | 80 |
| 200 | 3300049582 | Ga0501048_0002778 | Ga0501048_0002778_10807_11049 | 80 |
| 201 | 3300049582 | Ga0501048_0304124 | Ga0501048_0304124_238_492 | 80 |
| 202 | 3300049584 | Ga0501068_0023750 | Ga0501068_0023750_128_370 | 80 |
| 203 | 3300049586 | Ga0501070_0016335 | Ga0501070_0016335_672_914 | 80 |
| 204 | 3300049586 | Ga0501070_0222030 | Ga0501070_0222030_1223_1477 | 80 |
| 205 | 3300049587 | Ga0501071_0417839 | Ga0501071_0417839_645_902 | 80 |
| 206 | 3300049588 | Ga0501072_0893177 | Ga0501072_0893177_279_521 | 80 |
| 207 | 3300049742 | Ga0501080_0290556 | Ga0501080_0290556_51_293 | 80 |
| 208 | 3300049822 | Ga0501035_0029829 | Ga0501035_0029829_4682_4924 | 80 |
| 209 | 3300049823 | Ga0501044_0006111 | Ga0501044_0006111_2587_2841 | 80 |
| 210 | 3300049823 | Ga0501044_0073054 | Ga0501044_0073054_993_1235 | 80 |
| 211 | 3300049824 | Ga0501045_0024463 | Ga0501045_0024463_2100_2342 | 80 |
| 212 | 3300050511 | nmdc:mga08y16_426833_c1 | nmdc:mga08y16_426833_c1_1051_1308 | 80 |
| 213 | 3300053140 | Ga0500573_0017767 | Ga0500573_0017767_111_353 | 80 |
| 214 | 3300001979 | JGI24740J21852_10033442 | JGI24740J21852_100334422 | 81 |
| 215 | 3300001989 | JGI24739J22299_10067158 | JGI24739J22299_100671583 | 81 |
| 216 | 3300001990 | JGI24737J22298_10026599 | JGI24737J22298_100265993 | 81 |
| 217 | 3300002067 | JGI24735J21928_10001873 | JGI24735J21928_100018734 | 81 |
| 218 | 3300002067 | JGI24735J21928_10217997 | JGI24735J21928_102179971 | 81 |
| 219 | 3300002075 | JGI24738J21930_10098915 | JGI24738J21930_100989152 | 81 |
| 220 | 3300003577 | Ga0007416J51690_1012623 | Ga0007416J51690_10126232 | 81 |
| 221 | 3300003578 | Ga0006562J51391_1032259 | Ga0006562J51391_10322595 | 81 |
| 222 | 3300003578 | Ga0006562J51391_1032261 | Ga0006562J51391_10322617 | 81 |
| 223 | 3300003693 | Ga0032354_1067602 | Ga0032354_10676022 | 81 |
| 224 | 3300003752 | Ga0055539_1000027 | Ga0055539_1000027123 | 81 |
| 225 | 3300003756 | Ga0055533_1000020 | Ga0055533_1000020123 | 81 |
| 226 | 3300005327 | Ga0070658_10050727 | Ga0070658_100507273 | 81 |
| 227 | 3300005337 | Ga0070682_100281146 | Ga0070682_1002811462 | 81 |
| 228 | 3300005539 | Ga0068853_101123593 | Ga0068853_1011235931 | 81 |
| 229 | 3300005577 | Ga0068857_101838425 | Ga0068857_1018384252 | 81 |
| 230 | 3300005614 | Ga0068856_101518089 | Ga0068856_1015180892 | 81 |
| 231 | 3300010375 | Ga0105239_11021299 | Ga0105239_110212992 | 81 |
| 232 | 3300013059 | Ga0154012_146067 | Ga0154012_1460672 | 81 |
| 233 | 3300013062 | Ga0154010_110445 | Ga0154010_1104452 | 81 |
| 234 | 3300013102 | Ga0157371_10276854 | Ga0157371_102768542 | 81 |
| 235 | 3300013104 | Ga0157370_10410155 | Ga0157370_104101552 | 81 |
| 236 | 3300013105 | Ga0157369_10150744 | Ga0157369_101507442 | 81 |
| 237 | 3300013105 | Ga0157369_11175084 | Ga0157369_111750842 | 81 |
| 238 | 3300013105 | Ga0157369_11782457 | Ga0157369_117824572 | 81 |
| 239 | 3300013307 | Ga0157372_11197366 | Ga0157372_111973662 | 81 |
| 240 | 3300013307 | Ga0157372_12366871 | Ga0157372_123668712 | 81 |
| 241 | 3300020070 | Ga0206356_10087887 | Ga0206356_100878872 | 81 |
| 242 | 3300020075 | Ga0206349_1565693 | Ga0206349_15656932 | 81 |
| 243 | 3300020075 | Ga0206349_1763143 | Ga0206349_17631433 | 81 |
| 244 | 3300020076 | Ga0206355_1150177 | Ga0206355_11501772 | 81 |
| 245 | 3300020076 | Ga0206355_1500899 | Ga0206355_15008991 | 81 |
| 246 | 3300020077 | Ga0206351_10250689 | Ga0206351_102506892 | 81 |
| 247 | 3300020077 | Ga0206351_10258678 | Ga0206351_102586782 | 81 |
| 248 | 3300020077 | Ga0206351_10311684 | Ga0206351_103116842 | 81 |
| 249 | 3300020078 | Ga0206352_10227677 | Ga0206352_102276772 | 81 |
| 250 | 3300020078 | Ga0206352_10595782 | Ga0206352_105957822 | 81 |
| 251 | 3300020081 | Ga0206354_10055379 | Ga0206354_100553796 | 81 |
| 252 | 3300020082 | Ga0206353_10131355 | Ga0206353_101313557 | 81 |
| 253 | 3300020082 | Ga0206353_10225926 | Ga0206353_102259262 | 81 |
| 254 | 3300020610 | Ga0154015_1104577 | Ga0154015_11045772 | 81 |
| 255 | 3300020610 | Ga0154015_1119081 | Ga0154015_11190812 | 81 |
| 256 | 3300020610 | Ga0154015_1216335 | Ga0154015_12163352 | 81 |
| 257 | 3300022467 | Ga0224712_10016598 | Ga0224712_100165982 | 81 |
| 258 | 3300022467 | Ga0224712_10092639 | Ga0224712_100926392 | 81 |
| 259 | 3300022467 | Ga0224712_10177316 | Ga0224712_101773162 | 81 |
| 260 | 3300025225 | Ga0209566_100043 | Ga0209566_10004336 | 81 |
| 261 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013774 | 81 |
| 262 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013774 | 81 |
| 263 | 3300025230 | Ga0209563_102996 | Ga0209563_1029962 | 81 |
| 264 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013774 | 81 |
| 265 | 3300025272 | Ga0209455_1001354 | Ga0209455_10013543 | 81 |
| 266 | 3300025303 | Ga0209051_1086170 | Ga0209051_10861702 | 81 |
| 267 | 3300025904 | Ga0207647_10074902 | Ga0207647_100749022 | 81 |
| 268 | 3300025904 | Ga0207647_10152327 | Ga0207647_101523273 | 81 |
| 269 | 3300025904 | Ga0207647_10613550 | Ga0207647_106135502 | 81 |
| 270 | 3300025909 | Ga0207705_10092369 | Ga0207705_100923693 | 81 |
| 271 | 3300026041 | Ga0207639_10979536 | Ga0207639_109795362 | 81 |
| 272 | 3300026078 | Ga0207702_11205949 | Ga0207702_112059492 | 81 |
| 273 | 3300037312 | Ga0395899_0004424 | Ga0395899_0004424_918_1163 | 81 |
| 274 | 3300037312 | Ga0395899_0180964 | Ga0395899_0180964_172_417 | 81 |
| 275 | 3300037312 | Ga0395899_0656821 | Ga0395899_0656821_302_547 | 81 |
| 276 | 3300037418 | Ga0395900_0016126 | Ga0395900_0016126_1350_1595 | 81 |
| 277 | 3300037418 | Ga0395900_0068375 | Ga0395900_0068375_1677_1922 | 81 |
| 278 | 3300037466 | Ga0395898_0000098 | Ga0395898_0000098_135938_136183 | 81 |
| 279 | 3300037466 | Ga0395898_0691985 | Ga0395898_0691985_266_511 | 81 |
| 280 | 3300038443 | Ga0395901_0219619 | Ga0395901_0219619_1459_1704 | 81 |
| 281 | 3300044658 | Ga0466972_0025736 | Ga0466972_0025736_2260_2505 | 81 |
| 282 | 3300044658 | Ga0466972_0103350 | Ga0466972_0103350_551_799 | 81 |
| 283 | 3300044658 | Ga0466972_0253055 | Ga0466972_0253055_235_480 | 81 |
| 284 | 3300044658 | Ga0466972_0413720 | Ga0466972_0413720_267_515 | 81 |
| 285 | 3300044683 | Ga0466965_0042727 | Ga0466965_0042727_1506_1751 | 81 |
| 286 | 3300044683 | Ga0466965_0245859 | Ga0466965_0245859_52_300 | 81 |
| 287 | 3300044684 | Ga0466966_0152616 | Ga0466966_0152616_220_465 | 81 |
| 288 | 3300044693 | Ga0466961_0026471 | Ga0466961_0026471_1548_1793 | 81 |
| 289 | 3300044693 | Ga0466961_0198606 | Ga0466961_0198606_548_796 | 81 |
| 290 | 3300044765 | Ga0466970_0002161 | Ga0466970_0002161_271_516 | 81 |
| 291 | 3300044765 | Ga0466970_0054357 | Ga0466970_0054357_1549_1794 | 81 |
| 292 | 3300044765 | Ga0466970_0070130 | Ga0466970_0070130_1216_1464 | 81 |
| 293 | 3300044765 | Ga0466970_0970539 | Ga0466970_0970539_183_431 | 81 |
| 294 | 3300044842 | Ga0466957_0042923 | Ga0466957_0042923_2214_2462 | 81 |
| 295 | 3300044901 | Ga0466960_0011963 | Ga0466960_0011963_1087_1335 | 81 |
| 296 | 3300045049 | Ga0466959_0000751 | Ga0466959_0000751_12987_13232 | 81 |
| 297 | 3300045049 | Ga0466959_0268110 | Ga0466959_0268110_657_905 | 81 |
| 298 | 3300045836 | Ga0466958_1119700 | Ga0466958_1119700_19_264 | 81 |
| 299 | 3300048904 | Ga0496101_0070209 | Ga0496101_0070209_885_1130 | 81 |
| 300 | 3300048905 | Ga0496102_0058092 | Ga0496102_0058092_725_970 | 81 |
| 301 | 3300048905 | Ga0496102_1506352 | Ga0496102_1506352_164_409 | 81 |
| 302 | 3300048906 | Ga0496103_0210207 | Ga0496103_0210207_981_1226 | 81 |
| 303 | 3300048907 | Ga0496104_0007959 | Ga0496104_0007959_4144_4389 | 81 |
| 304 | 3300048908 | Ga0496105_0013865 | Ga0496105_0013865_387_632 | 81 |
| 305 | 3300048909 | Ga0496106_0479776 | Ga0496106_0479776_393_638 | 81 |
| 306 | 3300048910 | Ga0496107_0446015 | Ga0496107_0446015_578_823 | 81 |
| 307 | 3300048913 | Ga0496110_0494941 | Ga0496110_0494941_675_920 | 81 |
| 308 | 3300048914 | Ga0496111_0520197 | Ga0496111_0520197_156_401 | 81 |
| 309 | 3300048916 | Ga0496113_0398186 | Ga0496113_0398186_315_560 | 81 |
| 310 | 3300048917 | Ga0496114_0245382 | Ga0496114_0245382_482_727 | 81 |
| 311 | 3300048918 | Ga0496115_0103322 | Ga0496115_0103322_1317_1562 | 81 |
| 312 | 3300048919 | Ga0496116_0084133 | Ga0496116_0084133_110_355 | 81 |
| 313 | 3300048920 | Ga0496117_0043064 | Ga0496117_0043064_1747_1992 | 81 |
| 314 | 3300048920 | Ga0496117_0058541 | Ga0496117_0058541_1622_1867 | 81 |
| 315 | 3300048920 | Ga0496117_0148430 | Ga0496117_0148430_359_604 | 81 |
| 316 | 3300048921 | Ga0496118_0145186 | Ga0496118_0145186_48_293 | 81 |
| 317 | 3300048921 | Ga0496118_0193760 | Ga0496118_0193760_73_318 | 81 |
| 318 | 3300048922 | Ga0496119_0141387 | Ga0496119_0141387_188_433 | 81 |
| 319 | 3300048923 | Ga0496120_0087542 | Ga0496120_0087542_223_468 | 81 |
| 320 | 3300048924 | Ga0496121_0076212 | Ga0496121_0076212_820_1065 | 81 |
| 321 | 3300048925 | Ga0496122_0128019 | Ga0496122_0128019_1116_1361 | 81 |
| 322 | 3300049570 | Ga0501033_0244436 | Ga0501033_0244436_209_457 | 81 |
| 323 | 3300049571 | Ga0501034_0362823 | Ga0501034_0362823_892_1137 | 81 |
| 324 | 3300049573 | Ga0501037_0391617 | Ga0501037_0391617_150_395 | 81 |
| 325 | 3300049574 | Ga0501038_0027818 | Ga0501038_0027818_2031_2276 | 81 |
| 326 | 3300049586 | Ga0501070_0000044 | Ga0501070_0000044_19567_19812 | 81 |
| 327 | 3300049822 | Ga0501035_0017915 | Ga0501035_0017915_1999_2244 | 81 |
| 328 | 3300060344 | Ga0587071_116199 | Ga0587071_116199_170_415 | 81 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ec5-assembly2.cif.gz_C | crystal structure of four-helix bundle model | 0.6329 | 44 | 75 |
| 1tmx-assembly1.cif.gz_B | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.6186 | 41 | 80 |
| 4v7i-assembly1.cif.gz_BO | ribosome-secy complex. | 0.5576 | 44 | 79 |
| 1ec5-assembly2.cif.gz_C | crystal structure of four-helix bundle model | 0.455 | 44 | 75 |
| 1tmx-assembly1.cif.gz_B | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.3817 | 41 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X8R2_50_439_1.10.1380.10 | Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 | 0.7674 | 37 | 74 | 1.10.1380.10 |
| af_A0A2R8F5A8_8_66_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.7486 | 47 | 79 | 1.25.40.10 |
| af_P9WLZ5_168_273_1.20.140.50 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;alix/aip1 like domains | 0.5569 | 41 | 80 | 1.20.140.50 |
| 1yq1B02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.5515 | 46 | 80 | 1.20.1050.10 |
| af_A8WFN1_1_205_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5007 | 41 | 80 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5IG41-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.5521 | 9 | 77 |
|
| AF-A0A2W5IG41-F1-model_v4 | Mycothiol system anti-sigma-R factor | 0.482 | 9 | 77 |
|
| AF-A0A7X5Q2S5-F1-model_v4 | Phasin domain-containing protein | 0.451 | 1 | 80 |
|
| AF-A0A7X5Q2S5-F1-model_v4 | Phasin domain-containing protein | 0.4403 | 1 | 80 |
|
| AF-A0A349H229-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.3789 | 9 | 80 |
GO:0000155
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar