F409362

General Info

Members Datasets Scaffolds Average Seq Length
328 194 304 81

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0018988|Ga0466972_0018988_827_1072
Length 71
Sequence MTDCGCDKAKAELEEYLRNELCSEDAAGCSDEAHVHVVLTEAVQRACKETAPETLRTEVLMRIRSFQASVH

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221649 Leifsonia sp. Root4 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
7 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
8 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
9 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
10 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
11 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
12 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
13 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
14 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
15 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
16 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
17 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
18 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
19 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
20 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
21 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
22 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
193 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
194 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.1
Metatranscriptomes 11.28
Isolates 7.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 7.62
Rhizosphere 73.78
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10033442 3300001979 Bacteria 1632
2 JGI24739J22299_10067158 3300001989 Bacteria 1121
3 JGI24737J22298_10026599 3300001990 Bacteria 1827
4 JGI24735J21928_10001873 3300002067 Bacteria 7378
5 JGI24735J21928_10217997 3300002067 Bacteria 554
6 JGI24738J21930_10098915 3300002075 Bacteria 622
7 Ga0006778J45830_1064922 3300003162 Bacteria 576
8 Ga0006759J45824_1040136 3300003163 Bacteria 1087
9 rootH1_10028438 3300003316 Bacteria 4544
10 rootH1_10028438 3300003323 Bacteria 1649
11 Ga0007416J51690_1012623 3300003577 Bacteria 809
12 Ga0006562J51391_1032259 3300003578 Bacteria 14220
13 Ga0006562J51391_1032261 3300003578 Bacteria 11320
14 Ga0032354_1067602 3300003693 Bacteria 628
15 Ga0055539_1000027 3300003752 Bacteria 258020
16 Ga0055533_1000020 3300003756 Bacteria 353998
17 Ga0058861_11708186 3300004800 Bacteria 615
18 Ga0065714_10069957 3300005288 Bacteria 4020
19 Ga0065714_10115003 3300005288 Bacteria 1411
20 Ga0065714_10199479 3300005288 Bacteria 900
21 Ga0065714_10407926 3300005288 Bacteria 583
22 Ga0070658_10050727 3300005327 Bacteria 3363
23 Ga0070658_10142100 3300005327 Bacteria 2006
24 Ga0070682_100281146 3300005337 Bacteria 1213
25 Ga0070659_100011520 3300005366 Bacteria 6542
26 Ga0070659_101014368 3300005366 Bacteria 729
27 Ga0070663_101120548 3300005455 Bacteria 689
28 Ga0070663_102134689 3300005455 Bacteria 505
29 Ga0070678_100033456 3300005456 Bacteria 3569
30 Ga0070685_10734558 3300005466 Bacteria 722
31 Ga0068853_101123593 3300005539 Bacteria 758
32 Ga0070696_101848899 3300005546 Bacteria 522
33 Ga0068855_100054400 3300005563 Bacteria 4704
34 Ga0068857_100254047 3300005577 Bacteria 1612
35 Ga0068857_101838425 3300005577 Bacteria 593
36 Ga0068856_101518089 3300005614 Bacteria 684
37 Ga0068861_100045958 3300005719 Bacteria 3291
38 Ga0068863_101608107 3300005841 Bacteria 659
39 Ga0068862_100127046 3300005844 Bacteria 2252
40 Ga0075364_10883182 3300006051 Bacteria 609
41 Ga0075369_10094728 3300006186 Bacteria 1335
42 Ga0111539_10905102 3300009094 Bacteria 1026
43 Ga0105243_10153344 3300009148 Bacteria 1979
44 Ga0105238_11247463 3300009551 Bacteria 768
45 Ga0105249_10527299 3300009553 Bacteria 1229
46 Ga0105239_11021299 3300010375 Bacteria 951
47 Ga0105246_10542761 3300011119 Bacteria 995
48 Ga0154012_146067 3300013059 Bacteria 1226
49 Ga0154010_110445 3300013062 Bacteria 1164
50 Ga0157371_10276854 3300013102 Bacteria 1212
51 Ga0157371_10797031 3300013102 Bacteria 712
52 Ga0157370_10066733 3300013104 Bacteria 3402
53 Ga0157370_10410155 3300013104 Bacteria 1247
54 Ga0157369_10000103 3300013105 Bacteria 118273
55 Ga0157369_10150744 3300013105 Bacteria 2457
56 Ga0157369_11175084 3300013105 Bacteria 783
57 Ga0157369_11782457 3300013105 Bacteria 625
58 Ga0163162_10412453 3300013306 Bacteria 1483
59 Ga0163162_11554975 3300013306 Bacteria 754
60 Ga0157372_11197366 3300013307 Bacteria 878
61 Ga0157372_12366871 3300013307 Bacteria 610
62 Ga0157375_12652254 3300013308 Unclassified 599
63 Ga0163163_10850292 3300014325 Bacteria 976
64 Ga0157380_10014176 3300014326 Bacteria 5829
65 Ga0197907_10611759 3300020069 Bacteria 1077
66 Ga0197907_11048472 3300020069 Bacteria 504
67 Ga0206356_10087887 3300020070 Bacteria 911
68 Ga0206349_1565693 3300020075 Bacteria 662
69 Ga0206349_1763143 3300020075 Bacteria 1985
70 Ga0206355_1084907 3300020076 Bacteria 1700
71 Ga0206355_1150177 3300020076 Bacteria 658
72 Ga0206355_1217027 3300020076 Bacteria 2054
73 Ga0206355_1500899 3300020076 Bacteria 1013
74 Ga0206351_10042865 3300020077 Bacteria 971
75 Ga0206351_10250689 3300020077 Bacteria 1386
76 Ga0206351_10258678 3300020077 Bacteria 1361
77 Ga0206351_10311684 3300020077 Bacteria 1394
78 Ga0206351_10801304 3300020077 Bacteria 607
79 Ga0206352_10227677 3300020078 Bacteria 610
80 Ga0206352_10595782 3300020078 Bacteria 1224
81 Ga0206350_10391679 3300020080 Bacteria 1110
82 Ga0206354_10055379 3300020081 Bacteria 8489
83 Ga0206353_10131355 3300020082 Bacteria 10073
84 Ga0206353_10225926 3300020082 Bacteria 2084
85 Ga0154015_1015292 3300020610 Bacteria 1117
86 Ga0154015_1104577 3300020610 Bacteria 1343
87 Ga0154015_1119081 3300020610 Bacteria 999
88 Ga0154015_1216335 3300020610 Bacteria 1384
89 Ga0224712_10016598 3300022467 Bacteria 2423
90 Ga0224712_10092639 3300022467 Bacteria 1269
91 Ga0224712_10177316 3300022467 Bacteria 958
92 Ga0209566_100043 3300025225 Bacteria 266609
93 Ga0209674_100001 3300025226 Bacteria 4013750
94 Ga0209563_100001 3300025230 Bacteria 4013775
95 Ga0209563_102996 3300025230 Bacteria 3625
96 Ga0209677_100001 3300025253 Bacteria 4013787
97 Ga0209455_1001354 3300025272 Bacteria 11245
98 Ga0209051_1086170 3300025303 Bacteria 889
99 Ga0207688_10235677 3300025901 Bacteria 1106
100 Ga0207647_10074902 3300025904 Bacteria 2038
101 Ga0207647_10085598 3300025904 Bacteria 1885
102 Ga0207647_10152327 3300025904 Bacteria 1351
103 Ga0207647_10613550 3300025904 Bacteria 599
104 Ga0207645_10631317 3300025907 Bacteria 728
105 Ga0207705_10000001 3300025909 Bacteria 2061880
106 Ga0207705_10092369 3300025909 Bacteria 2217
107 Ga0207705_10151685 3300025909 Bacteria 1737
108 Ga0207705_11380790 3300025909 Bacteria 536
109 Ga0207694_10530472 3300025924 Bacteria 987
110 Ga0207659_10332892 3300025926 Bacteria 1256
111 Ga0207690_10053931 3300025932 Bacteria 2700
112 Ga0207690_10603774 3300025932 Bacteria 896
113 Ga0207709_10228219 3300025935 Bacteria 1347
114 Ga0207667_10181444 3300025949 Bacteria 2161
115 Ga0207712_10474090 3300025961 Bacteria 1065
116 Ga0207668_10014251 3300025972 Bacteria 4918
117 Ga0207639_10979536 3300026041 Bacteria 792
118 Ga0207678_10015816 3300026067 Bacteria 6632
119 Ga0207678_11062303 3300026067 Bacteria 717
120 Ga0207708_11175379 3300026075 Bacteria 670
121 Ga0207702_11205949 3300026078 Bacteria 751
122 Ga0207641_10742929 3300026088 Bacteria 968
123 Ga0207675_100034576 3300026118 Bacteria 4712
124 Ga0207683_10340037 3300026121 Bacteria 1376
125 Ga0268265_10292833 3300028380 Bacteria 1462
126 Ga0307408_100533396 3300031548 Bacteria 1033
127 Ga0307408_101791030 3300031548 Bacteria 587
128 Ga0307405_10179911 3300031731 Bacteria 1517
129 Ga0307410_10243120 3300031852 Bacteria 1396
130 Ga0307410_10759550 3300031852 Bacteria 822
131 Ga0307410_11303215 3300031852 Bacteria 635
132 Ga0307406_11885595 3300031901 Bacteria 533
133 Ga0307412_10185162 3300031911 Bacteria 1570
134 Ga0307412_11386261 3300031911 Bacteria 636
135 Ga0307412_11564496 3300031911 Bacteria 601
136 Ga0307409_100147946 3300031995 Bacteria 2034
137 Ga0307409_101681495 3300031995 Bacteria 663
138 Ga0307409_102725409 3300031995 Bacteria 522
139 Ga0307416_101286910 3300032002 Bacteria 837
140 Ga0307414_10878450 3300032004 Bacteria 821
141 Ga0307414_10939227 3300032004 Bacteria 794
142 Ga0307414_11200259 3300032004 Bacteria 702
143 Ga0307411_11520403 3300032005 Bacteria 616
144 Ga0307415_100449818 3300032126 Bacteria 1113
145 Ga0307415_100467378 3300032126 Bacteria 1095
146 Ga0395899_0004424 3300037312 Bacteria 10959
147 Ga0395899_0180964 3300037312 Bacteria 1480
148 Ga0395899_0656821 3300037312 Bacteria 662
149 Ga0395900_0016126 3300037418 Bacteria 7611
150 Ga0395900_0068375 3300037418 Bacteria 3650
151 Ga0395898_0000098 3300037466 Bacteria 229806
152 Ga0395898_0691985 3300037466 Bacteria 961
153 Ga0395901_0219619 3300038443 Bacteria 1987
154 Ga0439465_0020834 3300041413 Bacteria 2055
155 Ga0439465_0237709 3300041413 Bacteria 671
156 Ga0451791_0450400 3300041451 Bacteria 582
157 Ga0451791_1412632 3300041451 Bacteria 1539
158 Ga0451793_1722092 3300041452 Bacteria 1446
159 Ga0451797_0203594 3300041453 Bacteria 1851
160 Ga0451807_2544469 3300041486 Bacteria 557
161 Ga0451837_1079651 3300041494 Bacteria 899
162 Ga0451839_0255006 3300041496 Bacteria 698
163 Ga0466969_0282518 3300044656 Bacteria 751
164 Ga0466972_0018988 3300044658 Bacteria 3436
165 Ga0466972_0025736 3300044658 Bacteria 2915
166 Ga0466972_0103350 3300044658 Bacteria 1348
167 Ga0466972_0253055 3300044658 Bacteria 823
168 Ga0466972_0413720 3300044658 Bacteria 632
169 Ga0466965_0026140 3300044683 Bacteria 2829
170 Ga0466965_0042727 3300044683 Bacteria 2237
171 Ga0466965_0245859 3300044683 Bacteria 958
172 Ga0466966_0074631 3300044684 Bacteria 2119
173 Ga0466966_0152616 3300044684 Bacteria 1408
174 Ga0466961_0026471 3300044693 Bacteria 3729
175 Ga0466961_0037343 3300044693 Bacteria 3116
176 Ga0466961_0198606 3300044693 Bacteria 1241
177 Ga0466963_0245824 3300044694 Bacteria 1255
178 Ga0466971_0085645 3300044719 Bacteria 1440
179 Ga0466968_0016840 3300044735 Bacteria 2914
180 Ga0466968_0029745 3300044735 Bacteria 2260
181 Ga0466970_0002161 3300044765 Bacteria 9490
182 Ga0466970_0023191 3300044765 Bacteria 3240
183 Ga0466970_0054357 3300044765 Bacteria 2138
184 Ga0466970_0070130 3300044765 Bacteria 1884
185 Ga0466970_0083981 3300044765 Bacteria 1723
186 Ga0466970_0177162 3300044765 Bacteria 1182
187 Ga0466970_0970539 3300044765 Bacteria 501
188 Ga0466957_0036016 3300044842 Bacteria 2972
189 Ga0466957_0042923 3300044842 Bacteria 2737
190 Ga0466960_0011963 3300044901 Bacteria 3650
191 Ga0466960_0016118 3300044901 Bacteria 3235
192 Ga0466959_0000751 3300045049 Bacteria 19010
193 Ga0466959_0048995 3300045049 Bacteria 3103
194 Ga0466959_0268110 3300045049 Bacteria 1174
195 Ga0466958_0049970 3300045836 Bacteria 2531
196 Ga0466958_1119700 3300045836 Bacteria 514
197 Ga0495638_0487107 3300046460 Bacteria 623
198 Ga0495650_0130132 3300046471 Bacteria 919
199 Ga0495620_0228926 3300046515 Bacteria 711
200 Ga0496101_0070209 3300048904 Bacteria 2564
201 Ga0496101_0872280 3300048904 Bacteria 709
202 Ga0496102_0058092 3300048905 Bacteria 3534
203 Ga0496102_0131924 3300048905 Bacteria 2339
204 Ga0496102_1490608 3300048905 Bacteria 595
205 Ga0496102_1506352 3300048905 Bacteria 591
206 Ga0496103_0210207 3300048906 Bacteria 1251
207 Ga0496103_0441758 3300048906 Bacteria 835
208 Ga0496104_0007959 3300048907 Bacteria 9398
209 Ga0496104_0717022 3300048907 Bacteria 908
210 Ga0496105_0013865 3300048908 Bacteria 6402
211 Ga0496105_1044160 3300048908 Bacteria 609
212 Ga0496106_0479776 3300048909 Bacteria 999
213 Ga0496107_0446015 3300048910 Bacteria 961
214 Ga0496110_0494941 3300048913 Bacteria 1113
215 Ga0496111_0520197 3300048914 Bacteria 875
216 Ga0496113_0178873 3300048916 Bacteria 1681
217 Ga0496113_0398186 3300048916 Bacteria 1105
218 Ga0496114_0245382 3300048917 Bacteria 1575
219 Ga0496115_0103322 3300048918 Bacteria 2337
220 Ga0496116_0084133 3300048919 Bacteria 1961
221 Ga0496117_0000214 3300048920 Bacteria 111723
222 Ga0496117_0005473 3300048920 Bacteria 13313
223 Ga0496117_0043064 3300048920 Bacteria 3287
224 Ga0496117_0058541 3300048920 Bacteria 2667
225 Ga0496117_0148430 3300048920 Bacteria 1392
226 Ga0496117_0191100 3300048920 Bacteria 1166
227 Ga0496118_0004236 3300048921 Bacteria 17207
228 Ga0496118_0145186 3300048921 Bacteria 1495
229 Ga0496118_0193760 3300048921 Bacteria 1212
230 Ga0496118_0235731 3300048921 Bacteria 1052
231 Ga0496119_0141387 3300048922 Bacteria 1299
232 Ga0496119_0222771 3300048922 Bacteria 964
233 Ga0496119_0245502 3300048922 Bacteria 905
234 Ga0496120_0035722 3300048923 Bacteria 2965
235 Ga0496120_0087542 3300048923 Bacteria 1672
236 Ga0496120_0090965 3300048923 Bacteria 1630
237 Ga0496120_0351098 3300048923 Bacteria 662
238 Ga0496121_0076212 3300048924 Bacteria 2675
239 Ga0496122_0007228 3300048925 Bacteria 12423
240 Ga0496122_0074501 3300048925 Bacteria 2401
241 Ga0496122_0128019 3300048925 Bacteria 1621
242 Ga0496122_0200101 3300048925 Bacteria 1169
243 Ga0496122_0279944 3300048925 Bacteria 912
244 Ga0496123_0031836 3300048926 Bacteria 3829
245 Ga0496123_0075944 3300048926 Bacteria 2071
246 Ga0496123_0143991 3300048926 Bacteria 1298
247 Ga0496124_0000037 3300048927 Bacteria 317430
248 Ga0496124_0014081 3300048927 Bacteria 7756
249 Ga0496124_0186511 3300048927 Bacteria 1591
250 Ga0496125_0320415 3300048928 Bacteria 940
251 Ga0496126_0001681 3300048929 Bacteria 33084
252 Ga0496126_0215889 3300048929 Bacteria 1613
253 Ga0496126_0930881 3300048929 Bacteria 657
254 Ga0496126_0986945 3300048929 Bacteria 633
255 Ga0501031_0028007 3300049568 Bacteria 3672
256 Ga0501032_0039750 3300049569 Bacteria 3198
257 Ga0501033_0006733 3300049570 Bacteria 8975
258 Ga0501033_0244436 3300049570 Bacteria 1273
259 Ga0501034_0003150 3300049571 Bacteria 18978
260 Ga0501034_0008918 3300049571 Bacteria 10542
261 Ga0501034_0362823 3300049571 Bacteria 1376
262 Ga0501037_0014170 3300049573 Bacteria 5869
263 Ga0501037_0357070 3300049573 Bacteria 1007
264 Ga0501037_0391617 3300049573 Bacteria 954
265 Ga0501038_0007553 3300049574 Bacteria 10022
266 Ga0501038_0027818 3300049574 Bacteria 5025
267 Ga0501038_0279350 3300049574 Bacteria 1315
268 Ga0501039_0011105 3300049575 Bacteria 6864
269 Ga0501040_0364895 3300049576 Bacteria 1035
270 Ga0501043_0068543 3300049579 Bacteria 2785
271 Ga0501043_0382961 3300049579 Bacteria 1065
272 Ga0501046_0004157 3300049580 Bacteria 13178
273 Ga0501046_0060309 3300049580 Bacteria 2968
274 Ga0501046_0768503 3300049580 Bacteria 676
275 Ga0501047_0008677 3300049581 Bacteria 9597
276 Ga0501047_0047602 3300049581 Bacteria 4141
277 Ga0501047_0126876 3300049581 Bacteria 2432
278 Ga0501047_0189042 3300049581 Bacteria 1923
279 Ga0501047_0376318 3300049581 Bacteria 1255
280 Ga0501047_1195988 3300049581 Bacteria 574
281 Ga0501048_0002778 3300049582 Bacteria 13359
282 Ga0501048_0304124 3300049582 Bacteria 1135
283 Ga0501068_0023750 3300049584 Bacteria 3595
284 Ga0501070_0000044 3300049586 Bacteria 108859
285 Ga0501070_0016335 3300049586 Bacteria 6234
286 Ga0501070_0222030 3300049586 Bacteria 1549
287 Ga0501071_0417839 3300049587 Bacteria 1025
288 Ga0501072_0893177 3300049588 Bacteria 694
289 Ga0501080_0290556 3300049742 Bacteria 1484
290 Ga0501035_0017915 3300049822 Bacteria 6532
291 Ga0501035_0029829 3300049822 Bacteria 4974
292 Ga0501035_0090933 3300049822 Bacteria 2687
293 Ga0501044_0006111 3300049823 Bacteria 13288
294 Ga0501044_0073054 3300049823 Bacteria 3486
295 Ga0501044_0507753 3300049823 Bacteria 1106
296 Ga0501044_0817773 3300049823 Bacteria 810
297 Ga0501045_0024463 3300049824 Bacteria 4336
298 Ga0501045_0818078 3300049824 Bacteria 686
299 nmdc:mga08y16_426833_c1 3300050511 Bacteria 1354
300 nmdc:mga0sz30_40146_c1 3300050516 Bacteria 1300
301 Ga0500573_0017767 3300053140 Bacteria 4051
302 Ga0500616_0000021 3300053153 Bacteria 484527
303 Ga0587071_116199 3300060344 Bacteria 634
304 Ga0466962_0018951 3300061719 Bacteria 3306

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0818078 Ga0501045_0818078_24_236 70
2 3300044658 Ga0466972_0018988 Ga0466972_0018988_827_1072 71
3 3300044683 Ga0466965_0026140 Ga0466965_0026140_851_1096 71
4 3300044684 Ga0466966_0074631 Ga0466966_0074631_378_623 71
5 3300044693 Ga0466961_0037343 Ga0466961_0037343_2351_2596 71
6 3300044694 Ga0466963_0245824 Ga0466963_0245824_231_476 71
7 3300044719 Ga0466971_0085645 Ga0466971_0085645_1150_1395 71
8 3300044735 Ga0466968_0016840 Ga0466968_0016840_59_304 71
9 3300044765 Ga0466970_0083981 Ga0466970_0083981_175_420 71
10 3300044842 Ga0466957_0036016 Ga0466957_0036016_845_1090 71
11 3300044901 Ga0466960_0016118 Ga0466960_0016118_967_1212 71
12 3300045049 Ga0466959_0048995 Ga0466959_0048995_835_1080 71
13 3300045836 Ga0466958_0049970 Ga0466958_0049970_1732_1977 71
14 3300061719 Ga0466962_0018951 Ga0466962_0018951_274_519 71
15 iso_pu_bacteria 2585428094 2587864810 75
16 iso_pu_bacteria 2643221649 2644277541 75
17 iso_pu_bacteria 2844852863 2844855754 75
18 iso_pu_bacteria 8056037122 8056039622 75
19 iso_pu_bacteria 8057345674 8057348484 75
20 iso_pu_bacteria 2643221572 2643874669 76
21 iso_pu_bacteria 2643221669 2644381725 76
22 iso_pu_bacteria 2751185788 2753302376 76
23 iso_pu_bacteria 2857729791 2857732255 76
24 iso_pu_bacteria 2895660088 2895662960 76
25 iso_pu_bacteria 2904430863 2904432849 76
26 iso_pu_bacteria 2904501621 2904503301 76
27 iso_pu_bacteria 2908674828 2908675522 76
28 iso_pu_bacteria 2909074476 2909074578 76
29 iso_pu_bacteria 2919039151 2919041409 76
30 iso_pu_bacteria 2919042368 2919045534 76
31 iso_pu_bacteria 2928104781 2928108183 76
32 iso_pu_bacteria 2928121344 2928124853 76
33 iso_pu_bacteria 2928500415 2928500506 76
34 iso_pu_bacteria 2939660829 2939663095 76
35 iso_pu_bacteria 2964326757 2964329066 76
36 iso_pu_bacteria 2966921586 2966921821 76
37 iso_pu_bacteria 2966924647 2966926208 76
38 iso_pu_bacteria 2984551494 2984554543 76
39 iso_pu_bacteria 8046352972 8046355800 76
40 3300048929 Ga0496126_0930881 Ga0496126_0930881_44_277 77
41 3300049822 Ga0501035_0090933 Ga0501035_0090933_1715_1960 77
42 3300048923 Ga0496120_0351098 Ga0496120_0351098_380_616 78
43 3300003162 Ga0006778J45830_1064922 Ga0006778J45830_10649222 79
44 3300003163 Ga0006759J45824_1040136 Ga0006759J45824_10401362 79
45 3300005288 Ga0065714_10199479 Ga0065714_101994792 79
46 3300005455 Ga0070663_102134689 Ga0070663_1021346892 79
47 3300005466 Ga0070685_10734558 Ga0070685_107345582 79
48 3300006186 Ga0075369_10094728 Ga0075369_100947282 79
49 3300041494 Ga0451837_1079651 Ga0451837_1079651_542_784 79
50 3300048920 Ga0496117_0000214 Ga0496117_0000214_80529_80768 79
51 3300048925 Ga0496122_0007228 Ga0496122_0007228_6663_6902 79
52 3300048926 Ga0496123_0031836 Ga0496123_0031836_3024_3263 79
53 3300049574 Ga0501038_0279350 Ga0501038_0279350_608_847 79
54 3300049579 Ga0501043_0382961 Ga0501043_0382961_167_406 79
55 3300049580 Ga0501046_0768503 Ga0501046_0768503_363_602 79
56 3300049581 Ga0501047_0126876 Ga0501047_0126876_371_613 79
57 3300049581 Ga0501047_0376318 Ga0501047_0376318_807_1046 79
58 3300049581 Ga0501047_1195988 Ga0501047_1195988_162_401 79
59 3300049823 Ga0501044_0507753 Ga0501044_0507753_206_445 79
60 3300049823 Ga0501044_0817773 Ga0501044_0817773_235_477 79
61 3300050516 nmdc:mga0sz30_40146_c1 nmdc:mga0sz30_40146_c1_963_1202 79
62 3300053153 Ga0500616_0000021 Ga0500616_0000021_75616_75855 79
63 3300003323 rootH1_10028438 rootH1_100284383 80
64 3300004800 Ga0058861_11708186 Ga0058861_117081861 80
65 3300005288 Ga0065714_10069957 Ga0065714_100699574 80
66 3300005288 Ga0065714_10115003 Ga0065714_101150033 80
67 3300005288 Ga0065714_10407926 Ga0065714_104079261 80
68 3300005327 Ga0070658_10142100 Ga0070658_101421004 80
69 3300005366 Ga0070659_100011520 Ga0070659_1000115202 80
70 3300005366 Ga0070659_101014368 Ga0070659_1010143681 80
71 3300005455 Ga0070663_101120548 Ga0070663_1011205482 80
72 3300005456 Ga0070678_100033456 Ga0070678_1000334562 80
73 3300005546 Ga0070696_101848899 Ga0070696_1018488992 80
74 3300005563 Ga0068855_100054400 Ga0068855_1000544002 80
75 3300005577 Ga0068857_100254047 Ga0068857_1002540472 80
76 3300005719 Ga0068861_100045958 Ga0068861_1000459582 80
77 3300005841 Ga0068863_101608107 Ga0068863_1016081071 80
78 3300005844 Ga0068862_100127046 Ga0068862_1001270463 80
79 3300006051 Ga0075364_10883182 Ga0075364_108831822 80
80 3300009094 Ga0111539_10905102 Ga0111539_109051022 80
81 3300009148 Ga0105243_10153344 Ga0105243_101533443 80
82 3300009551 Ga0105238_11247463 Ga0105238_112474632 80
83 3300009553 Ga0105249_10527299 Ga0105249_105272992 80
84 3300011119 Ga0105246_10542761 Ga0105246_105427612 80
85 3300013102 Ga0157371_10797031 Ga0157371_107970312 80
86 3300013104 Ga0157370_10066733 Ga0157370_100667332 80
87 3300013105 Ga0157369_10000103 Ga0157369_1000010384 80
88 3300013306 Ga0163162_10412453 Ga0163162_104124533 80
89 3300013306 Ga0163162_11554975 Ga0163162_115549752 80
90 3300013308 Ga0157375_12652254 Ga0157375_126522542 80
91 3300014325 Ga0163163_10850292 Ga0163163_108502922 80
92 3300014326 Ga0157380_10014176 Ga0157380_100141762 80
93 3300020069 Ga0197907_10611759 Ga0197907_106117592 80
94 3300020069 Ga0197907_11048472 Ga0197907_110484722 80
95 3300020076 Ga0206355_1084907 Ga0206355_10849072 80
96 3300020076 Ga0206355_1217027 Ga0206355_12170272 80
97 3300020077 Ga0206351_10042865 Ga0206351_100428651 80
98 3300020077 Ga0206351_10801304 Ga0206351_108013042 80
99 3300020080 Ga0206350_10391679 Ga0206350_103916792 80
100 3300020610 Ga0154015_1015292 Ga0154015_10152922 80
101 3300025901 Ga0207688_10235677 Ga0207688_102356772 80
102 3300025904 Ga0207647_10085598 Ga0207647_100855983 80
103 3300025907 Ga0207645_10631317 Ga0207645_106313172 80
104 3300025909 Ga0207705_10000001 Ga0207705_100000011780 80
105 3300025909 Ga0207705_10151685 Ga0207705_101516853 80
106 3300025909 Ga0207705_11380790 Ga0207705_113807902 80
107 3300025924 Ga0207694_10530472 Ga0207694_105304722 80
108 3300025926 Ga0207659_10332892 Ga0207659_103328922 80
109 3300025932 Ga0207690_10053931 Ga0207690_100539313 80
110 3300025932 Ga0207690_10603774 Ga0207690_106037741 80
111 3300025935 Ga0207709_10228219 Ga0207709_102282192 80
112 3300025949 Ga0207667_10181444 Ga0207667_101814443 80
113 3300025961 Ga0207712_10474090 Ga0207712_104740902 80
114 3300025972 Ga0207668_10014251 Ga0207668_100142515 80
115 3300026067 Ga0207678_10015816 Ga0207678_100158163 80
116 3300026067 Ga0207678_11062303 Ga0207678_110623031 80
117 3300026075 Ga0207708_11175379 Ga0207708_111753792 80
118 3300026088 Ga0207641_10742929 Ga0207641_107429291 80
119 3300026118 Ga0207675_100034576 Ga0207675_1000345762 80
120 3300026121 Ga0207683_10340037 Ga0207683_103400372 80
121 3300028380 Ga0268265_10292833 Ga0268265_102928331 80
122 3300031548 Ga0307408_100533396 Ga0307408_1005333962 80
123 3300031548 Ga0307408_101791030 Ga0307408_1017910302 80
124 3300031731 Ga0307405_10179911 Ga0307405_101799112 80
125 3300031852 Ga0307410_10243120 Ga0307410_102431202 80
126 3300031852 Ga0307410_10759550 Ga0307410_107595502 80
127 3300031852 Ga0307410_11303215 Ga0307410_113032152 80
128 3300031901 Ga0307406_11885595 Ga0307406_118855952 80
129 3300031911 Ga0307412_10185162 Ga0307412_101851622 80
130 3300031911 Ga0307412_11386261 Ga0307412_113862611 80
131 3300031911 Ga0307412_11564496 Ga0307412_115644962 80
132 3300031995 Ga0307409_100147946 Ga0307409_1001479462 80
133 3300031995 Ga0307409_101681495 Ga0307409_1016814952 80
134 3300031995 Ga0307409_102725409 Ga0307409_1027254091 80
135 3300032002 Ga0307416_101286910 Ga0307416_1012869102 80
136 3300032004 Ga0307414_10878450 Ga0307414_108784502 80
137 3300032004 Ga0307414_10939227 Ga0307414_109392272 80
138 3300032004 Ga0307414_11200259 Ga0307414_112002592 80
139 3300032005 Ga0307411_11520403 Ga0307411_115204032 80
140 3300032126 Ga0307415_100449818 Ga0307415_1004498181 80
141 3300032126 Ga0307415_100467378 Ga0307415_1004673782 80
142 3300041413 Ga0439465_0020834 Ga0439465_0020834_843_1097 80
143 3300041413 Ga0439465_0237709 Ga0439465_0237709_37_294 80
144 3300041451 Ga0451791_0450400 Ga0451791_0450400_326_568 80
145 3300041451 Ga0451791_1412632 Ga0451791_1412632_1101_1352 80
146 3300041452 Ga0451793_1722092 Ga0451793_1722092_357_599 80
147 3300041453 Ga0451797_0203594 Ga0451797_0203594_1363_1614 80
148 3300041486 Ga0451807_2544469 Ga0451807_2544469_304_546 80
149 3300041496 Ga0451839_0255006 Ga0451839_0255006_222_473 80
150 3300044656 Ga0466969_0282518 Ga0466969_0282518_374_616 80
151 3300044735 Ga0466968_0029745 Ga0466968_0029745_176_418 80
152 3300044765 Ga0466970_0023191 Ga0466970_0023191_174_416 80
153 3300044765 Ga0466970_0177162 Ga0466970_0177162_668_916 80
154 3300046460 Ga0495638_0487107 Ga0495638_0487107_285_542 80
155 3300046471 Ga0495650_0130132 Ga0495650_0130132_613_855 80
156 3300046515 Ga0495620_0228926 Ga0495620_0228926_83_325 80
157 3300048904 Ga0496101_0872280 Ga0496101_0872280_328_570 80
158 3300048905 Ga0496102_0131924 Ga0496102_0131924_1492_1734 80
159 3300048905 Ga0496102_1490608 Ga0496102_1490608_133_390 80
160 3300048906 Ga0496103_0441758 Ga0496103_0441758_252_494 80
161 3300048907 Ga0496104_0717022 Ga0496104_0717022_64_306 80
162 3300048908 Ga0496105_1044160 Ga0496105_1044160_272_514 80
163 3300048916 Ga0496113_0178873 Ga0496113_0178873_133_390 80
164 3300048920 Ga0496117_0005473 Ga0496117_0005473_8673_8915 80
165 3300048920 Ga0496117_0191100 Ga0496117_0191100_728_979 80
166 3300048921 Ga0496118_0004236 Ga0496118_0004236_8273_8515 80
167 3300048921 Ga0496118_0235731 Ga0496118_0235731_183_434 80
168 3300048922 Ga0496119_0222771 Ga0496119_0222771_85_327 80
169 3300048922 Ga0496119_0245502 Ga0496119_0245502_50_292 80
170 3300048923 Ga0496120_0035722 Ga0496120_0035722_2121_2363 80
171 3300048923 Ga0496120_0090965 Ga0496120_0090965_10_252 80
172 3300048925 Ga0496122_0074501 Ga0496122_0074501_312_554 80
173 3300048925 Ga0496122_0200101 Ga0496122_0200101_451_693 80
174 3300048925 Ga0496122_0279944 Ga0496122_0279944_50_313 80
175 3300048926 Ga0496123_0075944 Ga0496123_0075944_27_290 80
176 3300048926 Ga0496123_0143991 Ga0496123_0143991_400_651 80
177 3300048927 Ga0496124_0000037 Ga0496124_0000037_32876_33118 80
178 3300048927 Ga0496124_0014081 Ga0496124_0014081_6892_7134 80
179 3300048927 Ga0496124_0186511 Ga0496124_0186511_1193_1435 80
180 3300048928 Ga0496125_0320415 Ga0496125_0320415_49_309 80
181 3300048929 Ga0496126_0001681 Ga0496126_0001681_7594_7836 80
182 3300048929 Ga0496126_0215889 Ga0496126_0215889_955_1197 80
183 3300048929 Ga0496126_0986945 Ga0496126_0986945_167_418 80
184 3300049568 Ga0501031_0028007 Ga0501031_0028007_2846_3088 80
185 3300049569 Ga0501032_0039750 Ga0501032_0039750_2778_3020 80
186 3300049570 Ga0501033_0006733 Ga0501033_0006733_5503_5745 80
187 3300049571 Ga0501034_0003150 Ga0501034_0003150_2895_3137 80
188 3300049571 Ga0501034_0008918 Ga0501034_0008918_4441_4695 80
189 3300049573 Ga0501037_0014170 Ga0501037_0014170_4925_5167 80
190 3300049573 Ga0501037_0357070 Ga0501037_0357070_387_641 80
191 3300049574 Ga0501038_0007553 Ga0501038_0007553_1499_1741 80
192 3300049575 Ga0501039_0011105 Ga0501039_0011105_5502_5744 80
193 3300049576 Ga0501040_0364895 Ga0501040_0364895_25_267 80
194 3300049579 Ga0501043_0068543 Ga0501043_0068543_194_436 80
195 3300049580 Ga0501046_0004157 Ga0501046_0004157_7381_7623 80
196 3300049580 Ga0501046_0060309 Ga0501046_0060309_2695_2949 80
197 3300049581 Ga0501047_0008677 Ga0501047_0008677_7252_7506 80
198 3300049581 Ga0501047_0047602 Ga0501047_0047602_3875_4117 80
199 3300049581 Ga0501047_0189042 Ga0501047_0189042_1499_1741 80
200 3300049582 Ga0501048_0002778 Ga0501048_0002778_10807_11049 80
201 3300049582 Ga0501048_0304124 Ga0501048_0304124_238_492 80
202 3300049584 Ga0501068_0023750 Ga0501068_0023750_128_370 80
203 3300049586 Ga0501070_0016335 Ga0501070_0016335_672_914 80
204 3300049586 Ga0501070_0222030 Ga0501070_0222030_1223_1477 80
205 3300049587 Ga0501071_0417839 Ga0501071_0417839_645_902 80
206 3300049588 Ga0501072_0893177 Ga0501072_0893177_279_521 80
207 3300049742 Ga0501080_0290556 Ga0501080_0290556_51_293 80
208 3300049822 Ga0501035_0029829 Ga0501035_0029829_4682_4924 80
209 3300049823 Ga0501044_0006111 Ga0501044_0006111_2587_2841 80
210 3300049823 Ga0501044_0073054 Ga0501044_0073054_993_1235 80
211 3300049824 Ga0501045_0024463 Ga0501045_0024463_2100_2342 80
212 3300050511 nmdc:mga08y16_426833_c1 nmdc:mga08y16_426833_c1_1051_1308 80
213 3300053140 Ga0500573_0017767 Ga0500573_0017767_111_353 80
214 3300001979 JGI24740J21852_10033442 JGI24740J21852_100334422 81
215 3300001989 JGI24739J22299_10067158 JGI24739J22299_100671583 81
216 3300001990 JGI24737J22298_10026599 JGI24737J22298_100265993 81
217 3300002067 JGI24735J21928_10001873 JGI24735J21928_100018734 81
218 3300002067 JGI24735J21928_10217997 JGI24735J21928_102179971 81
219 3300002075 JGI24738J21930_10098915 JGI24738J21930_100989152 81
220 3300003577 Ga0007416J51690_1012623 Ga0007416J51690_10126232 81
221 3300003578 Ga0006562J51391_1032259 Ga0006562J51391_10322595 81
222 3300003578 Ga0006562J51391_1032261 Ga0006562J51391_10322617 81
223 3300003693 Ga0032354_1067602 Ga0032354_10676022 81
224 3300003752 Ga0055539_1000027 Ga0055539_1000027123 81
225 3300003756 Ga0055533_1000020 Ga0055533_1000020123 81
226 3300005327 Ga0070658_10050727 Ga0070658_100507273 81
227 3300005337 Ga0070682_100281146 Ga0070682_1002811462 81
228 3300005539 Ga0068853_101123593 Ga0068853_1011235931 81
229 3300005577 Ga0068857_101838425 Ga0068857_1018384252 81
230 3300005614 Ga0068856_101518089 Ga0068856_1015180892 81
231 3300010375 Ga0105239_11021299 Ga0105239_110212992 81
232 3300013059 Ga0154012_146067 Ga0154012_1460672 81
233 3300013062 Ga0154010_110445 Ga0154010_1104452 81
234 3300013102 Ga0157371_10276854 Ga0157371_102768542 81
235 3300013104 Ga0157370_10410155 Ga0157370_104101552 81
236 3300013105 Ga0157369_10150744 Ga0157369_101507442 81
237 3300013105 Ga0157369_11175084 Ga0157369_111750842 81
238 3300013105 Ga0157369_11782457 Ga0157369_117824572 81
239 3300013307 Ga0157372_11197366 Ga0157372_111973662 81
240 3300013307 Ga0157372_12366871 Ga0157372_123668712 81
241 3300020070 Ga0206356_10087887 Ga0206356_100878872 81
242 3300020075 Ga0206349_1565693 Ga0206349_15656932 81
243 3300020075 Ga0206349_1763143 Ga0206349_17631433 81
244 3300020076 Ga0206355_1150177 Ga0206355_11501772 81
245 3300020076 Ga0206355_1500899 Ga0206355_15008991 81
246 3300020077 Ga0206351_10250689 Ga0206351_102506892 81
247 3300020077 Ga0206351_10258678 Ga0206351_102586782 81
248 3300020077 Ga0206351_10311684 Ga0206351_103116842 81
249 3300020078 Ga0206352_10227677 Ga0206352_102276772 81
250 3300020078 Ga0206352_10595782 Ga0206352_105957822 81
251 3300020081 Ga0206354_10055379 Ga0206354_100553796 81
252 3300020082 Ga0206353_10131355 Ga0206353_101313557 81
253 3300020082 Ga0206353_10225926 Ga0206353_102259262 81
254 3300020610 Ga0154015_1104577 Ga0154015_11045772 81
255 3300020610 Ga0154015_1119081 Ga0154015_11190812 81
256 3300020610 Ga0154015_1216335 Ga0154015_12163352 81
257 3300022467 Ga0224712_10016598 Ga0224712_100165982 81
258 3300022467 Ga0224712_10092639 Ga0224712_100926392 81
259 3300022467 Ga0224712_10177316 Ga0224712_101773162 81
260 3300025225 Ga0209566_100043 Ga0209566_10004336 81
261 3300025226 Ga0209674_100001 Ga0209674_1000013774 81
262 3300025230 Ga0209563_100001 Ga0209563_1000013774 81
263 3300025230 Ga0209563_102996 Ga0209563_1029962 81
264 3300025253 Ga0209677_100001 Ga0209677_1000013774 81
265 3300025272 Ga0209455_1001354 Ga0209455_10013543 81
266 3300025303 Ga0209051_1086170 Ga0209051_10861702 81
267 3300025904 Ga0207647_10074902 Ga0207647_100749022 81
268 3300025904 Ga0207647_10152327 Ga0207647_101523273 81
269 3300025904 Ga0207647_10613550 Ga0207647_106135502 81
270 3300025909 Ga0207705_10092369 Ga0207705_100923693 81
271 3300026041 Ga0207639_10979536 Ga0207639_109795362 81
272 3300026078 Ga0207702_11205949 Ga0207702_112059492 81
273 3300037312 Ga0395899_0004424 Ga0395899_0004424_918_1163 81
274 3300037312 Ga0395899_0180964 Ga0395899_0180964_172_417 81
275 3300037312 Ga0395899_0656821 Ga0395899_0656821_302_547 81
276 3300037418 Ga0395900_0016126 Ga0395900_0016126_1350_1595 81
277 3300037418 Ga0395900_0068375 Ga0395900_0068375_1677_1922 81
278 3300037466 Ga0395898_0000098 Ga0395898_0000098_135938_136183 81
279 3300037466 Ga0395898_0691985 Ga0395898_0691985_266_511 81
280 3300038443 Ga0395901_0219619 Ga0395901_0219619_1459_1704 81
281 3300044658 Ga0466972_0025736 Ga0466972_0025736_2260_2505 81
282 3300044658 Ga0466972_0103350 Ga0466972_0103350_551_799 81
283 3300044658 Ga0466972_0253055 Ga0466972_0253055_235_480 81
284 3300044658 Ga0466972_0413720 Ga0466972_0413720_267_515 81
285 3300044683 Ga0466965_0042727 Ga0466965_0042727_1506_1751 81
286 3300044683 Ga0466965_0245859 Ga0466965_0245859_52_300 81
287 3300044684 Ga0466966_0152616 Ga0466966_0152616_220_465 81
288 3300044693 Ga0466961_0026471 Ga0466961_0026471_1548_1793 81
289 3300044693 Ga0466961_0198606 Ga0466961_0198606_548_796 81
290 3300044765 Ga0466970_0002161 Ga0466970_0002161_271_516 81
291 3300044765 Ga0466970_0054357 Ga0466970_0054357_1549_1794 81
292 3300044765 Ga0466970_0070130 Ga0466970_0070130_1216_1464 81
293 3300044765 Ga0466970_0970539 Ga0466970_0970539_183_431 81
294 3300044842 Ga0466957_0042923 Ga0466957_0042923_2214_2462 81
295 3300044901 Ga0466960_0011963 Ga0466960_0011963_1087_1335 81
296 3300045049 Ga0466959_0000751 Ga0466959_0000751_12987_13232 81
297 3300045049 Ga0466959_0268110 Ga0466959_0268110_657_905 81
298 3300045836 Ga0466958_1119700 Ga0466958_1119700_19_264 81
299 3300048904 Ga0496101_0070209 Ga0496101_0070209_885_1130 81
300 3300048905 Ga0496102_0058092 Ga0496102_0058092_725_970 81
301 3300048905 Ga0496102_1506352 Ga0496102_1506352_164_409 81
302 3300048906 Ga0496103_0210207 Ga0496103_0210207_981_1226 81
303 3300048907 Ga0496104_0007959 Ga0496104_0007959_4144_4389 81
304 3300048908 Ga0496105_0013865 Ga0496105_0013865_387_632 81
305 3300048909 Ga0496106_0479776 Ga0496106_0479776_393_638 81
306 3300048910 Ga0496107_0446015 Ga0496107_0446015_578_823 81
307 3300048913 Ga0496110_0494941 Ga0496110_0494941_675_920 81
308 3300048914 Ga0496111_0520197 Ga0496111_0520197_156_401 81
309 3300048916 Ga0496113_0398186 Ga0496113_0398186_315_560 81
310 3300048917 Ga0496114_0245382 Ga0496114_0245382_482_727 81
311 3300048918 Ga0496115_0103322 Ga0496115_0103322_1317_1562 81
312 3300048919 Ga0496116_0084133 Ga0496116_0084133_110_355 81
313 3300048920 Ga0496117_0043064 Ga0496117_0043064_1747_1992 81
314 3300048920 Ga0496117_0058541 Ga0496117_0058541_1622_1867 81
315 3300048920 Ga0496117_0148430 Ga0496117_0148430_359_604 81
316 3300048921 Ga0496118_0145186 Ga0496118_0145186_48_293 81
317 3300048921 Ga0496118_0193760 Ga0496118_0193760_73_318 81
318 3300048922 Ga0496119_0141387 Ga0496119_0141387_188_433 81
319 3300048923 Ga0496120_0087542 Ga0496120_0087542_223_468 81
320 3300048924 Ga0496121_0076212 Ga0496121_0076212_820_1065 81
321 3300048925 Ga0496122_0128019 Ga0496122_0128019_1116_1361 81
322 3300049570 Ga0501033_0244436 Ga0501033_0244436_209_457 81
323 3300049571 Ga0501034_0362823 Ga0501034_0362823_892_1137 81
324 3300049573 Ga0501037_0391617 Ga0501037_0391617_150_395 81
325 3300049574 Ga0501038_0027818 Ga0501038_0027818_2031_2276 81
326 3300049586 Ga0501070_0000044 Ga0501070_0000044_19567_19812 81
327 3300049822 Ga0501035_0017915 Ga0501035_0017915_1999_2244 81
328 3300060344 Ga0587071_116199 Ga0587071_116199_170_415 81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ec5-assembly2.cif.gz_C crystal structure of four-helix bundle model 0.6329 44 75
1tmx-assembly1.cif.gz_B crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.6186 41 80
4v7i-assembly1.cif.gz_BO ribosome-secy complex. 0.5576 44 79
1ec5-assembly2.cif.gz_C crystal structure of four-helix bundle model 0.455 44 75
1tmx-assembly1.cif.gz_B crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.3817 41 80
ID Description Score Start End Superfamily
af_I6X8R2_50_439_1.10.1380.10 Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 0.7674 37 74 1.10.1380.10
af_A0A2R8F5A8_8_66_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7486 47 79 1.25.40.10
af_P9WLZ5_168_273_1.20.140.50 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;alix/aip1 like domains 0.5569 41 80 1.20.140.50
1yq1B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.5515 46 80 1.20.1050.10
af_A8WFN1_1_205_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5007 41 80 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2W5IG41-F1-model_v4 Mycothiol system anti-sigma-R factor 0.5521 9 77
AF-A0A2W5IG41-F1-model_v4 Mycothiol system anti-sigma-R factor 0.482 9 77
AF-A0A7X5Q2S5-F1-model_v4 Phasin domain-containing protein 0.451 1 80
AF-A0A7X5Q2S5-F1-model_v4 Phasin domain-containing protein 0.4403 1 80
AF-A0A349H229-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.3789 9 80 GO:0000155
GO:0016020

Feature Viewer

pLDDT pTM Quality
88.86 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map