F409298

General Info

Members Datasets Scaffolds Average Seq Length
328 223 656 77

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10632186|Ga0265316_106321861
Length 95
Sequence MHEIYAILPAMPPKTTCPITQAQFLEKAEPLKITINGQDMLAEVKQFSTGSFGWYMNGKTVVQIDGKAVSVQIGMNLTIVGSKDADRGTPPTSSS

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
161 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
162 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
177 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
178 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
181 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
182 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
204 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
205 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
222 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0
Rhizoplane 1.22
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10632186 3300031344 Bacteria 758
2 rootL2_10221707 3300003322 Bacteria 1351
3 Ga0070683_100886677 3300005329 Bacteria 856
4 Ga0068869_100284103 3300005334 Bacteria 1331
5 Ga0070682_100142307 3300005337 Bacteria 1636
6 Ga0070682_101261872 3300005337 Bacteria 626
7 Ga0070682_101397987 3300005337 Unclassified 598
8 Ga0068868_100828025 3300005338 Bacteria 837
9 Ga0068868_101995337 3300005338 Bacteria 551
10 Ga0070689_100151147 3300005340 Bacteria 1873
11 Ga0070689_100195387 3300005340 Bacteria 1649
12 Ga0070689_100501690 3300005340 Bacteria 1040
13 Ga0070689_100984054 3300005340 Bacteria 750
14 Ga0070689_101953978 3300005340 Bacteria 536
15 Ga0070692_10322288 3300005345 Bacteria 951
16 Ga0070675_101236080 3300005354 Bacteria 688
17 Ga0070674_101633716 3300005356 Bacteria 582
18 Ga0070688_100363248 3300005365 Bacteria 1063
19 Ga0070688_100776038 3300005365 Bacteria 748
20 Ga0070688_101382213 3300005365 Unclassified 570
21 Ga0070667_100131107 3300005367 Bacteria 2188
22 Ga0070703_10284387 3300005406 Bacteria 684
23 Ga0070714_100809059 3300005435 Bacteria 908
24 Ga0070714_101996009 3300005435 Unclassified 566
25 Ga0070701_10890492 3300005438 Bacteria 614
26 Ga0070701_10920633 3300005438 Bacteria 605
27 Ga0070705_101144118 3300005440 Bacteria 639
28 Ga0070694_100267394 3300005444 Bacteria 1299
29 Ga0070663_100289346 3300005455 Bacteria 1308
30 Ga0070678_100185339 3300005456 Bacteria 1707
31 Ga0070678_101139287 3300005456 Unclassified 721
32 Ga0070681_10787571 3300005458 Bacteria 868
33 Ga0070685_10115521 3300005466 Bacteria 1660
34 Ga0070685_10376541 3300005466 Bacteria 977
35 Ga0070685_11172719 3300005466 Bacteria 583
36 Ga0070706_100006047 3300005467 Bacteria 11438
37 Ga0070707_100000276 3300005468 Bacteria 50554
38 Ga0070698_100048798 3300005471 Bacteria 4325
39 Ga0070699_100150046 3300005518 Bacteria 2061
40 Ga0070699_101271966 3300005518 Bacteria 675
41 Ga0070679_100367146 3300005530 Bacteria 1386
42 Ga0070679_100466317 3300005530 Bacteria 1207
43 Ga0070679_101134359 3300005530 Unclassified 727
44 Ga0070684_100342850 3300005535 Bacteria 1374
45 Ga0070697_100705703 3300005536 Bacteria 890
46 Ga0068853_100046845 3300005539 Bacteria 3709
47 Ga0070695_101204471 3300005545 Unclassified 623
48 Ga0070665_100197516 3300005548 Bacteria 2012
49 Ga0070665_101001108 3300005548 Bacteria 848
50 Ga0070665_101280200 3300005548 Unclassified 743
51 Ga0070665_101666336 3300005548 Unclassified 645
52 Ga0070704_100863650 3300005549 Bacteria 812
53 Ga0068855_100165112 3300005563 Bacteria 2511
54 Ga0068857_100713467 3300005577 Bacteria 953
55 Ga0068857_101186838 3300005577 Bacteria 739
56 Ga0068857_101263196 3300005577 Bacteria 716
57 Ga0068854_100797704 3300005578 Bacteria 823
58 Ga0068856_100009712 3300005614 Bacteria 9346
59 Ga0070702_100220400 3300005615 Bacteria 1268
60 Ga0070702_100645572 3300005615 Bacteria 800
61 Ga0068859_100225113 3300005617 Bacteria 1964
62 Ga0068859_100657612 3300005617 Bacteria 1140
63 Ga0068859_101086926 3300005617 Bacteria 880
64 Ga0068864_100215185 3300005618 Bacteria 1771
65 Ga0068864_100425435 3300005618 Bacteria 1266
66 Ga0068864_100539209 3300005618 Bacteria 1127
67 Ga0068864_100936357 3300005618 Bacteria 857
68 Ga0068866_10022202 3300005718 Bacteria 2934
69 Ga0068861_100119153 3300005719 Bacteria 2127
70 Ga0068861_100222606 3300005719 Bacteria 1596
71 Ga0068863_100228869 3300005841 Bacteria 1793
72 Ga0068863_102022749 3300005841 Bacteria 586
73 Ga0068858_101084370 3300005842 Unclassified 786
74 Ga0068860_100678163 3300005843 Bacteria 1040
75 Ga0068862_101096053 3300005844 Bacteria 791
76 Ga0070717_10005643 3300006028 Bacteria 9146
77 Ga0068871_100244556 3300006358 Bacteria 1561
78 Ga0068871_101768650 3300006358 Unclassified 587
79 Ga0075428_100000192 3300006844 Bacteria 57853
80 Ga0075428_100924126 3300006844 Bacteria 925
81 Ga0075430_100323514 3300006846 Bacteria 1275
82 Ga0075430_100819342 3300006846 Unclassified 767
83 Ga0075431_100198446 3300006847 Bacteria 2054
84 Ga0075431_101067458 3300006847 Bacteria 773
85 Ga0075431_101389653 3300006847 Bacteria 662
86 Ga0075429_100010512 3300006880 Bacteria 8004
87 Ga0075429_100057864 3300006880 Bacteria 3375
88 Ga0075429_100072110 3300006880 Bacteria 3007
89 Ga0075429_100319898 3300006880 Bacteria 1358
90 Ga0075429_101571925 3300006880 Unclassified 572
91 Ga0068865_100059463 3300006881 Bacteria 2673
92 Ga0075436_100981128 3300006914 Bacteria 634
93 Ga0097620_100225094 3300006931 Bacteria 1964
94 Ga0097620_100657632 3300006931 Bacteria 1140
95 Ga0097620_101086841 3300006931 Bacteria 880
96 Ga0075435_100226056 3300007076 Bacteria 1590
97 Ga0105240_12008665 3300009093 Bacteria 601
98 Ga0111539_10000550 3300009094 Bacteria 47896
99 Ga0111539_10145188 3300009094 Bacteria 2778
100 Ga0111539_10247092 3300009094 Unclassified 2077
101 Ga0111539_11034020 3300009094 Bacteria 955
102 Ga0105245_11809219 3300009098 Bacteria 664
103 Ga0105243_10670406 3300009148 Bacteria 1007
104 Ga0105241_12016748 3300009174 Bacteria 568
105 Ga0105242_12019804 3300009176 Bacteria 619
106 Ga0105248_10286229 3300009177 Bacteria 1856
107 Ga0105248_12877547 3300009177 Bacteria 549
108 Ga0105237_10082704 3300009545 Bacteria 3201
109 Ga0105237_11056178 3300009545 Bacteria 819
110 Ga0105238_11519344 3300009551 Bacteria 699
111 Ga0105238_12048343 3300009551 Bacteria 606
112 Ga0105249_10230002 3300009553 Bacteria 1828
113 Ga0105249_12974342 3300009553 Bacteria 544
114 Ga0105239_10458516 3300010375 Bacteria 1447
115 Ga0105246_11069626 3300011119 Bacteria 735
116 Ga0157378_10179923 3300013297 Bacteria 1988
117 Ga0163162_12446095 3300013306 Bacteria 600
118 Ga0157372_10506633 3300013307 Unclassified 1407
119 Ga0157372_13352494 3300013307 Bacteria 510
120 Ga0157375_11815867 3300013308 Bacteria 723
121 Ga0163163_11386629 3300014325 Bacteria 765
122 Ga0157380_12567636 3300014326 Unclassified 575
123 Ga0157377_10823868 3300014745 Bacteria 686
124 Ga0157379_12262212 3300014968 Bacteria 541
125 Ga0157376_11754774 3300014969 Bacteria 656
126 Ga0157376_12624945 3300014969 Bacteria 544
127 Ga0157376_12894670 3300014969 Bacteria 519
128 Ga0182007_10191637 3300015262 Bacteria 711
129 Ga0163161_10026391 3300017792 Unclassified 4115
130 Ga0213876_10131603 3300021384 Bacteria 1329
131 Ga0213876_10516080 3300021384 Bacteria 636
132 Ga0207653_10180595 3300025885 Bacteria 789
133 Ga0207642_10249109 3300025899 Bacteria 1007
134 Ga0207688_10828776 3300025901 Viruses 586
135 Ga0207705_10143970 3300025909 Bacteria 1782
136 Ga0207684_10022451 3300025910 Bacteria 5386
137 Ga0207654_10307267 3300025911 Bacteria 1080
138 Ga0207707_10849580 3300025912 Bacteria 758
139 Ga0207671_10083757 3300025914 Unclassified 2394
140 Ga0207671_10604609 3300025914 Bacteria 874
141 Ga0207660_10962384 3300025917 Unclassified 696
142 Ga0207662_10300241 3300025918 Bacteria 1067
143 Ga0207662_10837193 3300025918 Unclassified 650
144 Ga0207652_10330353 3300025921 Bacteria 1377
145 Ga0207652_10743726 3300025921 Bacteria 873
146 Ga0207646_10000095 3300025922 Bacteria 117382
147 Ga0207694_11516294 3300025924 Bacteria 566
148 Ga0207659_11021244 3300025926 Bacteria 712
149 Ga0207659_11366655 3300025926 Bacteria 607
150 Ga0207664_11792970 3300025929 Bacteria 536
151 Ga0207709_10429768 3300025935 Bacteria 1016
152 Ga0207670_10064179 3300025936 Bacteria 2516
153 Ga0207670_10114749 3300025936 Bacteria 1947
154 Ga0207670_11187983 3300025936 Bacteria 645
155 Ga0207669_10626246 3300025937 Bacteria 877
156 Ga0207704_10023486 3300025938 Bacteria 3325
157 Ga0207711_10395907 3300025941 Bacteria 1283
158 Ga0207689_10161918 3300025942 Bacteria 1843
159 Ga0207689_10596937 3300025942 Bacteria 929
160 Ga0207661_10733659 3300025944 Bacteria 909
161 Ga0207667_10201077 3300025949 Bacteria 2044
162 Ga0207712_10253870 3300025961 Bacteria 1423
163 Ga0207640_10399902 3300025981 Bacteria 1118
164 Ga0207658_10055264 3300025986 Bacteria 2942
165 Ga0207677_10759470 3300026023 Bacteria 865
166 Ga0207639_10082516 3300026041 Bacteria 2548
167 Ga0207678_10710160 3300026067 Bacteria 885
168 Ga0207708_10764489 3300026075 Bacteria 830
169 Ga0207708_11864075 3300026075 Bacteria 527
170 Ga0207702_10113609 3300026078 Bacteria 2412
171 Ga0207641_10191619 3300026088 Bacteria 1879
172 Ga0207648_11091578 3300026089 Bacteria 748
173 Ga0207676_10127855 3300026095 Bacteria 2155
174 Ga0207676_10140161 3300026095 Bacteria 2069
175 Ga0207676_10456030 3300026095 Bacteria 1206
176 Ga0207676_10606832 3300026095 Bacteria 1052
177 Ga0207676_12235147 3300026095 Unclassified 545
178 Ga0207674_10848795 3300026116 Bacteria 881
179 Ga0207674_11158166 3300026116 Bacteria 743
180 Ga0207675_100160104 3300026118 Bacteria 2147
181 Ga0207675_100611987 3300026118 Bacteria 1093
182 Ga0207683_11300284 3300026121 Bacteria 673
183 Ga0207698_11094853 3300026142 Viruses 809
184 Ga0207428_10006501 3300027907 Bacteria 10789
185 Ga0268266_10221473 3300028379 Bacteria 1739
186 Ga0268266_10797586 3300028379 Bacteria 912
187 Ga0268266_11441628 3300028379 Unclassified 664
188 Ga0268266_11726823 3300028379 Unclassified 601
189 Ga0268264_10185072 3300028381 Bacteria 1894
190 Ga0268264_10343392 3300028381 Bacteria 1419
191 Ga0265319_1081480 3300028563 Unclassified 1027
192 Ga0307517_10071674 3300028786 Bacteria 3102
193 Ga0307515_10604607 3300028794 Bacteria 707
194 Ga0265338_10039599 3300028800 Unclassified 4443
195 Ga0265338_10062103 3300028800 Bacteria 3268
196 Ga0307513_10163387 3300031456 Bacteria 2115
197 Ga0307509_10000039 3300031507 Bacteria 185329
198 Ga0307509_10008198 3300031507 Bacteria 13378
199 Ga0307509_10113816 3300031507 Bacteria 2702
200 Ga0307509_10180547 3300031507 Bacteria 1976
201 Ga0307509_10530946 3300031507 Bacteria 857
202 Ga0307508_10082543 3300031616 Bacteria 2796
203 Ga0307508_10534734 3300031616 Bacteria 769
204 Ga0307516_10035119 3300031730 Bacteria 5032
205 Ga0326468_10022386 3300031889 Bacteria 768
206 Ga0307406_10029934 3300031901 Bacteria 3300
207 Ga0307406_10497156 3300031901 Bacteria 988
208 Ga0307415_100054267 3300032126 Bacteria 2735
209 Ga0307415_100094255 3300032126 Bacteria 2176
210 Ga0307415_101747351 3300032126 Bacteria 601
211 Ga0307507_10145271 3300033179 Bacteria 1804
212 Ga0373949_0000141 3300035090 Bacteria 27063
213 Ga0373932_0189602 3300035112 Bacteria 726
214 Ga0373936_0000043 3300035113 Bacteria 87319
215 Ga0373939_0024966 3300035114 Bacteria 1670
216 Ga0373941_0196723 3300035115 Bacteria 764
217 Ga0373956_0210894 3300035119 Bacteria 921
218 Ga0373960_0067810 3300035121 Bacteria 1097
219 Ga0373946_0587201 3300035171 Unclassified 577
220 Ga0395899_0111424 3300037312 Bacteria 1967
221 Ga0395900_0164128 3300037418 Bacteria 2264
222 Ga0395901_0048698 3300038443 Bacteria 4401
223 Ga0436365_0140212 3300039437 Bacteria 2159
224 Ga0436365_0168134 3300039437 Bacteria 2181
225 Ga0436365_1603277 3300039437 Bacteria 717
226 Ga0436363_1060006 3300039450 Unclassified 684
227 Ga0436363_1690926 3300039450 Bacteria 1554
228 Ga0436362_0824570 3300039453 Unclassified 768
229 Ga0451791_0698399 3300041451 Bacteria 603
230 Ga0451797_0944496 3300041453 Bacteria 682
231 Ga0451807_1019777 3300041486 Bacteria 566
232 Ga0451839_0134918 3300041496 Bacteria 608
233 Ga0451849_0199681 3300041505 Bacteria 1038
234 Ga0453684_0107104 3300044712 Bacteria 3405
235 Ga0451576_0041888 3300045051 Bacteria 4838
236 Ga0451576_0089405 3300045051 Bacteria 3203
237 Ga0495650_0059386 3300046471 Bacteria 1540
238 Ga0495596_0034048 3300046500 Bacteria 2025
239 Ga0495630_1070848 3300046517 Bacteria 612
240 Ga0495630_1133320 3300046517 Unclassified 592
241 Ga0495622_0283321 3300046557 Unclassified 724
242 Ga0495625_0534655 3300046660 Unclassified 712
243 Ga0496101_0737766 3300048904 Unclassified 777
244 Ga0501291_041424 3300049514 Unclassified 811
245 Ga0501298_004672 3300049521 Archaea 2168
246 Ga0501299_059468 3300049522 Bacteria 806
247 Ga0501034_0118629 3300049571 Bacteria 2633
248 Ga0501036_0214014 3300049572 Unclassified 1619
249 Ga0501037_0076235 3300049573 Bacteria 2435
250 Ga0501043_0494147 3300049579 Bacteria 915
251 Ga0501046_0282020 3300049580 Bacteria 1217
252 Ga0501067_0139086 3300049583 Bacteria 1352
253 Ga0501068_0119202 3300049584 Bacteria 1645
254 Ga0501069_0002573 3300049585 Bacteria 9262
255 Ga0501070_0049714 3300049586 Bacteria 3481
256 Ga0501070_0088978 3300049586 Bacteria 2555
257 Ga0501070_0115122 3300049586 Bacteria 2221
258 Ga0501070_0567195 3300049586 Unclassified 907
259 Ga0501071_0203183 3300049587 Bacteria 1489
260 Ga0501071_0879817 3300049587 Bacteria 691
261 Ga0501072_0239400 3300049588 Bacteria 1445
262 Ga0501072_0891344 3300049588 Bacteria 695
263 Ga0501073_1237215 3300049589 Bacteria 512
264 Ga0501074_0136421 3300049590 Bacteria 1755
265 Ga0501074_0746647 3300049590 Bacteria 690
266 Ga0501207_070024 3300049654 Unclassified 657
267 Ga0501209_040094 3300049656 Unclassified 1235
268 Ga0501216_002677 3300049660 Bacteria 2549
269 Ga0501217_151225 3300049661 Bacteria 694
270 Ga0501230_000509 3300049667 Bacteria 3931
271 Ga0501233_007147 3300049668 Bacteria 2120
272 Ga0501235_018643 3300049669 Bacteria 1539
273 Ga0501257_081475 3300049686 Unclassified 835
274 Ga0501221_028427 3300049704 Bacteria 1150
275 Ga0501225_0007178 3300049705 Bacteria 3234
276 Ga0501083_0090468 3300049744 Bacteria 2021
277 Ga0501267_017100 3300049764 Bacteria 777
278 Ga0501035_0001304 3300049822 Bacteria 25773
279 Ga0501035_0391964 3300049822 Bacteria 1157
280 Ga0501044_0326335 3300049823 Bacteria 1458
281 Ga0501045_1399424 3300049824 Bacteria 508
282 nmdc:mga09592_24625_c1 3300050508 Bacteria 4979
283 nmdc:mga09592_246540_c1 3300050508 Bacteria 1548
284 nmdc:mga09592_40986_c1 3300050508 Bacteria 3892
285 nmdc:mga09592_72937_c1 3300050508 Bacteria 2916
286 nmdc:mga0qj67_321660_c1 3300050509 Bacteria 1252
287 nmdc:mga06r32_159014_c1 3300050510 Bacteria 2241
288 nmdc:mga06r32_830394_c1 3300050510 Bacteria 883
289 nmdc:mga08y16_104169_c1 3300050511 Bacteria 2953
290 nmdc:mga08y16_369296_c1 3300050511 Bacteria 1472
291 nmdc:mga08y16_42414_c1 3300050511 Bacteria 4766
292 nmdc:mga08y16_640630_c1 3300050511 Bacteria 1068
293 nmdc:mga0n895_1034091_c1 3300050512 Bacteria 801
294 nmdc:mga0n895_1752511_c1 3300050512 Bacteria 583
295 nmdc:mga0rr50_356679_c1 3300050513 Bacteria 1230
296 nmdc:mga08x19_389524_c1 3300050514 Bacteria 976
297 Ga0500635_0006059 3300053080 Bacteria 3213
298 Ga0495595_0594619 3300053084 Viruses 566
299 Ga0500647_0148043 3300053091 Bacteria 1097
300 Ga0500583_0361633 3300053092 Bacteria 702
301 Ga0500566_0005407 3300053094 Bacteria 7597
302 Ga0500566_0032321 3300053094 Bacteria 3051
303 Ga0500566_0365621 3300053094 Bacteria 656
304 Ga0500640_000107 3300053095 Bacteria 15162
305 Ga0500654_083239 3300053099 Bacteria 1476
306 Ga0500554_000948 3300053102 Bacteria 5643
307 Ga0500572_005809 3300053111 Bacteria 2808
308 Ga0500595_005952 3300053119 Bacteria 5251
309 Ga0500597_028621 3300053120 Bacteria 2275
310 Ga0500597_101013 3300053120 Bacteria 1254
311 Ga0500597_255061 3300053120 Bacteria 716
312 Ga0500607_274737 3300053121 Bacteria 647
313 Ga0500608_094441 3300053122 Bacteria 1393
314 Ga0500614_000340 3300053123 Bacteria 12134
315 Ga0500642_0013156 3300053130 Bacteria 3031
316 Ga0500658_0417990 3300053134 Bacteria 613
317 Ga0500559_0001926 3300053136 Bacteria 11238
318 Ga0500564_156335 3300053138 Bacteria 968
319 Ga0500568_0030118 3300053139 Bacteria 2248
320 Ga0500568_0086877 3300053139 Bacteria 1182
321 Ga0500585_084632 3300053144 Bacteria 1146
322 Ga0500585_114458 3300053144 Bacteria 965
323 Ga0500590_109503 3300053148 Bacteria 1313
324 Ga0500603_001526 3300053150 Bacteria 5262
325 Ga0500627_0388169 3300053158 Bacteria 597
326 Ga0500656_038369 3300053732 Bacteria 662
327 Ga0500601_004266 3300053737 Bacteria 1553
328 Ga0501082_0260612 3300060353 Bacteria 1508
329 Ga0265316_10632186
330 rootL2_10221707
331 Ga0070683_100886677
332 Ga0068869_100284103
333 Ga0070682_100142307
334 Ga0070682_101261872
335 Ga0070682_101397987
336 Ga0068868_100828025
337 Ga0068868_101995337
338 Ga0070689_100151147
339 Ga0070689_100195387
340 Ga0070689_100501690
341 Ga0070689_100984054
342 Ga0070689_101953978
343 Ga0070692_10322288
344 Ga0070675_101236080
345 Ga0070674_101633716
346 Ga0070688_100363248
347 Ga0070688_100776038
348 Ga0070688_101382213
349 Ga0070667_100131107
350 Ga0070703_10284387
351 Ga0070714_100809059
352 Ga0070714_101996009
353 Ga0070701_10890492
354 Ga0070701_10920633
355 Ga0070705_101144118
356 Ga0070694_100267394
357 Ga0070663_100289346
358 Ga0070678_100185339
359 Ga0070678_101139287
360 Ga0070681_10787571
361 Ga0070685_10115521
362 Ga0070685_10376541
363 Ga0070685_11172719
364 Ga0070706_100006047
365 Ga0070707_100000276
366 Ga0070698_100048798
367 Ga0070699_100150046
368 Ga0070699_101271966
369 Ga0070679_100367146
370 Ga0070679_100466317
371 Ga0070679_101134359
372 Ga0070684_100342850
373 Ga0070697_100705703
374 Ga0068853_100046845
375 Ga0070695_101204471
376 Ga0070665_100197516
377 Ga0070665_101001108
378 Ga0070665_101280200
379 Ga0070665_101666336
380 Ga0070704_100863650
381 Ga0068855_100165112
382 Ga0068857_100713467
383 Ga0068857_101186838
384 Ga0068857_101263196
385 Ga0068854_100797704
386 Ga0068856_100009712
387 Ga0070702_100220400
388 Ga0070702_100645572
389 Ga0068859_100225113
390 Ga0068859_100657612
391 Ga0068859_101086926
392 Ga0068864_100215185
393 Ga0068864_100425435
394 Ga0068864_100539209
395 Ga0068864_100936357
396 Ga0068866_10022202
397 Ga0068861_100119153
398 Ga0068861_100222606
399 Ga0068863_100228869
400 Ga0068863_102022749
401 Ga0068858_101084370
402 Ga0068860_100678163
403 Ga0068862_101096053
404 Ga0070717_10005643
405 Ga0068871_100244556
406 Ga0068871_101768650
407 Ga0075428_100000192
408 Ga0075428_100924126
409 Ga0075430_100323514
410 Ga0075430_100819342
411 Ga0075431_100198446
412 Ga0075431_101067458
413 Ga0075431_101389653
414 Ga0075429_100010512
415 Ga0075429_100057864
416 Ga0075429_100072110
417 Ga0075429_100319898
418 Ga0075429_101571925
419 Ga0068865_100059463
420 Ga0075436_100981128
421 Ga0097620_100225094
422 Ga0097620_100657632
423 Ga0097620_101086841
424 Ga0075435_100226056
425 Ga0105240_12008665
426 Ga0111539_10000550
427 Ga0111539_10145188
428 Ga0111539_10247092
429 Ga0111539_11034020
430 Ga0105245_11809219
431 Ga0105243_10670406
432 Ga0105241_12016748
433 Ga0105242_12019804
434 Ga0105248_10286229
435 Ga0105248_12877547
436 Ga0105237_10082704
437 Ga0105237_11056178
438 Ga0105238_11519344
439 Ga0105238_12048343
440 Ga0105249_10230002
441 Ga0105249_12974342
442 Ga0105239_10458516
443 Ga0105246_11069626
444 Ga0157378_10179923
445 Ga0163162_12446095
446 Ga0157372_10506633
447 Ga0157372_13352494
448 Ga0157375_11815867
449 Ga0163163_11386629
450 Ga0157380_12567636
451 Ga0157377_10823868
452 Ga0157379_12262212
453 Ga0157376_11754774
454 Ga0157376_12624945
455 Ga0157376_12894670
456 Ga0182007_10191637
457 Ga0163161_10026391
458 Ga0213876_10131603
459 Ga0213876_10516080
460 Ga0207653_10180595
461 Ga0207642_10249109
462 Ga0207688_10828776
463 Ga0207705_10143970
464 Ga0207684_10022451
465 Ga0207654_10307267
466 Ga0207707_10849580
467 Ga0207671_10083757
468 Ga0207671_10604609
469 Ga0207660_10962384
470 Ga0207662_10300241
471 Ga0207662_10837193
472 Ga0207652_10330353
473 Ga0207652_10743726
474 Ga0207646_10000095
475 Ga0207694_11516294
476 Ga0207659_11021244
477 Ga0207659_11366655
478 Ga0207664_11792970
479 Ga0207709_10429768
480 Ga0207670_10064179
481 Ga0207670_10114749
482 Ga0207670_11187983
483 Ga0207669_10626246
484 Ga0207704_10023486
485 Ga0207711_10395907
486 Ga0207689_10161918
487 Ga0207689_10596937
488 Ga0207661_10733659
489 Ga0207667_10201077
490 Ga0207712_10253870
491 Ga0207640_10399902
492 Ga0207658_10055264
493 Ga0207677_10759470
494 Ga0207639_10082516
495 Ga0207678_10710160
496 Ga0207708_10764489
497 Ga0207708_11864075
498 Ga0207702_10113609
499 Ga0207641_10191619
500 Ga0207648_11091578
501 Ga0207676_10127855
502 Ga0207676_10140161
503 Ga0207676_10456030
504 Ga0207676_10606832
505 Ga0207676_12235147
506 Ga0207674_10848795
507 Ga0207674_11158166
508 Ga0207675_100160104
509 Ga0207675_100611987
510 Ga0207683_11300284
511 Ga0207698_11094853
512 Ga0207428_10006501
513 Ga0268266_10221473
514 Ga0268266_10797586
515 Ga0268266_11441628
516 Ga0268266_11726823
517 Ga0268264_10185072
518 Ga0268264_10343392
519 Ga0265319_1081480
520 Ga0307517_10071674
521 Ga0307515_10604607
522 Ga0265338_10039599
523 Ga0265338_10062103
524 Ga0307513_10163387
525 Ga0307509_10000039
526 Ga0307509_10008198
527 Ga0307509_10113816
528 Ga0307509_10180547
529 Ga0307509_10530946
530 Ga0307508_10082543
531 Ga0307508_10534734
532 Ga0307516_10035119
533 Ga0326468_10022386
534 Ga0307406_10029934
535 Ga0307406_10497156
536 Ga0307415_100054267
537 Ga0307415_100094255
538 Ga0307415_101747351
539 Ga0307507_10145271
540 Ga0373949_0000141
541 Ga0373932_0189602
542 Ga0373936_0000043
543 Ga0373939_0024966
544 Ga0373941_0196723
545 Ga0373956_0210894
546 Ga0373960_0067810
547 Ga0373946_0587201
548 Ga0395899_0111424
549 Ga0395900_0164128
550 Ga0395901_0048698
551 Ga0436365_0140212
552 Ga0436365_0168134
553 Ga0436365_1603277
554 Ga0436363_1060006
555 Ga0436363_1690926
556 Ga0436362_0824570
557 Ga0451791_0698399
558 Ga0451797_0944496
559 Ga0451807_1019777
560 Ga0451839_0134918
561 Ga0451849_0199681
562 Ga0453684_0107104
563 Ga0451576_0041888
564 Ga0451576_0089405
565 Ga0495650_0059386
566 Ga0495596_0034048
567 Ga0495630_1070848
568 Ga0495630_1133320
569 Ga0495622_0283321
570 Ga0495625_0534655
571 Ga0496101_0737766
572 Ga0501291_041424
573 Ga0501298_004672
574 Ga0501299_059468
575 Ga0501034_0118629
576 Ga0501036_0214014
577 Ga0501037_0076235
578 Ga0501043_0494147
579 Ga0501046_0282020
580 Ga0501067_0139086
581 Ga0501068_0119202
582 Ga0501069_0002573
583 Ga0501070_0049714
584 Ga0501070_0088978
585 Ga0501070_0115122
586 Ga0501070_0567195
587 Ga0501071_0203183
588 Ga0501071_0879817
589 Ga0501072_0239400
590 Ga0501072_0891344
591 Ga0501073_1237215
592 Ga0501074_0136421
593 Ga0501074_0746647
594 Ga0501207_070024
595 Ga0501209_040094
596 Ga0501216_002677
597 Ga0501217_151225
598 Ga0501230_000509
599 Ga0501233_007147
600 Ga0501235_018643
601 Ga0501257_081475
602 Ga0501221_028427
603 Ga0501225_0007178
604 Ga0501083_0090468
605 Ga0501267_017100
606 Ga0501035_0001304
607 Ga0501035_0391964
608 Ga0501044_0326335
609 Ga0501045_1399424
610 nmdc:mga09592_24625_c1
611 nmdc:mga09592_246540_c1
612 nmdc:mga09592_40986_c1
613 nmdc:mga09592_72937_c1
614 nmdc:mga0qj67_321660_c1
615 nmdc:mga06r32_159014_c1
616 nmdc:mga06r32_830394_c1
617 nmdc:mga08y16_104169_c1
618 nmdc:mga08y16_369296_c1
619 nmdc:mga08y16_42414_c1
620 nmdc:mga08y16_640630_c1
621 nmdc:mga0n895_1034091_c1
622 nmdc:mga0n895_1752511_c1
623 nmdc:mga0rr50_356679_c1
624 nmdc:mga08x19_389524_c1
625 Ga0500635_0006059
626 Ga0495595_0594619
627 Ga0500647_0148043
628 Ga0500583_0361633
629 Ga0500566_0005407
630 Ga0500566_0032321
631 Ga0500566_0365621
632 Ga0500640_000107
633 Ga0500654_083239
634 Ga0500554_000948
635 Ga0500572_005809
636 Ga0500595_005952
637 Ga0500597_028621
638 Ga0500597_101013
639 Ga0500597_255061
640 Ga0500607_274737
641 Ga0500608_094441
642 Ga0500614_000340
643 Ga0500642_0013156
644 Ga0500658_0417990
645 Ga0500559_0001926
646 Ga0500564_156335
647 Ga0500568_0030118
648 Ga0500568_0086877
649 Ga0500585_084632
650 Ga0500585_114458
651 Ga0500590_109503
652 Ga0500603_001526
653 Ga0500627_0388169
654 Ga0500656_038369
655 Ga0500601_004266
656 Ga0501082_0260612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uc8-assembly2.cif.gz_A n-terminal globular domain of the rsv nucleoprotein in complex with c- terminal phenylalanine of the phosphoprotein 0.699 45 64
4uca-assembly2.cif.gz_B n-terminal globular domain of the rsv nucleoprotein in complex with c- terminal peptide of the phosphoprotein 0.6986 45 66
4ucb-assembly2.cif.gz_A n-terminal globular domain of the rsv nucleoprotein in complex with c- terminal peptide of the phosphoprotein 0.6615 45 64
3j31-assembly1.cif.gz_P life in the extremes: atomic structure of sulfolobus turreted icosahedral virus 0.6584 41 64
4uc6-assembly2.cif.gz_B n-terminal globular domain of the rsv nucleoprotein 0.6537 45 64
ID Description Score Start End Superfamily
af_Q2FY50_278_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7638 45 67 3.40.50.300
af_P47821_1_123_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7546 46 65 3.60.20.10
af_A0A1D6PQV4_1_250_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7115 45 69 1.10.510.10
af_Q19000_114_414_3.60.130.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.7074 45 70 3.60.130.10
af_P91364_76_507_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6987 44 64 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A085WGJ5-F1-model_v4 Lipoprotein 0.9877 4 77
AF-A0A1H9ZCW5-F1-model_v4 Uncharacterized protein 0.9812 4 77
AF-A0A832CMJ6-F1-model_v4 Uncharacterized protein 0.9657 4 77
AF-A0A848LG19-F1-model_v4 Lipoprotein 0.958 4 77
AF-A0A3R7CLR2-F1-model_v4 deleted 0.9471 6 74

Map