F409135

General Info

Members Datasets Scaffolds Average Seq Length
328 243 656 213

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10361896|Ga0070681_103618961
Length 260
Sequence VPRNGSKVRSIRLCSKYTPMPSWRISIYHFIPRMLLAAQKTHNEAGLIMDASFWHQRWEKNEIAFHESQANPLLVKHLNELSLAKGRRIFVPLCGKTLDVSWLLSKGYRVAGAELSQIAIEQLFMELGVQPEISAAGEVEQWSAKYLDIFVGDIFALSKKVLGPVDAIYDRAALVAFPQDMRNRYTAHLTEITGKASQLLICYEYDQSLMGGPPFSVSNDEVKRQYALTYDVTLIASTEVSGGLKGKCPAKENVWLLKQK

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
237 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 2818991436 Collimonas arenae 515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 0
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 10.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10361896 3300005458 Bacteria 1361
2 SwRhRL2b_contig_2231893 2162886007 Bacteria 2186
3 JGI24738J21930_10035202 3300002075 Bacteria 1020
4 JGI24033J26618_1009601 3300002155 Bacteria 1128
5 JGI26145J50221_1000360 3300003371 Bacteria 3992
6 JGI26134J50242_100763 3300003392 Bacteria 1098
7 Ga0065704_10080548 3300005289 Bacteria 3926
8 Ga0065715_10189173 3300005293 Bacteria 1418
9 Ga0065715_10253621 3300005293 Bacteria 1153
10 Ga0065707_10001318 3300005295 Bacteria 8503
11 Ga0070676_10007389 3300005328 Bacteria 5895
12 Ga0070690_100008395 3300005330 Bacteria 5946
13 Ga0070690_100036660 3300005330 Bacteria 3084
14 Ga0070670_100037677 3300005331 Bacteria 4160
15 Ga0070670_100803900 3300005331 Bacteria 849
16 Ga0070670_100844500 3300005331 Bacteria 828
17 Ga0070677_10003074 3300005333 Bacteria 5359
18 Ga0068869_100012307 3300005334 Bacteria 5650
19 Ga0070680_100000233 3300005336 Bacteria 36710
20 Ga0070682_100034926 3300005337 Bacteria 3065
21 Ga0068868_100015615 3300005338 Bacteria 5622
22 Ga0070660_100014320 3300005339 Bacteria 5712
23 Ga0070689_100045205 3300005340 Unclassified 3390
24 Ga0070689_100128595 3300005340 Bacteria 2030
25 Ga0070691_10012675 3300005341 Bacteria 3861
26 Ga0070687_100001245 3300005343 Bacteria 8849
27 Ga0070687_100061699 3300005343 Bacteria 1982
28 Ga0070661_100000753 3300005344 Bacteria 23375
29 Ga0070692_10027396 3300005345 Bacteria 2824
30 Ga0070668_100176546 3300005347 Unclassified 1742
31 Ga0070669_100003527 3300005353 Bacteria 11284
32 Ga0070675_100031532 3300005354 Bacteria 4285
33 Ga0070674_100000625 3300005356 Bacteria 17789
34 Ga0070673_100002720 3300005364 Bacteria 10843
35 Ga0070673_100083182 3300005364 Unclassified 2600
36 Ga0070673_100452501 3300005364 Unclassified 1155
37 Ga0070659_100014079 3300005366 Bacteria 5969
38 Ga0070659_100314125 3300005366 Bacteria 1309
39 Ga0070667_100008756 3300005367 Bacteria 8388
40 Ga0070667_100509792 3300005367 Bacteria 1103
41 Ga0070701_10313931 3300005438 Unclassified 968
42 Ga0070711_100142068 3300005439 Bacteria 1801
43 Ga0070705_100007879 3300005440 Bacteria 5260
44 Ga0070705_100092562 3300005440 Bacteria 1887
45 Ga0070700_100001546 3300005441 Bacteria 11471
46 Ga0070694_100003344 3300005444 Bacteria 9597
47 Ga0070678_100003056 3300005456 Bacteria 9275
48 Ga0070662_100002964 3300005457 Bacteria 10548
49 Ga0070662_100166800 3300005457 Bacteria 1726
50 Ga0070681_10327858 3300005458 Bacteria 1440
51 Ga0068867_100003744 3300005459 Bacteria 10708
52 Ga0068867_100127999 3300005459 Bacteria 1970
53 Ga0070685_10026803 3300005466 Bacteria 3179
54 Ga0070698_100264519 3300005471 Bacteria 1652
55 Ga0070679_100081697 3300005530 Bacteria 3221
56 Ga0070679_100174055 3300005530 Bacteria 2125
57 Ga0070684_100080910 3300005535 Bacteria 2874
58 Ga0070684_100351255 3300005535 Unclassified 1356
59 Ga0070697_100317129 3300005536 Bacteria 1342
60 Ga0070672_100001751 3300005543 Bacteria 13586
61 Ga0070686_100047791 3300005544 Plasmid 2707
62 Ga0070695_100040813 3300005545 Bacteria 2940
63 Ga0070695_100174016 3300005545 Bacteria 1520
64 Ga0070696_100003917 3300005546 Bacteria 9947
65 Ga0070696_100128925 3300005546 Bacteria 1839
66 Ga0070693_100096396 3300005547 Bacteria 1793
67 Ga0070665_100016239 3300005548 Bacteria 7469
68 Ga0070704_100117074 3300005549 Bacteria 2039
69 Ga0068855_100303146 3300005563 Bacteria 1769
70 Ga0070664_100001953 3300005564 Bacteria 16549
71 Ga0070664_100003260 3300005564 Bacteria 13105
72 Ga0068857_100048225 3300005577 Bacteria 3782
73 Ga0068856_100399136 3300005614 Bacteria 1395
74 Ga0070702_100068688 3300005615 Bacteria 2086
75 Ga0070702_100297247 3300005615 Bacteria 1115
76 Ga0068861_100245766 3300005719 Unclassified 1524
77 Ga0068870_10009213 3300005840 Bacteria 4479
78 Ga0068870_10200629 3300005840 Unclassified 1209
79 Ga0068858_100549038 3300005842 Bacteria 1118
80 Ga0068860_100019257 3300005843 Bacteria 6625
81 Ga0068860_100020026 3300005843 Bacteria 6483
82 Ga0068860_100450304 3300005843 Bacteria 1280
83 Ga0068862_100012238 3300005844 Bacteria 7093
84 Ga0081455_10001875 3300005937 Bacteria 25301
85 Ga0081455_10138839 3300005937 Bacteria 1890
86 Ga0075432_10000452 3300006058 Bacteria 12126
87 Ga0070716_100072413 3300006173 Bacteria 2029
88 Ga0097621_100001399 3300006237 Bacteria 16611
89 Ga0068871_100007601 3300006358 Bacteria 7750
90 Ga0068871_100053529 3300006358 Unclassified 3272
91 Ga0075428_100069425 3300006844 Bacteria 3852
92 Ga0075431_100010881 3300006847 Bacteria 9152
93 Ga0075433_10036638 3300006852 Bacteria 4227
94 Ga0075433_10171643 3300006852 Bacteria 1930
95 Ga0075434_100859581 3300006871 Bacteria 922
96 Ga0075429_100048195 3300006880 Bacteria 3706
97 Ga0068865_100001467 3300006881 Bacteria 13729
98 Ga0075436_100083529 3300006914 Bacteria 2216
99 Ga0075436_100293094 3300006914 Bacteria 1165
100 Ga0075435_100078417 3300007076 Bacteria 2709
101 Ga0075435_100129103 3300007076 Bacteria 2114
102 Ga0075435_100466123 3300007076 Unclassified 1090
103 Ga0105240_10741197 3300009093 Bacteria 1069
104 Ga0111539_10271461 3300009094 Bacteria 1974
105 Ga0105245_10003626 3300009098 Bacteria 13783
106 Ga0105245_10767140 3300009098 Bacteria 1001
107 Ga0114129_10029738 3300009147 Bacteria 7736
108 Ga0114129_10040241 3300009147 Bacteria 6589
109 Ga0114129_10493819 3300009147 Bacteria 1599
110 Ga0105243_10003386 3300009148 Bacteria 12936
111 Ga0105241_10042923 3300009174 Bacteria 3424
112 Ga0105242_10000961 3300009176 Bacteria 22492
113 Ga0105242_10016894 3300009176 Bacteria 5679
114 Ga0105242_10246258 3300009176 Bacteria 1609
115 Ga0105237_10536113 3300009545 Unclassified 1177
116 Ga0105249_10064450 3300009553 Bacteria 3369
117 Ga0105239_10006140 3300010375 Bacteria 13981
118 Ga0105246_10001180 3300011119 Bacteria 15179
119 Ga0157371_10023602 3300013102 Bacteria 4498
120 Ga0157369_10356169 3300013105 Bacteria 1520
121 Ga0157374_10409041 3300013296 Bacteria 1354
122 Ga0157374_10485778 3300013296 Bacteria 1238
123 Ga0157378_10002984 3300013297 Bacteria 15028
124 Ga0157378_10064264 3300013297 Bacteria 3282
125 Ga0157375_10021139 3300013308 Bacteria 5961
126 Ga0163163_10125656 3300014325 Bacteria 2603
127 Ga0157380_10013584 3300014326 Bacteria 5943
128 Ga0157380_10076893 3300014326 Bacteria 2718
129 Ga0157377_10001427 3300014745 Bacteria 10307
130 Ga0157376_10000507 3300014969 Bacteria 25180
131 Ga0182007_10006829 3300015262 Bacteria 4856
132 Ga0182005_1002319 3300015265 Bacteria 6932
133 Ga0213872_10006244 3300021361 Bacteria 6018
134 Ga0207682_10005924 3300025893 Unclassified 4946
135 Ga0207645_10001327 3300025907 Bacteria 20329
136 Ga0207643_10035112 3300025908 Bacteria 2810
137 Ga0207643_10415737 3300025908 Unclassified 852
138 Ga0207707_10019933 3300025912 Bacteria 5853
139 Ga0207707_10176293 3300025912 Bacteria 1867
140 Ga0207707_10337885 3300025912 Bacteria 1299
141 Ga0207695_10034842 3300025913 Bacteria 5468
142 Ga0207695_10195647 3300025913 Bacteria 1938
143 Ga0207695_10532573 3300025913 Bacteria 1056
144 Ga0207660_10010039 3300025917 Bacteria 6133
145 Ga0207660_10091743 3300025917 Bacteria 2253
146 Ga0207662_10002064 3300025918 Bacteria 9957
147 Ga0207662_10063469 3300025918 Bacteria 2221
148 Ga0207657_10000376 3300025919 Bacteria 47172
149 Ga0207649_10005127 3300025920 Bacteria 7082
150 Ga0207652_10063553 3300025921 Bacteria 3192
151 Ga0207652_10262015 3300025921 Bacteria 1559
152 Ga0207681_10028987 3300025923 Bacteria 3589
153 Ga0207694_10000725 3300025924 Bacteria 29645
154 Ga0207650_10005673 3300025925 Bacteria 8521
155 Ga0207659_10017432 3300025926 Bacteria 4692
156 Ga0207659_10050494 3300025926 Unclassified 2955
157 Ga0207687_10063211 3300025927 Bacteria 2620
158 Ga0207644_10283435 3300025931 Bacteria 1331
159 Ga0207690_10009486 3300025932 Bacteria 5781
160 Ga0207690_10081266 3300025932 Bacteria 2264
161 Ga0207706_10000559 3300025933 Bacteria 39690
162 Ga0207686_10002027 3300025934 Bacteria 11177
163 Ga0207709_10097323 3300025935 Bacteria 1937
164 Ga0207670_10008691 3300025936 Bacteria 5750
165 Ga0207670_10044699 3300025936 Bacteria 2932
166 Ga0207669_10008429 3300025937 Bacteria 4840
167 Ga0207704_10002764 3300025938 Bacteria 7916
168 Ga0207691_10000420 3300025940 Bacteria 42155
169 Ga0207691_10386097 3300025940 Bacteria 1195
170 Ga0207689_10000593 3300025942 Bacteria 34592
171 Ga0207679_10009050 3300025945 Bacteria 6363
172 Ga0207679_10074283 3300025945 Bacteria 2575
173 Ga0207651_10005638 3300025960 Bacteria 6453
174 Ga0207651_10265928 3300025960 Bacteria 1410
175 Ga0207651_10932454 3300025960 Bacteria 774
176 Ga0207712_10069066 3300025961 Bacteria 2534
177 Ga0207668_10014295 3300025972 Bacteria 4912
178 Ga0207668_10456934 3300025972 Bacteria 1091
179 Ga0207640_10044138 3300025981 Bacteria 2854
180 Ga0207658_10008933 3300025986 Bacteria 6796
181 Ga0207658_10577175 3300025986 Unclassified 1008
182 Ga0207703_10464110 3300026035 Bacteria 1185
183 Ga0207708_10007966 3300026075 Bacteria 7851
184 Ga0207702_10899503 3300026078 Bacteria 877
185 Ga0207648_10000627 3300026089 Bacteria 39584
186 Ga0207648_10495079 3300026089 Bacteria 1118
187 Ga0207648_11005378 3300026089 Unclassified 781
188 Ga0207674_10011346 3300026116 Bacteria 10014
189 Ga0207675_100303164 3300026118 Bacteria 1556
190 Ga0207683_10000033 3300026121 Bacteria 104248
191 Ga0209973_1002429 3300027252 Bacteria 1745
192 Ga0209969_1000223 3300027360 Bacteria 7618
193 Ga0209967_1000011 3300027364 Bacteria 24295
194 Ga0209981_1000098 3300027378 Bacteria 9592
195 Ga0209996_1000065 3300027395 Bacteria 14723
196 Ga0209984_1000384 3300027424 Bacteria 4816
197 Ga0210000_1000141 3300027462 Bacteria 10197
198 Ga0209995_1000020 3300027471 Bacteria 25031
199 Ga0209968_1000039 3300027526 Bacteria 23682
200 Ga0209999_1000051 3300027543 Bacteria 12891
201 Ga0209982_1000157 3300027552 Bacteria 7561
202 Ga0209970_1010983 3300027614 Bacteria 1486
203 Ga0210002_1000102 3300027617 Bacteria 13285
204 Ga0209983_1001790 3300027665 Bacteria 4771
205 Ga0209971_1000107 3300027682 Bacteria 24395
206 Ga0209966_1000057 3300027695 Bacteria 49396
207 Ga0209998_10000151 3300027717 Bacteria 26152
208 Ga0209974_10000043 3300027876 Bacteria 31212
209 Ga0207428_10018576 3300027907 Bacteria 5936
210 Ga0268266_10001019 3300028379 Bacteria 35295
211 Ga0268266_10021748 3300028379 Bacteria 5466
212 Ga0268265_10032724 3300028380 Bacteria 3772
213 Ga0268264_10014732 3300028381 Bacteria 6424
214 Ga0268264_10041868 3300028381 Bacteria 3789
215 Ga0268264_10427943 3300028381 Bacteria 1278
216 Ga0265319_1037943 3300028563 Unclassified 1639
217 Ga0265334_10027707 3300028573 Unclassified 2281
218 Ga0265318_10003071 3300028577 Bacteria 8583
219 Ga0265336_10076782 3300028666 Unclassified 998
220 Ga0265338_10006366 3300028800 Bacteria 15073
221 Ga0265327_10011481 3300031251 Bacteria 6091
222 Ga0316579_10013753 3300031691 Bacteria 3486
223 Ga0316577_10169783 3300031733 Unclassified 1231
224 Ga0307416_100822149 3300032002 Bacteria 1026
225 Ga0307411_10337300 3300032005 Bacteria 1224
226 Ga0316585_10036115 3300032137 Bacteria 1566
227 Ga0373940_0033201 3300035088 Bacteria 1387
228 Ga0373923_0258442 3300035111 Unclassified 817
229 Ga0373953_0017080 3300035117 Bacteria 2661
230 Ga0373955_0485820 3300035172 Unclassified 754
231 Ga0373961_0031267 3300035241 Bacteria 1486
232 Ga0373961_0197715 3300035241 Unclassified 708
233 Ga0373931_0053516 3300035691 Bacteria 2154
234 Ga0373935_0260281 3300035692 Unclassified 1217
235 Ga0373937_0001368 3300036401 Bacteria 20378
236 Ga0316582_0027074 3300036647 Bacteria 3458
237 Ga0395900_0305441 3300037418 Bacteria 1576
238 Ga0400483_247715 3300039062 Unclassified 1053
239 Ga0436361_0038353 3300039447 Bacteria 24888
240 Ga0436361_0745532 3300039447 Bacteria 2111
241 Ga0439455_0063012 3300042012 Bacteria 986
242 Ga0439460_0025921 3300042461 Bacteria 1637
243 Ga0453683_0301080 3300044673 Bacteria 1026
244 Ga0466966_0024205 3300044684 Bacteria 3974
245 Ga0453684_0213717 3300044712 Bacteria 2240
246 Ga0466971_0024599 3300044719 Bacteria 2687
247 Ga0466957_0001479 3300044842 Bacteria 12328
248 Ga0466959_0282474 3300045049 Bacteria 1139
249 Ga0451576_0003630 3300045051 Bacteria 20973
250 Ga0451576_0050373 3300045051 Bacteria 4367
251 Ga0451576_0389202 3300045051 Bacteria 1461
252 Ga0451576_0493331 3300045051 Bacteria 1286
253 Ga0466958_0002902 3300045836 Bacteria 8756
254 Ga0466967_0108426 3300045976 Bacteria 2548
255 Ga0495592_0441982 3300046454 Bacteria 816
256 Ga0495651_0019478 3300046462 Bacteria 5260
257 Ga0495651_0045235 3300046462 Bacteria 3410
258 Ga0495651_0281344 3300046462 Bacteria 1123
259 Ga0495653_0058211 3300046463 Bacteria 2938
260 Ga0495608_0051924 3300046511 Bacteria 2715
261 Ga0495618_0067586 3300046514 Bacteria 2273
262 Ga0495628_0095478 3300046516 Bacteria 2297
263 Ga0495599_0143414 3300046678 Bacteria 1481
264 Ga0495646_0020559 3300046680 Bacteria 4177
265 Ga0495624_0083423 3300046690 Bacteria 1976
266 Ga0495600_0002613 3300046809 Bacteria 10381
267 Ga0495602_0111585 3300048088 Bacteria 2220
268 Ga0495602_0112784 3300048088 Bacteria 2205
269 Ga0501031_0147424 3300049568 Unclassified 1537
270 Ga0501032_0111323 3300049569 Unclassified 1812
271 Ga0501033_0355829 3300049570 Unclassified 1025
272 Ga0501034_0054735 3300049571 Bacteria 4017
273 Ga0501034_0430313 3300049571 Bacteria 1240
274 Ga0501036_0296150 3300049572 Bacteria 1353
275 Ga0501037_0022490 3300049573 Bacteria 4664
276 Ga0501037_0067874 3300049573 Unclassified 2596
277 Ga0501038_0079588 3300049574 Unclassified 2763
278 Ga0501038_0123334 3300049574 Bacteria 2134
279 Ga0501038_0294084 3300049574 Bacteria 1276
280 Ga0501038_0358559 3300049574 Bacteria 1134
281 Ga0501039_0059208 3300049575 Bacteria 2967
282 Ga0501041_0043167 3300049577 Bacteria 2741
283 Ga0501041_0293025 3300049577 Bacteria 1025
284 Ga0501042_0031161 3300049578 Bacteria 3773
285 Ga0501042_0062853 3300049578 Bacteria 2653
286 Ga0501043_0318767 3300049579 Bacteria 1185
287 Ga0501047_0179871 3300049581 Bacteria 1981
288 Ga0501047_0231803 3300049581 Bacteria 1700
289 Ga0501068_0198181 3300049584 Unclassified 1273
290 Ga0501070_0167296 3300049586 Bacteria 1812
291 Ga0501071_0090729 3300049587 Bacteria 2244
292 Ga0501071_0160765 3300049587 Unclassified 1679
293 Ga0501073_0020063 3300049589 Bacteria 4820
294 Ga0501074_0109567 3300049590 Unclassified 1976
295 Ga0501076_0216070 3300049592 Bacteria 1567
296 Ga0501077_0011223 3300049593 Bacteria 5591
297 Ga0501079_0292833 3300049741 Bacteria 1273
298 Ga0501080_0090704 3300049742 Bacteria 2838
299 Ga0501080_0281550 3300049742 Bacteria 1512
300 Ga0501035_0138524 3300049822 Bacteria 2117
301 nmdc:mga05p37_134609_c1 3300050507 Bacteria 3032
302 nmdc:mga05p37_304622_c2 3300050507 Bacteria 1303
303 nmdc:mga05p37_91887_c1 3300050507 Bacteria 3740
304 nmdc:mga09592_52980_c1 3300050508 Bacteria 3425
305 nmdc:mga09592_551458_c1 3300050508 Bacteria 990
306 nmdc:mga0qj67_113078_c1 3300050509 Bacteria 2192
307 nmdc:mga0qj67_30797_c1 3300050509 Bacteria 4178
308 nmdc:mga06r32_21472_c1 3300050510 Bacteria 5960
309 nmdc:mga08y16_86452_c1 3300050511 Bacteria 3268
310 nmdc:mga0n895_60979_c1 3300050512 Bacteria 3723
311 nmdc:mga0n895_825793_c1 3300050512 Bacteria 916
312 nmdc:mga0rr50_30381_c1 3300050513 Bacteria 3825
313 nmdc:mga0rr50_446116_c1 3300050513 Bacteria 1097
314 nmdc:mga0rr50_812372_c1 3300050513 Unclassified 798
315 nmdc:mga08x19_73152_c1 3300050514 Bacteria 2237
316 nmdc:mga0a205_35915_c2 3300050515 Bacteria 4394
317 Ga0500643_035648 3300053087 Bacteria 1490
318 Ga0500595_010275 3300053119 Bacteria 3725
319 Ga0500595_012687 3300053119 Bacteria 3250
320 Ga0500607_071671 3300053121 Bacteria 1788
321 Ga0500574_020353 3300053141 Bacteria 1665
322 Ga0500619_000318 3300053154 Bacteria 9361
323 Ga0500636_0000187 3300053177 Bacteria 33470
324 Ga0500637_0041057 3300053178 Bacteria 2615
325 Ga0590075_021420 3300059424 Bacteria 1613
326 Ga0590077_018085 3300059426 Bacteria 1486
327 Ga0501082_0172089 3300060353 Bacteria 1883
328 2819544127 2818991436 Bacteria 5376622
329 Ga0070681_10361896
330 SwRhRL2b_contig_2231893
331 JGI24738J21930_10035202
332 JGI24033J26618_1009601
333 JGI26145J50221_1000360
334 JGI26134J50242_100763
335 Ga0065704_10080548
336 Ga0065715_10189173
337 Ga0065715_10253621
338 Ga0065707_10001318
339 Ga0070676_10007389
340 Ga0070690_100008395
341 Ga0070690_100036660
342 Ga0070670_100037677
343 Ga0070670_100803900
344 Ga0070670_100844500
345 Ga0070677_10003074
346 Ga0068869_100012307
347 Ga0070680_100000233
348 Ga0070682_100034926
349 Ga0068868_100015615
350 Ga0070660_100014320
351 Ga0070689_100045205
352 Ga0070689_100128595
353 Ga0070691_10012675
354 Ga0070687_100001245
355 Ga0070687_100061699
356 Ga0070661_100000753
357 Ga0070692_10027396
358 Ga0070668_100176546
359 Ga0070669_100003527
360 Ga0070675_100031532
361 Ga0070674_100000625
362 Ga0070673_100002720
363 Ga0070673_100083182
364 Ga0070673_100452501
365 Ga0070659_100014079
366 Ga0070659_100314125
367 Ga0070667_100008756
368 Ga0070667_100509792
369 Ga0070701_10313931
370 Ga0070711_100142068
371 Ga0070705_100007879
372 Ga0070705_100092562
373 Ga0070700_100001546
374 Ga0070694_100003344
375 Ga0070678_100003056
376 Ga0070662_100002964
377 Ga0070662_100166800
378 Ga0070681_10327858
379 Ga0068867_100003744
380 Ga0068867_100127999
381 Ga0070685_10026803
382 Ga0070698_100264519
383 Ga0070679_100081697
384 Ga0070679_100174055
385 Ga0070684_100080910
386 Ga0070684_100351255
387 Ga0070697_100317129
388 Ga0070672_100001751
389 Ga0070686_100047791
390 Ga0070695_100040813
391 Ga0070695_100174016
392 Ga0070696_100003917
393 Ga0070696_100128925
394 Ga0070693_100096396
395 Ga0070665_100016239
396 Ga0070704_100117074
397 Ga0068855_100303146
398 Ga0070664_100001953
399 Ga0070664_100003260
400 Ga0068857_100048225
401 Ga0068856_100399136
402 Ga0070702_100068688
403 Ga0070702_100297247
404 Ga0068861_100245766
405 Ga0068870_10009213
406 Ga0068870_10200629
407 Ga0068858_100549038
408 Ga0068860_100019257
409 Ga0068860_100020026
410 Ga0068860_100450304
411 Ga0068862_100012238
412 Ga0081455_10001875
413 Ga0081455_10138839
414 Ga0075432_10000452
415 Ga0070716_100072413
416 Ga0097621_100001399
417 Ga0068871_100007601
418 Ga0068871_100053529
419 Ga0075428_100069425
420 Ga0075431_100010881
421 Ga0075433_10036638
422 Ga0075433_10171643
423 Ga0075434_100859581
424 Ga0075429_100048195
425 Ga0068865_100001467
426 Ga0075436_100083529
427 Ga0075436_100293094
428 Ga0075435_100078417
429 Ga0075435_100129103
430 Ga0075435_100466123
431 Ga0105240_10741197
432 Ga0111539_10271461
433 Ga0105245_10003626
434 Ga0105245_10767140
435 Ga0114129_10029738
436 Ga0114129_10040241
437 Ga0114129_10493819
438 Ga0105243_10003386
439 Ga0105241_10042923
440 Ga0105242_10000961
441 Ga0105242_10016894
442 Ga0105242_10246258
443 Ga0105237_10536113
444 Ga0105249_10064450
445 Ga0105239_10006140
446 Ga0105246_10001180
447 Ga0157371_10023602
448 Ga0157369_10356169
449 Ga0157374_10409041
450 Ga0157374_10485778
451 Ga0157378_10002984
452 Ga0157378_10064264
453 Ga0157375_10021139
454 Ga0163163_10125656
455 Ga0157380_10013584
456 Ga0157380_10076893
457 Ga0157377_10001427
458 Ga0157376_10000507
459 Ga0182007_10006829
460 Ga0182005_1002319
461 Ga0213872_10006244
462 Ga0207682_10005924
463 Ga0207645_10001327
464 Ga0207643_10035112
465 Ga0207643_10415737
466 Ga0207707_10019933
467 Ga0207707_10176293
468 Ga0207707_10337885
469 Ga0207695_10034842
470 Ga0207695_10195647
471 Ga0207695_10532573
472 Ga0207660_10010039
473 Ga0207660_10091743
474 Ga0207662_10002064
475 Ga0207662_10063469
476 Ga0207657_10000376
477 Ga0207649_10005127
478 Ga0207652_10063553
479 Ga0207652_10262015
480 Ga0207681_10028987
481 Ga0207694_10000725
482 Ga0207650_10005673
483 Ga0207659_10017432
484 Ga0207659_10050494
485 Ga0207687_10063211
486 Ga0207644_10283435
487 Ga0207690_10009486
488 Ga0207690_10081266
489 Ga0207706_10000559
490 Ga0207686_10002027
491 Ga0207709_10097323
492 Ga0207670_10008691
493 Ga0207670_10044699
494 Ga0207669_10008429
495 Ga0207704_10002764
496 Ga0207691_10000420
497 Ga0207691_10386097
498 Ga0207689_10000593
499 Ga0207679_10009050
500 Ga0207679_10074283
501 Ga0207651_10005638
502 Ga0207651_10265928
503 Ga0207651_10932454
504 Ga0207712_10069066
505 Ga0207668_10014295
506 Ga0207668_10456934
507 Ga0207640_10044138
508 Ga0207658_10008933
509 Ga0207658_10577175
510 Ga0207703_10464110
511 Ga0207708_10007966
512 Ga0207702_10899503
513 Ga0207648_10000627
514 Ga0207648_10495079
515 Ga0207648_11005378
516 Ga0207674_10011346
517 Ga0207675_100303164
518 Ga0207683_10000033
519 Ga0209973_1002429
520 Ga0209969_1000223
521 Ga0209967_1000011
522 Ga0209981_1000098
523 Ga0209996_1000065
524 Ga0209984_1000384
525 Ga0210000_1000141
526 Ga0209995_1000020
527 Ga0209968_1000039
528 Ga0209999_1000051
529 Ga0209982_1000157
530 Ga0209970_1010983
531 Ga0210002_1000102
532 Ga0209983_1001790
533 Ga0209971_1000107
534 Ga0209966_1000057
535 Ga0209998_10000151
536 Ga0209974_10000043
537 Ga0207428_10018576
538 Ga0268266_10001019
539 Ga0268266_10021748
540 Ga0268265_10032724
541 Ga0268264_10014732
542 Ga0268264_10041868
543 Ga0268264_10427943
544 Ga0265319_1037943
545 Ga0265334_10027707
546 Ga0265318_10003071
547 Ga0265336_10076782
548 Ga0265338_10006366
549 Ga0265327_10011481
550 Ga0316579_10013753
551 Ga0316577_10169783
552 Ga0307416_100822149
553 Ga0307411_10337300
554 Ga0316585_10036115
555 Ga0373940_0033201
556 Ga0373923_0258442
557 Ga0373953_0017080
558 Ga0373955_0485820
559 Ga0373961_0031267
560 Ga0373961_0197715
561 Ga0373931_0053516
562 Ga0373935_0260281
563 Ga0373937_0001368
564 Ga0316582_0027074
565 Ga0395900_0305441
566 Ga0400483_247715
567 Ga0436361_0038353
568 Ga0436361_0745532
569 Ga0439455_0063012
570 Ga0439460_0025921
571 Ga0453683_0301080
572 Ga0466966_0024205
573 Ga0453684_0213717
574 Ga0466971_0024599
575 Ga0466957_0001479
576 Ga0466959_0282474
577 Ga0451576_0003630
578 Ga0451576_0050373
579 Ga0451576_0389202
580 Ga0451576_0493331
581 Ga0466958_0002902
582 Ga0466967_0108426
583 Ga0495592_0441982
584 Ga0495651_0019478
585 Ga0495651_0045235
586 Ga0495651_0281344
587 Ga0495653_0058211
588 Ga0495608_0051924
589 Ga0495618_0067586
590 Ga0495628_0095478
591 Ga0495599_0143414
592 Ga0495646_0020559
593 Ga0495624_0083423
594 Ga0495600_0002613
595 Ga0495602_0111585
596 Ga0495602_0112784
597 Ga0501031_0147424
598 Ga0501032_0111323
599 Ga0501033_0355829
600 Ga0501034_0054735
601 Ga0501034_0430313
602 Ga0501036_0296150
603 Ga0501037_0022490
604 Ga0501037_0067874
605 Ga0501038_0079588
606 Ga0501038_0123334
607 Ga0501038_0294084
608 Ga0501038_0358559
609 Ga0501039_0059208
610 Ga0501041_0043167
611 Ga0501041_0293025
612 Ga0501042_0031161
613 Ga0501042_0062853
614 Ga0501043_0318767
615 Ga0501047_0179871
616 Ga0501047_0231803
617 Ga0501068_0198181
618 Ga0501070_0167296
619 Ga0501071_0090729
620 Ga0501071_0160765
621 Ga0501073_0020063
622 Ga0501074_0109567
623 Ga0501076_0216070
624 Ga0501077_0011223
625 Ga0501079_0292833
626 Ga0501080_0090704
627 Ga0501080_0281550
628 Ga0501035_0138524
629 nmdc:mga05p37_134609_c1
630 nmdc:mga05p37_304622_c2
631 nmdc:mga05p37_91887_c1
632 nmdc:mga09592_52980_c1
633 nmdc:mga09592_551458_c1
634 nmdc:mga0qj67_113078_c1
635 nmdc:mga0qj67_30797_c1
636 nmdc:mga06r32_21472_c1
637 nmdc:mga08y16_86452_c1
638 nmdc:mga0n895_60979_c1
639 nmdc:mga0n895_825793_c1
640 nmdc:mga0rr50_30381_c1
641 nmdc:mga0rr50_446116_c1
642 nmdc:mga0rr50_812372_c1
643 nmdc:mga08x19_73152_c1
644 nmdc:mga0a205_35915_c2
645 Ga0500643_035648
646 Ga0500595_010275
647 Ga0500595_012687
648 Ga0500607_071671
649 Ga0500574_020353
650 Ga0500619_000318
651 Ga0500636_0000187
652 Ga0500637_0041057
653 Ga0590075_021420
654 Ga0590077_018085
655 Ga0501082_0172089
656 2819544127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

49

260

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gb4-assembly1.cif.gz_A crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution 0.8833 1 212
2gb4-assembly1.cif.gz_A crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution 0.8795 1 212
2h11-assembly2.cif.gz_B amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine 0.8775 1 212
2h11-assembly2.cif.gz_B amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine 0.8736 1 212
8ajp-assembly1.cif.gz_A crystal structure of halogen methyl transferase from paraburkholderia xenovorans at 1.8 a in complex with sah 0.7585 2 212
ID Description Score Start End Superfamily
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9006 37 80 3.40.50.150
2bzgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8686 1 212 3.40.50.150
2bzgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8648 1 212 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7651 32 145 3.40.50.150
af_B7E650_31_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7631 6 207 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A849S662-F1-model_v4 Thiopurine S-methyltransferase 1.003 120 212 GO:0005737
GO:0008119
GO:0032259
AF-A0A4Q6E3T4-F1-model_v4 deleted 0.9946 103 211
AF-A0A832Q973-F1-model_v4 Thiopurine S-methyltransferase 0.9941 80 210 GO:0005737
GO:0008119
GO:0032259
AF-A0A836WZ62-F1-model_v4 Thiopurine S-methyltransferase 0.9926 51 212 GO:0005737
GO:0008119
GO:0032259
AF-F3KCW2-F1-model_v4 Thiopurine S-methyltransferase 0.9924 93 212 GO:0005737
GO:0008119
GO:0032259

Map