F409205

General Info

Members Datasets Scaffolds Average Seq Length
328 230 273 382

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000008|Ga0079104_1000008258
Length 403
Sequence MNTRIPQSTLDAAAVNRPLRGRVAIAGAATYGCGEAPGMDDMTLLVRAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVDGTMIGGSSFIAHLLPAIRALEAGQCKAVLVCYGSAQRSATFGRKEGQAARRFLDPQPYEFPYEPVLPVTAYALAAARHMHEFGTTREQLAEVAVAARAWAQLNPEAFMRDPLTIEDVLSARPIASPLSVRDCCLVTDGAGAIVLVRGERARDLPRPPVYVLGNATAIWNRQISCMPDLTTTAAAQSGAQAFAMAGLTAADMDMAQVYDAFTINTLLFLEDLGFCAKGEGGAFVSKGGIAPGGRLAVNTNGGGLSCVHPGMYGIFALIEAVRQLRGEAGQRQLGRHRTAVVHGNGGTLSSQSTAVLGTAEAL

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2517572101 Frankia sp. DC12 Isolate Nodule
6 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
9 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
10 2643221569 Achromobacter sp. Root565 Isolate Unclassified
11 2643221594 Achromobacter sp. Root170 Isolate Unclassified
12 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
13 2643221621 Achromobacter sp. Root83 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221733 Bosea sp. Root381 Isolate Unclassified
18 2721755523 Delftia sp. HK171 Isolate Unclassified
19 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
20 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
21 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
22 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
23 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
24 2842677519 Variovorax sp. R-72495 Isolate Unclassified
25 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
26 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
27 2858950400 Achromobacter sp. K91 Isolate Unclassified
28 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
29 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
30 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
31 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
32 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
33 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
34 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
35 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
36 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
37 2929520902 Variovorax beijingensis 502 Isolate Unclassified
38 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
39 2941479691
40 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
41 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
42 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
124 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
125 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
158 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
159 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
163 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 8002775197 Frankia nepalensis CN7 Isolate Nodule
230 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.93
Metatranscriptomes 0.61
Isolates 16.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.85
Nodule 4.27
Rhizoplane 3.05
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 26.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000254 3300003187 Bacteria 62429
2 JGI25151J46595_10000357 3300003187 Bacteria 48666
3 Ga0006562J51391_1028714 3300003578 Bacteria 4602
4 Ga0006562J51391_1028715 3300003578 Bacteria 2540
5 Ga0055537_1000064 3300003773 Bacteria 77134
6 Ga0055536_1004216 3300003781 Bacteria 7425
7 Ga0055534_1003498 3300003784 Bacteria 4914
8 Ga0055528_1007269 3300003790 Bacteria 4914
9 Ga0055530_10003198 3300003791 Bacteria 9599
10 Ga0055540_1000610 3300003792 Bacteria 25546
11 Ga0055540_1001790 3300003792 Bacteria 12221
12 Ga0055531_10000084 3300003794 Bacteria 102550
13 Ga0070667_100120150 3300005367 Bacteria 2285
14 Ga0070711_100018430 3300005439 Bacteria 4457
15 Ga0070698_100254922 3300005471 Bacteria 1687
16 Ga0070679_100048610 3300005530 Bacteria 4225
17 Ga0070665_100020091 3300005548 Bacteria 6705
18 Ga0068855_100127226 3300005563 Bacteria 2912
19 Ga0068856_100042229 3300005614 Bacteria 4485
20 Ga0068866_10018085 3300005718 Bacteria 3183
21 Ga0068858_100019423 3300005842 Bacteria 6355
22 Ga0068860_100024136 3300005843 Bacteria 5879
23 Ga0075363_100014525 3300006048 Bacteria 3851
24 Ga0075363_100139663 3300006048 Bacteria 1363
25 Ga0075364_10003257 3300006051 Bacteria 9192
26 Ga0075362_10001585 3300006177 Bacteria 7366
27 Ga0075362_10004561 3300006177 Bacteria 4990
28 Ga0075362_10026067 3300006177 Bacteria 2494
29 Ga0075366_10005468 3300006195 Bacteria 6883
30 Ga0075366_10015909 3300006195 Bacteria 4318
31 Ga0075366_10045906 3300006195 Bacteria 2588
32 Ga0075370_10001502 3300006353 Bacteria 10182
33 Ga0075370_10074975 3300006353 Bacteria 1939
34 Ga0075370_10100797 3300006353 Bacteria 1671
35 Ga0075430_100148393 3300006846 Bacteria 1953
36 Ga0075434_100046415 3300006871 Bacteria 4311
37 Ga0075429_100000515 3300006880 Bacteria 29279
38 Ga0079104_1000008 3300006946 Bacteria 371223
39 Ga0099826_10000031 3300006948 Bacteria 124966
40 Ga0099826_10002996 3300006948 Bacteria 11245
41 Ga0099826_10074282 3300006948 Bacteria 2145
42 Ga0105250_10000607 3300009092 Bacteria 23329
43 Ga0105240_10006694 3300009093 Bacteria 16895
44 Ga0105245_10002039 3300009098 Bacteria 18326
45 Ga0105243_10192480 3300009148 Bacteria 1782
46 Ga0105241_10049097 3300009174 Bacteria 3213
47 Ga0105248_10031080 3300009177 Bacteria 5968
48 Ga0105237_10055118 3300009545 Bacteria 3982
49 Ga0105238_10041600 3300009551 Bacteria 4654
50 Ga0105249_10252102 3300009553 Bacteria 1750
51 Ga0105239_10117838 3300010375 Bacteria 2947
52 Ga0157373_10016774 3300013100 Bacteria 5338
53 Ga0157371_10065751 3300013102 Bacteria 2568
54 Ga0157378_10021906 3300013297 Bacteria 5619
55 Ga0157376_10251659 3300014969 Bacteria 1650
56 Ga0182006_1009496 3300015261 Bacteria 4358
57 Ga0163161_10003274 3300017792 Bacteria 11384
58 Ga0213872_10005513 3300021361 Bacteria 6490
59 Ga0209258_102846 3300025242 Bacteria 4124
60 Ga0209565_1000025 3300025263 Bacteria 377969
61 Ga0209455_1000566 3300025272 Bacteria 24635
62 Ga0209673_1000149 3300025273 Bacteria 148659
63 Ga0209675_1000017 3300025291 Bacteria 378002
64 Ga0209676_1000123 3300025292 Bacteria 195351
65 Ga0209676_1021977 3300025292 Bacteria 2126
66 Ga0209025_1000003 3300025294 Bacteria 1366495
67 Ga0209025_1000019 3300025294 Bacteria 631548
68 Ga0209025_1020619 3300025294 Bacteria 3594
69 Ga0209050_1000188 3300025298 Bacteria 138865
70 Ga0209050_1005397 3300025298 Bacteria 8070
71 Ga0209051_1000091 3300025303 Bacteria 173683
72 Ga0209051_1000444 3300025303 Bacteria 55960
73 Ga0209257_1000057 3300025304 Bacteria 396985
74 Ga0207695_10368013 3300025913 Bacteria 1324
75 Ga0207693_10009830 3300025915 Bacteria 7784
76 Ga0207657_10082647 3300025919 Bacteria 2696
77 Ga0207652_10049529 3300025921 Bacteria 3596
78 Ga0207694_10121128 3300025924 Bacteria 2089
79 Ga0207687_10030822 3300025927 Bacteria 3619
80 Ga0207709_10000070 3300025935 Bacteria 183020
81 Ga0207665_10032947 3300025939 Bacteria 3432
82 Ga0207691_10082798 3300025940 Bacteria 2881
83 Ga0207689_10110489 3300025942 Bacteria 2259
84 Ga0207667_10046823 3300025949 Bacteria 4580
85 Ga0207668_10208035 3300025972 Bacteria 1563
86 Ga0207677_10014210 3300026023 Bacteria 4641
87 Ga0207702_10133541 3300026078 Bacteria 2236
88 Ga0207648_10014324 3300026089 Bacteria 7329
89 Ga0207675_100183605 3300026118 Bacteria 2004
90 Ga0209281_1000029 3300027111 Bacteria 431495
91 Ga0209282_1000011 3300027666 Bacteria 217665
92 Ga0209282_1016026 3300027666 Bacteria 4768
93 Ga0209974_10009647 3300027876 Bacteria 3275
94 Ga0207428_10030271 3300027907 Bacteria 4477
95 Ga0268264_10067031 3300028381 Bacteria 3029
96 Ga0307517_10091895 3300028786 Bacteria 2474
97 Ga0307515_10000014 3300028794 Bacteria 562358
98 Ga0307515_10000020 3300028794 Bacteria 411735
99 Ga0307515_10001078 3300028794 Bacteria 62511
100 Ga0307515_10004453 3300028794 Bacteria 29008
101 Ga0307515_10008667 3300028794 Bacteria 19791
102 Ga0307515_10015097 3300028794 Bacteria 14257
103 Ga0307512_10099679 3300030522 Bacteria 1975
104 Ga0316177_1042817 3300030731 Bacteria 1334
105 Ga0316178_1000969 3300030735 Bacteria 2979
106 Ga0316183_1098067 3300030742 Bacteria 4763
107 Ga0265327_10000049 3300031251 Bacteria 268046
108 Ga0307513_10000012 3300031456 Bacteria 328865
109 Ga0307513_10028784 3300031456 Bacteria 6345
110 Ga0307513_10049903 3300031456 Bacteria 4529
111 Ga0307513_10051293 3300031456 Bacteria 4452
112 Ga0307408_100005502 3300031548 Bacteria 8465
113 Ga0307408_100026477 3300031548 Bacteria 3984
114 Ga0307408_100038754 3300031548 Bacteria 3364
115 Ga0307408_100052489 3300031548 Bacteria 2940
116 Ga0307408_100142868 3300031548 Bacteria 1880
117 Ga0307508_10213474 3300031616 Bacteria 1530
118 Ga0307514_10049797 3300031649 Bacteria 3256
119 Ga0307516_10001147 3300031730 Bacteria 37031
120 Ga0307516_10006403 3300031730 Bacteria 13804
121 Ga0307516_10012543 3300031730 Bacteria 9122
122 Ga0307405_10069848 3300031731 Bacteria 2253
123 Ga0307405_10078706 3300031731 Bacteria 2146
124 Ga0307406_10001365 3300031901 Bacteria 13654
125 Ga0307412_10000979 3300031911 Bacteria 16330
126 Ga0307412_10001167 3300031911 Bacteria 15025
127 Ga0307412_10032577 3300031911 Bacteria 3304
128 Ga0307412_10140203 3300031911 Bacteria 1769
129 Ga0307409_100092874 3300031995 Bacteria 2478
130 Ga0307416_100056528 3300032002 Bacteria 3168
131 Ga0307416_100365223 3300032002 Bacteria 1467
132 Ga0307414_10032742 3300032004 Bacteria 3427
133 Ga0307414_10043634 3300032004 Bacteria 3056
134 Ga0307414_10088815 3300032004 Bacteria 2288
135 Ga0307415_100163574 3300032126 Bacteria 1728
136 Ga0373927_0010210 3300035695 Bacteria 6274
137 Ga0395900_0028936 3300037418 Bacteria 5680
138 Ga0395898_0087305 3300037466 Bacteria 3005
139 Ga0395905_0000421 3300037471 Bacteria 59264
140 Ga0395905_0004126 3300037471 Bacteria 15209
141 Ga0395905_0013832 3300037471 Bacteria 7720
142 Ga0395905_0041333 3300037471 Bacteria 4327
143 Ga0436364_1148617 3300037853 Bacteria 6939
144 Ga0395901_0011278 3300038443 Bacteria 9054
145 Ga0436361_0024002 3300039447 Bacteria 58799
146 Ga0436361_0998449 3300039447 Bacteria 1791
147 Ga0439436_0004120 3300041404 Bacteria 4453
148 Ga0439439_0000066 3300041406 Bacteria 13467
149 Ga0439439_0034745 3300041406 Bacteria 1293
150 Ga0439466_0005261 3300041411 Bacteria 4952
151 Ga0439465_0003856 3300041413 Bacteria 4892
152 Ga0451853_0232277 3300041512 Bacteria 2595
153 Ga0439431_0016919 3300041997 Bacteria 1711
154 Ga0439432_010218 3300042006 Bacteria 3256
155 Ga0439432_011067 3300042006 Bacteria 3111
156 Ga0439449_0006090 3300042007 Bacteria 4610
157 Ga0439452_008742 3300042010 Bacteria 3026
158 Ga0439457_021906 3300042014 Bacteria 1415
159 Ga0439462_0015261 3300042015 Bacteria 1979
160 Ga0439462_0018399 3300042015 Bacteria 1814
161 Ga0450911_000582 3300042115 Bacteria 11328
162 Ga0450920_004697 3300042122 Bacteria 2411
163 Ga0450896_008181 3300042133 Bacteria 1449
164 Ga0439446_0009406 3300042156 Bacteria 2616
165 Ga0439434_0008759 3300042435 Bacteria 2973
166 Ga0450918_001417 3300042531 Bacteria 4767
167 Ga0450893_0005876 3300042532 Bacteria 1977
168 Ga0451576_0021669 3300045051 Bacteria 6981
169 Ga0495627_000385 3300046453 Bacteria 40228
170 Ga0495650_0002886 3300046471 Bacteria 13080
171 Ga0495580_0001063 3300046472 Bacteria 24156
172 Ga0495605_0005515 3300046474 Bacteria 7363
173 Ga0495584_0009491 3300046491 Bacteria 5010
174 Ga0495607_0009241 3300046501 Bacteria 6696
175 Ga0495610_0001269 3300046512 Bacteria 22626
176 Ga0495616_0004150 3300046513 Bacteria 9182
177 Ga0495620_0035229 3300046515 Bacteria 2253
178 Ga0495630_0187040 3300046517 Bacteria 1580
179 Ga0495631_0000333 3300046518 Bacteria 32414
180 Ga0495632_0015276 3300046519 Bacteria 4314
181 Ga0495637_0002864 3300046520 Bacteria 9351
182 Ga0495643_0011809 3300046522 Bacteria 5299
183 Ga0495643_0059247 3300046522 Bacteria 2036
184 Ga0495642_0002886 3300046528 Bacteria 6856
185 Ga0495654_0000351 3300046530 Bacteria 39795
186 Ga0495609_0004901 3300046538 Bacteria 7193
187 Ga0495633_0009855 3300046558 Bacteria 5251
188 Ga0495625_0000056 3300046660 Bacteria 186024
189 Ga0495661_0002439 3300046665 Bacteria 14321
190 Ga0495661_0125582 3300046665 Bacteria 1412
191 Ga0495671_0001219 3300046692 Bacteria 17593
192 Ga0495674_0209141 3300047319 Bacteria 1617
193 Ga0495672_0000942 3300047320 Bacteria 30337
194 Ga0495687_001323 3300047443 Bacteria 23117
195 Ga0495687_036603 3300047443 Bacteria 2194
196 Ga0496101_0198456 3300048904 Bacteria 1550
197 Ga0496105_0143638 3300048908 Bacteria 1963
198 Ga0496107_0000159 3300048910 Bacteria 34333
199 Ga0496108_0005409 3300048911 Bacteria 10324
200 Ga0496110_0036038 3300048913 Bacteria 4295
201 Ga0496111_0016452 3300048914 Bacteria 5095
202 Ga0496113_0006116 3300048916 Bacteria 7596
203 Ga0496116_0007047 3300048919 Bacteria 10067
204 Ga0496116_0040701 3300048919 Bacteria 3197
205 Ga0496116_0046563 3300048919 Bacteria 2926
206 Ga0496116_0114352 3300048919 Bacteria 1576
207 Ga0496117_0099867 3300048920 Bacteria 1840
208 Ga0496118_0005781 3300048921 Bacteria 13889
209 Ga0496118_0011669 3300048921 Bacteria 8545
210 Ga0496118_0112388 3300048921 Bacteria 1803
211 Ga0496119_0001978 3300048922 Bacteria 23275
212 Ga0496119_0105431 3300048922 Bacteria 1575
213 Ga0496120_0003793 3300048923 Bacteria 13325
214 Ga0496121_0000314 3300048924 Bacteria 100909
215 Ga0496121_0001760 3300048924 Bacteria 35275
216 Ga0496121_0005771 3300048924 Bacteria 15704
217 Ga0496121_0044203 3300048924 Bacteria 3846
218 Ga0496121_0059778 3300048924 Bacteria 3140
219 Ga0496122_0000046 3300048925 Bacteria 274640
220 Ga0496122_0020624 3300048925 Bacteria 5942
221 Ga0496122_0133102 3300048925 Bacteria 1574
222 Ga0496123_0000082 3300048926 Bacteria 188909
223 Ga0496123_0002298 3300048926 Bacteria 23994
224 Ga0496123_0012894 3300048926 Bacteria 7074
225 Ga0496124_0000007 3300048927 Bacteria 883534
226 Ga0496124_0000459 3300048927 Bacteria 70625
227 Ga0496124_0014958 3300048927 Bacteria 7470
228 Ga0496124_0016559 3300048927 Bacteria 7000
229 Ga0496124_0027248 3300048927 Bacteria 5134
230 Ga0496124_0086638 3300048927 Bacteria 2563
231 Ga0496125_0000028 3300048928 Bacteria 387222
232 Ga0496125_0012469 3300048928 Bacteria 8436
233 Ga0496125_0015580 3300048928 Bacteria 7341
234 Ga0496125_0019457 3300048928 Bacteria 6402
235 Ga0496125_0020077 3300048928 Bacteria 6282
236 Ga0496125_0026435 3300048928 Bacteria 5289
237 Ga0496125_0066641 3300048928 Bacteria 2843
238 Ga0496126_0020011 3300048929 Bacteria 6575
239 Ga0496126_0190509 3300048929 Bacteria 1737
240 Ga0501033_0024190 3300049570 Bacteria 4582
241 Ga0501034_0086300 3300049571 Bacteria 3140
242 Ga0501034_0096031 3300049571 Bacteria 2960
243 Ga0501036_0145681 3300049572 Bacteria 1998
244 Ga0501037_0143991 3300049573 Bacteria 1705
245 Ga0501037_0162288 3300049573 Bacteria 1593
246 Ga0501038_0031829 3300049574 Bacteria 4659
247 Ga0501043_0078911 3300049579 Bacteria 2587
248 Ga0501043_0100654 3300049579 Bacteria 2272
249 Ga0501043_0170175 3300049579 Bacteria 1700
250 Ga0501047_0002464 3300049581 Bacteria 17651
251 Ga0501225_0006142 3300049705 Bacteria 3509
252 Ga0501262_000758 3300049759 Bacteria 3721
253 Ga0501035_0008851 3300049822 Bacteria 9366
254 Ga0501035_0019386 3300049822 Bacteria 6256
255 Ga0501035_0022709 3300049822 Bacteria 5762
256 Ga0501044_0000022 3300049823 Bacteria 201689
257 Ga0501044_0024648 3300049823 Bacteria 6383
258 nmdc:mga03683_1264_c1 3300050489 Bacteria 7490
259 nmdc:mga03683_36475_c1 3300050489 Bacteria 2000
260 nmdc:mga03683_40394_c2 3300050489 Bacteria 1459
261 nmdc:mga03n38_1980_c1 3300050490 Bacteria 6160
262 nmdc:mga00v17_15965_c1 3300050491 Bacteria 4226
263 nmdc:mga0yw44_44040_c1 3300050492 Bacteria 2668
264 nmdc:mga0k408_20605_c1 3300050493 Bacteria 3696
265 nmdc:mga0k408_29086_c1 3300050493 Bacteria 3144
266 nmdc:mga0k408_3282_c1 3300050493 Bacteria 8561
267 nmdc:mga06z11_75549_c1 3300050494 Bacteria 1794
268 nmdc:mga07m45_6855_c1 3300050496 Bacteria 5793
269 nmdc:mga07m45_94977_c1 3300050496 Bacteria 1710
270 nmdc:mga09592_365_c1 3300050508 Bacteria 33116
271 nmdc:mga0n895_35578_c1 3300050512 Bacteria 4802
272 nmdc:mga0sz30_6078_c1 3300050516 Bacteria 4467
273 Ga0500618_000848 3300053125 Bacteria 16475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_94977_c1 nmdc:mga07m45_94977_c1_14_988 324
2 3300049573 Ga0501037_0162288 Ga0501037_0162288_571_1560 329
3 3300042122 Ga0450920_004697 Ga0450920_004697_1263_2351 339
4 3300041406 Ga0439439_0034745 Ga0439439_0034745_210_1244 344
5 3300050494 nmdc:mga06z11_75549_c1 nmdc:mga06z11_75549_c1_100_1206 358
6 3300005367 Ga0070667_100120150 Ga0070667_1001201501 359
7 3300005439 Ga0070711_100018430 Ga0070711_1000184305 359
8 3300005548 Ga0070665_100020091 Ga0070665_1000200916 359
9 3300005842 Ga0068858_100019423 Ga0068858_1000194233 359
10 3300005843 Ga0068860_100024136 Ga0068860_1000241367 359
11 3300009098 Ga0105245_10002039 Ga0105245_1000203913 359
12 3300009174 Ga0105241_10049097 Ga0105241_100490973 359
13 3300009177 Ga0105248_10031080 Ga0105248_100310803 359
14 3300009545 Ga0105237_10055118 Ga0105237_100551182 359
15 3300013297 Ga0157378_10021906 Ga0157378_100219067 359
16 3300025915 Ga0207693_10009830 Ga0207693_100098303 359
17 3300025927 Ga0207687_10030822 Ga0207687_100308221 359
18 3300025942 Ga0207689_10110489 Ga0207689_101104892 359
19 3300026023 Ga0207677_10014210 Ga0207677_100142102 359
20 3300026078 Ga0207702_10133541 Ga0207702_101335412 359
21 3300035695 Ga0373927_0010210 Ga0373927_0010210_4239_5384 359
22 3300046517 Ga0495630_0187040 Ga0495630_0187040_132_1277 359
23 3300047319 Ga0495674_0209141 Ga0495674_0209141_58_1203 359
24 3300048904 Ga0496101_0198456 Ga0496101_0198456_291_1436 359
25 3300048908 Ga0496105_0143638 Ga0496105_0143638_355_1500 359
26 3300048911 Ga0496108_0005409 Ga0496108_0005409_8607_9752 359
27 3300048913 Ga0496110_0036038 Ga0496110_0036038_3031_4176 359
28 3300048914 Ga0496111_0016452 Ga0496111_0016452_3670_4815 359
29 3300031548 Ga0307408_100005502 Ga0307408_1000055022 360
30 3300031731 Ga0307405_10069848 Ga0307405_100698482 360
31 3300031901 Ga0307406_10001365 Ga0307406_100013659 360
32 3300025949 Ga0207667_10046823 Ga0207667_100468234 364
33 3300025972 Ga0207668_10208035 Ga0207668_102080352 366
34 3300003773 Ga0055537_1000064 Ga0055537_100006472 367
35 3300003781 Ga0055536_1004216 Ga0055536_10042168 367
36 3300003784 Ga0055534_1003498 Ga0055534_10034983 367
37 3300003790 Ga0055528_1007269 Ga0055528_10072693 367
38 3300003791 Ga0055530_10003198 Ga0055530_1000319810 367
39 3300003792 Ga0055540_1001790 Ga0055540_10017905 367
40 3300003794 Ga0055531_10000084 Ga0055531_1000008479 367
41 3300005614 Ga0068856_100042229 Ga0068856_1000422295 367
42 3300006048 Ga0075363_100014525 Ga0075363_1000145253 367
43 3300006048 Ga0075363_100139663 Ga0075363_1001396631 367
44 3300006051 Ga0075364_10003257 Ga0075364_100032571 367
45 3300006177 Ga0075362_10004561 Ga0075362_100045612 367
46 3300006177 Ga0075362_10026067 Ga0075362_100260672 367
47 3300006195 Ga0075366_10015909 Ga0075366_100159092 367
48 3300006948 Ga0099826_10002996 Ga0099826_100029964 367
49 3300006948 Ga0099826_10074282 Ga0099826_100742823 367
50 3300009553 Ga0105249_10252102 Ga0105249_102521022 367
51 3300010375 Ga0105239_10117838 Ga0105239_101178383 367
52 3300025263 Ga0209565_1000025 Ga0209565_10000253 367
53 3300025273 Ga0209673_1000149 Ga0209673_1000149144 367
54 3300025291 Ga0209675_1000017 Ga0209675_1000017371 367
55 3300025292 Ga0209676_1000123 Ga0209676_1000123145 367
56 3300025294 Ga0209025_1020619 Ga0209025_10206194 367
57 3300025298 Ga0209050_1000188 Ga0209050_1000188108 367
58 3300025303 Ga0209051_1000091 Ga0209051_1000091145 367
59 3300025304 Ga0209257_1000057 Ga0209257_1000057103 367
60 3300025939 Ga0207665_10032947 Ga0207665_100329473 367
61 3300027666 Ga0209282_1016026 Ga0209282_10160264 367
62 3300027907 Ga0207428_10030271 Ga0207428_100302713 367
63 3300037418 Ga0395900_0028936 Ga0395900_0028936_3548_4705 367
64 3300037466 Ga0395898_0087305 Ga0395898_0087305_211_1368 367
65 3300037471 Ga0395905_0013832 Ga0395905_0013832_3172_4329 367
66 3300038443 Ga0395901_0011278 Ga0395901_0011278_969_2126 367
67 3300041411 Ga0439466_0005261 Ga0439466_0005261_3200_4378 367
68 3300042133 Ga0450896_008181 Ga0450896_008181_259_1437 367
69 3300042531 Ga0450918_001417 Ga0450918_001417_2141_3319 367
70 3300046472 Ga0495580_0001063 Ga0495580_0001063_7299_8444 367
71 3300046660 Ga0495625_0000056 Ga0495625_0000056_74344_75522 367
72 3300050489 nmdc:mga03683_36475_c1 nmdc:mga03683_36475_c1_532_1710 367
73 3300050490 nmdc:mga03n38_1980_c1 nmdc:mga03n38_1980_c1_1573_2751 367
74 3300050491 nmdc:mga00v17_15965_c1 nmdc:mga00v17_15965_c1_114_1292 367
75 3300050492 nmdc:mga0yw44_44040_c1 nmdc:mga0yw44_44040_c1_30_1208 367
76 3300050493 nmdc:mga0k408_29086_c1 nmdc:mga0k408_29086_c1_1890_3068 367
77 3300017792 Ga0163161_10003274 Ga0163161_100032744 368
78 3300025294 Ga0209025_1000019 Ga0209025_1000019218 370
79 3300046522 Ga0495643_0011809 Ga0495643_0011809_619_1791 370
80 3300046528 Ga0495642_0002886 Ga0495642_0002886_1706_2878 370
81 3300046665 Ga0495661_0002439 Ga0495661_0002439_9548_10720 370
82 iso_pu_bacteria 2508501042 2508696673 370
83 3300046453 Ga0495627_000385 Ga0495627_000385_13156_14307 371
84 3300046518 Ga0495631_0000333 Ga0495631_0000333_11586_12737 371
85 3300046530 Ga0495654_0000351 Ga0495654_0000351_25917_27068 371
86 3300047320 Ga0495672_0000942 Ga0495672_0000942_13116_14267 371
87 3300048927 Ga0496124_0014958 Ga0496124_0014958_5986_7137 371
88 3300049571 Ga0501034_0096031 Ga0501034_0096031_1660_2811 371
89 3300006948 Ga0099826_10000031 Ga0099826_1000003129 372
90 3300027666 Ga0209282_1000011 Ga0209282_1000011175 372
91 3300046474 Ga0495605_0005515 Ga0495605_0005515_3672_4850 372
92 3300046501 Ga0495607_0009241 Ga0495607_0009241_4029_5207 372
93 3300046512 Ga0495610_0001269 Ga0495610_0001269_19406_20584 372
94 3300046513 Ga0495616_0004150 Ga0495616_0004150_3672_4850 372
95 3300046538 Ga0495609_0004901 Ga0495609_0004901_1377_2555 372
96 3300048919 Ga0496116_0040701 Ga0496116_0040701_1430_2608 372
97 3300048925 Ga0496122_0020624 Ga0496122_0020624_1536_2714 372
98 3300048926 Ga0496123_0002298 Ga0496123_0002298_2996_4174 372
99 3300006871 Ga0075434_100046415 Ga0075434_1000464156 373
100 3300032004 Ga0307414_10043634 Ga0307414_100436343 373
101 3300050512 nmdc:mga0n895_35578_c1 nmdc:mga0n895_35578_c1_936_2090 373
102 3300048928 Ga0496125_0015580 Ga0496125_0015580_3143_4294 374
103 3300032004 Ga0307414_10088815 Ga0307414_100888153 375
104 iso_pu_bacteria 2517572101 2517763100 375
105 iso_pu_bacteria 8002775197 8002783503 375
106 3300013100 Ga0157373_10016774 Ga0157373_100167742 376
107 3300003578 Ga0006562J51391_1028714 Ga0006562J51391_10287144 377
108 3300003578 Ga0006562J51391_1028715 Ga0006562J51391_10287152 377
109 3300015261 Ga0182006_1009496 Ga0182006_10094964 377
110 3300025940 Ga0207691_10082798 Ga0207691_100827982 377
111 3300031548 Ga0307408_100038754 Ga0307408_1000387542 377
112 3300031911 Ga0307412_10140203 Ga0307412_101402032 377
113 iso_pu_bacteria 2643221733 2644731443 378
114 iso_pu_bacteria 2554235132 2554816738 379
115 iso_pu_bacteria 2606217733 2608379955 379
116 iso_pu_bacteria 2739367655 2739611363 379
117 iso_pu_bacteria 2858950400 2858955174 379
118 iso_pu_bacteria 2899275550 2899278897 379
119 3300037853 Ga0436364_1148617 Ga0436364_1148617_427_1569 380
120 iso_pu_bacteria 2995392953 2995396394 380
121 3300005471 Ga0070698_100254922 Ga0070698_1002549221 381
122 3300005718 Ga0068866_10018085 Ga0068866_100180852 381
123 3300009148 Ga0105243_10192480 Ga0105243_101924801 381
124 3300026089 Ga0207648_10014324 Ga0207648_100143246 381
125 3300026118 Ga0207675_100183605 Ga0207675_1001836052 381
126 3300027876 Ga0209974_10009647 Ga0209974_100096473 381
127 3300028794 Ga0307515_10004453 Ga0307515_100044539 381
128 3300028794 Ga0307515_10015097 Ga0307515_1001509714 381
129 3300030522 Ga0307512_10099679 Ga0307512_100996792 381
130 3300031456 Ga0307513_10051293 Ga0307513_100512933 381
131 3300031649 Ga0307514_10049797 Ga0307514_100497974 381
132 3300031730 Ga0307516_10006403 Ga0307516_1000640311 381
133 3300031730 Ga0307516_10012543 Ga0307516_100125433 381
134 3300037471 Ga0395905_0041333 Ga0395905_0041333_1843_2988 381
135 3300041512 Ga0451853_0232277 Ga0451853_0232277_168_1343 381
136 3300046515 Ga0495620_0035229 Ga0495620_0035229_238_1413 381
137 3300046519 Ga0495632_0015276 Ga0495632_0015276_2311_3486 381
138 3300047443 Ga0495687_036603 Ga0495687_036603_868_2040 381
139 3300050493 nmdc:mga0k408_20605_c1 nmdc:mga0k408_20605_c1_2357_3532 381
140 3300028794 Ga0307515_10000020 Ga0307515_10000020113 382
141 3300031251 Ga0265327_10000049 Ga0265327_10000049151 382
142 3300031456 Ga0307513_10028784 Ga0307513_100287842 382
143 iso_pu_bacteria 2904541872 2904542387 382
144 3300006880 Ga0075429_100000515 Ga0075429_10000051510 383
145 3300046471 Ga0495650_0002886 Ga0495650_0002886_7912_9063 383
146 3300046491 Ga0495584_0009491 Ga0495584_0009491_1987_3138 383
147 3300046692 Ga0495671_0001219 Ga0495671_0001219_5989_7140 383
148 3300048910 Ga0496107_0000159 Ga0496107_0000159_1803_2954 383
149 3300048916 Ga0496113_0006116 Ga0496113_0006116_6035_7186 383
150 3300048928 Ga0496125_0019457 Ga0496125_0019457_290_1465 383
151 3300050508 nmdc:mga09592_365_c1 nmdc:mga09592_365_c1_21132_22295 383
152 3300028381 Ga0268264_10067031 Ga0268264_100670312 384
153 3300031456 Ga0307513_10049903 Ga0307513_100499033 384
154 3300037471 Ga0395905_0004126 Ga0395905_0004126_6240_7412 384
155 3300039447 Ga0436361_0998449 Ga0436361_0998449_551_1708 384
156 3300048924 Ga0496121_0001760 Ga0496121_0001760_8679_9836 384
157 3300048927 Ga0496124_0000459 Ga0496124_0000459_2837_3994 384
158 3300048928 Ga0496125_0012469 Ga0496125_0012469_4811_5968 384
159 3300053125 Ga0500618_000848 Ga0500618_000848_10274_11428 384
160 3300050496 nmdc:mga07m45_6855_c1 nmdc:mga07m45_6855_c1_3457_4614 385
161 iso_pu_bacteria 2808606395 2809033028 385
162 iso_pu_bacteria 2989776772 2989781227 385
163 iso_pu_bacteria 2501025502 2501077545 386
164 iso_pu_bacteria 2501025502 2501077788 386
165 iso_pu_bacteria 2510917013 2511091385 386
166 iso_pu_bacteria 2510917013 2511092244 386
167 iso_pu_bacteria 2599185292 2599906430 386
168 iso_pu_bacteria 2643221569 2643862703 386
169 iso_pu_bacteria 2643221594 2643980291 386
170 iso_pu_bacteria 2643221603 2644031262 386
171 iso_pu_bacteria 2643221621 2644121929 386
172 iso_pu_bacteria 2739367655 2739610174 386
173 iso_pu_bacteria 2808606395 2809032396 386
174 iso_pu_bacteria 2834641062 2834646000 386
175 iso_pu_bacteria 2857537821 2857542466 386
176 iso_pu_bacteria 2857542790 2857544030 386
177 iso_pu_bacteria 2858950400 2858952813 386
178 iso_pu_bacteria 2858950400 2858953060 386
179 iso_pu_bacteria 2858950400 2858953936 386
180 iso_pu_bacteria 2881412998 2881413973 386
181 iso_pu_bacteria 2881927736 2881930632 386
182 iso_pu_bacteria 2894023352 2894024966 386
183 iso_pu_bacteria 2941479691 2941485188 386
184 iso_pu_bacteria 8003400568 8003403339 386
185 iso_pu_bacteria 2513237101 2513698758 387
186 iso_pu_bacteria 2585428062 2587759066 387
187 iso_pu_bacteria 2599185292 2599903180 387
188 iso_pu_bacteria 2643221569 2643862328 387
189 iso_pu_bacteria 2838122688 2838130879 387
190 iso_pu_bacteria 2841974524 2841976908 387
191 iso_pu_bacteria 2842677519 2842680409 387
192 iso_pu_bacteria 2857537821 2857538516 387
193 iso_pu_bacteria 2919462493 2919468086 387
194 iso_pu_bacteria 2945945610 2945947902 387
195 3300025298 Ga0209050_1005397 Ga0209050_10053976 388
196 3300028794 Ga0307515_10000014 Ga0307515_10000014511 388
197 iso_pu_bacteria 2643221628 2644159870 388
198 iso_pu_bacteria 2643221658 2644325877 388
199 iso_pu_bacteria 2643221672 2644397250 388
200 iso_pu_bacteria 2721755523 2722880993 388
201 iso_pu_bacteria 2885192300 2885197100 388
202 iso_pu_bacteria 2919704043 2919708755 388
203 iso_pu_bacteria 2928115317 2928120235 388
204 iso_pu_bacteria 2929520902 2929522101 388
205 iso_pu_bacteria 2932422444 2932422845 388
206 3300003187 JGI25151J46595_10000357 JGI25151J46595_1000035712 389
207 3300006195 Ga0075366_10005468 Ga0075366_100054682 389
208 3300006353 Ga0075370_10001502 Ga0075370_100015029 389
209 3300025294 Ga0209025_1000003 Ga0209025_1000003975 389
210 3300031616 Ga0307508_10213474 Ga0307508_102134742 389
211 3300031995 Ga0307409_100092874 Ga0307409_1000928742 389
212 3300032002 Ga0307416_100056528 Ga0307416_1000565282 389
213 3300047443 Ga0495687_001323 Ga0495687_001323_8005_9174 389
214 3300048927 Ga0496124_0016559 Ga0496124_0016559_2317_3489 389
215 3300048928 Ga0496125_0026435 Ga0496125_0026435_544_1716 389
216 3300048929 Ga0496126_0020011 Ga0496126_0020011_1298_2470 389
217 3300050493 nmdc:mga0k408_3282_c1 nmdc:mga0k408_3282_c1_2816_3985 389
218 3300003187 JGI25151J46595_10000254 JGI25151J46595_1000025448 390
219 3300003792 Ga0055540_1000610 Ga0055540_100061026 390
220 3300005530 Ga0070679_100048610 Ga0070679_1000486101 390
221 3300005563 Ga0068855_100127226 Ga0068855_1001272263 390
222 3300006177 Ga0075362_10001585 Ga0075362_100015856 390
223 3300006195 Ga0075366_10045906 Ga0075366_100459062 390
224 3300006353 Ga0075370_10074975 Ga0075370_100749752 390
225 3300006353 Ga0075370_10100797 Ga0075370_101007972 390
226 3300006846 Ga0075430_100148393 Ga0075430_1001483931 390
227 3300006946 Ga0079104_1000008 Ga0079104_1000008258 390
228 3300009092 Ga0105250_10000607 Ga0105250_100006075 390
229 3300009093 Ga0105240_10006694 Ga0105240_1000669414 390
230 3300009551 Ga0105238_10041600 Ga0105238_100416004 390
231 3300013102 Ga0157371_10065751 Ga0157371_100657513 390
232 3300014969 Ga0157376_10251659 Ga0157376_102516592 390
233 3300021361 Ga0213872_10005513 Ga0213872_100055134 390
234 3300025242 Ga0209258_102846 Ga0209258_1028464 390
235 3300025272 Ga0209455_1000566 Ga0209455_100056611 390
236 3300025292 Ga0209676_1021977 Ga0209676_10219773 390
237 3300025294 Ga0209025_1000003 Ga0209025_10000031087 390
238 3300025303 Ga0209051_1000444 Ga0209051_10004445 390
239 3300025913 Ga0207695_10368013 Ga0207695_103680131 390
240 3300025919 Ga0207657_10082647 Ga0207657_100826473 390
241 3300025921 Ga0207652_10049529 Ga0207652_100495292 390
242 3300025924 Ga0207694_10121128 Ga0207694_101211282 390
243 3300025935 Ga0207709_10000070 Ga0207709_1000007094 390
244 3300027111 Ga0209281_1000029 Ga0209281_1000029140 390
245 3300028786 Ga0307517_10091895 Ga0307517_100918953 390
246 3300028794 Ga0307515_10001078 Ga0307515_1000107817 390
247 3300028794 Ga0307515_10008667 Ga0307515_1000866719 390
248 3300030731 Ga0316177_1042817 Ga0316177_10428171 390
249 3300030735 Ga0316178_1000969 Ga0316178_10009693 390
250 3300030742 Ga0316183_1098067 Ga0316183_10980674 390
251 3300031456 Ga0307513_10000012 Ga0307513_10000012280 390
252 3300031548 Ga0307408_100026477 Ga0307408_1000264775 390
253 3300031548 Ga0307408_100052489 Ga0307408_1000524892 390
254 3300031548 Ga0307408_100142868 Ga0307408_1001428681 390
255 3300031730 Ga0307516_10001147 Ga0307516_100011473 390
256 3300031731 Ga0307405_10078706 Ga0307405_100787063 390
257 3300031911 Ga0307412_10000979 Ga0307412_100009796 390
258 3300031911 Ga0307412_10001167 Ga0307412_1000116710 390
259 3300031911 Ga0307412_10032577 Ga0307412_100325772 390
260 3300032002 Ga0307416_100365223 Ga0307416_1003652231 390
261 3300032004 Ga0307414_10032742 Ga0307414_100327423 390
262 3300032126 Ga0307415_100163574 Ga0307415_1001635742 390
263 3300037471 Ga0395905_0000421 Ga0395905_0000421_25262_26437 390
264 3300039447 Ga0436361_0024002 Ga0436361_0024002_47653_48828 390
265 3300041404 Ga0439436_0004120 Ga0439436_0004120_2192_3370 390
266 3300041406 Ga0439439_0000066 Ga0439439_0000066_11387_12565 390
267 3300041413 Ga0439465_0003856 Ga0439465_0003856_2725_3903 390
268 3300041997 Ga0439431_0016919 Ga0439431_0016919_313_1491 390
269 3300042006 Ga0439432_010218 Ga0439432_010218_111_1289 390
270 3300042006 Ga0439432_011067 Ga0439432_011067_1341_2519 390
271 3300042007 Ga0439449_0006090 Ga0439449_0006090_2435_3613 390
272 3300042010 Ga0439452_008742 Ga0439452_008742_658_1836 390
273 3300042014 Ga0439457_021906 Ga0439457_021906_220_1398 390
274 3300042015 Ga0439462_0015261 Ga0439462_0015261_353_1537 390
275 3300042015 Ga0439462_0018399 Ga0439462_0018399_186_1364 390
276 3300042115 Ga0450911_000582 Ga0450911_000582_9526_10701 390
277 3300042156 Ga0439446_0009406 Ga0439446_0009406_575_1753 390
278 3300042435 Ga0439434_0008759 Ga0439434_0008759_274_1452 390
279 3300042532 Ga0450893_0005876 Ga0450893_0005876_78_1253 390
280 3300045051 Ga0451576_0021669 Ga0451576_0021669_866_2044 390
281 3300046520 Ga0495637_0002864 Ga0495637_0002864_3909_5087 390
282 3300046522 Ga0495643_0059247 Ga0495643_0059247_481_1653 390
283 3300046558 Ga0495633_0009855 Ga0495633_0009855_365_1558 390
284 3300046665 Ga0495661_0125582 Ga0495661_0125582_188_1360 390
285 3300048919 Ga0496116_0007047 Ga0496116_0007047_6905_8077 390
286 3300048919 Ga0496116_0046563 Ga0496116_0046563_1354_2526 390
287 3300048919 Ga0496116_0114352 Ga0496116_0114352_345_1517 390
288 3300048920 Ga0496117_0099867 Ga0496117_0099867_557_1729 390
289 3300048921 Ga0496118_0005781 Ga0496118_0005781_1926_3098 390
290 3300048921 Ga0496118_0011669 Ga0496118_0011669_3174_4349 390
291 3300048921 Ga0496118_0112388 Ga0496118_0112388_27_1199 390
292 3300048922 Ga0496119_0001978 Ga0496119_0001978_9396_10571 390
293 3300048922 Ga0496119_0105431 Ga0496119_0105431_286_1458 390
294 3300048923 Ga0496120_0003793 Ga0496120_0003793_11790_12962 390
295 3300048924 Ga0496121_0000314 Ga0496121_0000314_50175_51347 390
296 3300048924 Ga0496121_0005771 Ga0496121_0005771_6189_7364 390
297 3300048924 Ga0496121_0044203 Ga0496121_0044203_1593_2765 390
298 3300048924 Ga0496121_0059778 Ga0496121_0059778_644_1819 390
299 3300048925 Ga0496122_0000046 Ga0496122_0000046_85367_86539 390
300 3300048925 Ga0496122_0133102 Ga0496122_0133102_234_1406 390
301 3300048926 Ga0496123_0000082 Ga0496123_0000082_47263_48435 390
302 3300048926 Ga0496123_0012894 Ga0496123_0012894_2523_3695 390
303 3300048927 Ga0496124_0000007 Ga0496124_0000007_359101_360273 390
304 3300048927 Ga0496124_0027248 Ga0496124_0027248_1448_2620 390
305 3300048927 Ga0496124_0086638 Ga0496124_0086638_1139_2314 390
306 3300048928 Ga0496125_0000028 Ga0496125_0000028_117996_119168 390
307 3300048928 Ga0496125_0020077 Ga0496125_0020077_3121_4293 390
308 3300048928 Ga0496125_0066641 Ga0496125_0066641_724_1899 390
309 3300048929 Ga0496126_0190509 Ga0496126_0190509_170_1342 390
310 3300049570 Ga0501033_0024190 Ga0501033_0024190_724_1899 390
311 3300049571 Ga0501034_0086300 Ga0501034_0086300_1590_2765 390
312 3300049572 Ga0501036_0145681 Ga0501036_0145681_511_1686 390
313 3300049573 Ga0501037_0143991 Ga0501037_0143991_493_1665 390
314 3300049574 Ga0501038_0031829 Ga0501038_0031829_2191_3363 390
315 3300049579 Ga0501043_0078911 Ga0501043_0078911_634_1809 390
316 3300049579 Ga0501043_0100654 Ga0501043_0100654_713_1885 390
317 3300049579 Ga0501043_0170175 Ga0501043_0170175_472_1644 390
318 3300049581 Ga0501047_0002464 Ga0501047_0002464_14288_15463 390
319 3300049705 Ga0501225_0006142 Ga0501225_0006142_2318_3493 390
320 3300049759 Ga0501262_000758 Ga0501262_000758_798_1973 390
321 3300049822 Ga0501035_0008851 Ga0501035_0008851_5990_7165 390
322 3300049822 Ga0501035_0019386 Ga0501035_0019386_1725_2897 390
323 3300049822 Ga0501035_0022709 Ga0501035_0022709_388_1560 390
324 3300049823 Ga0501044_0000022 Ga0501044_0000022_17364_18536 390
325 3300049823 Ga0501044_0024648 Ga0501044_0024648_2781_3956 390
326 3300050489 nmdc:mga03683_1264_c1 nmdc:mga03683_1264_c1_3531_4712 390
327 3300050489 nmdc:mga03683_40394_c2 nmdc:mga03683_40394_c2_91_1266 390
328 3300050516 nmdc:mga0sz30_6078_c1 nmdc:mga0sz30_6078_c1_398_1579 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

256

399

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u4e-assembly1.cif.gz_A crystal structure of putative thiolase from sphaerobacter thermophilus dsm 20745 0.9454 6 387
4u4e-assembly1.cif.gz_A crystal structure of putative thiolase from sphaerobacter thermophilus dsm 20745 0.9403 6 387
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9248 11 387
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.9198 7 385
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9171 11 387
ID Description Score Start End Superfamily
4u4eA00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9385 6 387 3.40.47.10
4u4eA00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9333 6 387 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9213 10 385 3.40.47.10
af_I6Y3T7_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9049 6 385 3.40.47.10
af_I6Y3T7_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.889 6 385 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A536DP89-F1-model_v4 Thiolase 0.9891 158 385 GO:0016746
AF-A0A2W4THG7-F1-model_v4 Thiolase 0.9868 178 390 GO:0016746
AF-A0A356HTX4-F1-model_v4 deleted 0.9833 260 387
AF-A0A1Z9SCQ0-F1-model_v4 Thiolase 0.9828 235 390 GO:0016746
AF-W7WJC5-F1-model_v4 deleted 0.9796 238 386

Feature Viewer

pLDDT pTM Quality
93.99 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map