F409098

General Info

Members Datasets Scaffolds Average Seq Length
328 216 656 171

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100069278|Ga0068869_1000692782
Length 198
Sequence MTQSHSVAVYPGTFDPITNGHLDVLQRALGIFGRVIVTIAPNIRKNPLFSTEERMQFIRDALPEHERRLEFAVFEGLLVEFCRSRGASVIVRGLRALADFEYEFQFAHMNRRLAPGVDTVFFMTDERNHYVSSSLVKEVASLGGDVTGLVPAAVVTALDAKYRKANVPAQNRVSPRPDQAIDHPRRHRQGRQAQGRRR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
162 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
173 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
195 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
196 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
197 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
198 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
199 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
203 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
209 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
212 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0
Rhizoplane 1.52
Rhizosphere 83.84
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100069278 3300005334 Bacteria 2608
2 Ga0058859_11656746 3300004798 Bacteria 640
3 Ga0070658_10275409 3300005327 Bacteria 1432
4 Ga0070683_100132057 3300005329 Bacteria 2363
5 Ga0070690_100031170 3300005330 Bacteria 3319
6 Ga0068869_100216643 3300005334 Bacteria 1516
7 Ga0068869_100774647 3300005334 Bacteria 823
8 Ga0070680_100038830 3300005336 Bacteria 3852
9 Ga0070680_100320030 3300005336 Bacteria 1317
10 Ga0070680_100437348 3300005336 Bacteria 1117
11 Ga0070680_100693967 3300005336 Bacteria 876
12 Ga0070689_100052103 3300005340 Bacteria 3165
13 Ga0070689_100117369 3300005340 Bacteria 2122
14 Ga0070691_10440496 3300005341 Bacteria 742
15 Ga0070687_100057299 3300005343 Bacteria 2043
16 Ga0070692_10144483 3300005345 Bacteria 1350
17 Ga0070692_10488132 3300005345 Bacteria 796
18 Ga0070675_100375998 3300005354 Bacteria 1264
19 Ga0070674_100474623 3300005356 Bacteria 1037
20 Ga0070673_101324367 3300005364 Bacteria 677
21 Ga0070688_100149654 3300005365 Bacteria 1594
22 Ga0070688_100431087 3300005365 Bacteria 982
23 Ga0070688_100540946 3300005365 Bacteria 884
24 Ga0070694_100026354 3300005444 Bacteria 3767
25 Ga0070708_100031184 3300005445 Bacteria 4612
26 Ga0070678_100464318 3300005456 Bacteria 1111
27 Ga0070681_10182228 3300005458 Bacteria 2021
28 Ga0070706_100012935 3300005467 Bacteria 7724
29 Ga0070706_100353777 3300005467 Bacteria 1369
30 Ga0070706_100885727 3300005467 Bacteria 825
31 Ga0070707_100560276 3300005468 Bacteria 1105
32 Ga0070707_100657264 3300005468 Bacteria 1011
33 Ga0070698_100001081 3300005471 Bacteria 29945
34 Ga0070698_100039781 3300005471 Bacteria 4836
35 Ga0070679_100066921 3300005530 Bacteria 3582
36 Ga0070679_100109946 3300005530 Bacteria 2742
37 Ga0070679_100242089 3300005530 Bacteria 1761
38 Ga0070679_100418981 3300005530 Bacteria 1284
39 Ga0070684_100107523 3300005535 Bacteria 2498
40 Ga0070684_100183151 3300005535 Bacteria 1905
41 Ga0070684_101415768 3300005535 Bacteria 655
42 Ga0070695_101415905 3300005545 Bacteria 577
43 Ga0070665_100040890 3300005548 Bacteria 4659
44 Ga0070665_100334529 3300005548 Bacteria 1519
45 Ga0070665_100823957 3300005548 Bacteria 941
46 Ga0070665_101383664 3300005548 Bacteria 713
47 Ga0070704_100324542 3300005549 Bacteria 1291
48 Ga0068855_100947537 3300005563 Bacteria 907
49 Ga0068857_100063595 3300005577 Bacteria 3280
50 Ga0068857_100180339 3300005577 Bacteria 1922
51 Ga0068856_100065196 3300005614 Bacteria 3599
52 Ga0068856_100084732 3300005614 Bacteria 3149
53 Ga0068859_100997443 3300005617 Bacteria 920
54 Ga0068859_101344221 3300005617 Bacteria 788
55 Ga0068864_100158976 3300005618 Bacteria 2053
56 Ga0068861_100080604 3300005719 Bacteria 2547
57 Ga0068863_100037242 3300005841 Bacteria 4632
58 Ga0068863_100468403 3300005841 Bacteria 1238
59 Ga0068860_100306100 3300005843 Bacteria 1558
60 Ga0068860_101871555 3300005843 Bacteria 622
61 Ga0068862_100352683 3300005844 Bacteria 1365
62 Ga0070717_10004763 3300006028 Bacteria 9862
63 Ga0070717_10784772 3300006028 Bacteria 866
64 Ga0068871_100321874 3300006358 Bacteria 1362
65 Ga0075430_100347610 3300006846 Bacteria 1225
66 Ga0075430_100508842 3300006846 Bacteria 994
67 Ga0075431_100097443 3300006847 Bacteria 3037
68 Ga0075434_100855288 3300006871 Bacteria 925
69 Ga0075429_100021311 3300006880 Bacteria 5618
70 Ga0075429_100040265 3300006880 Bacteria 4067
71 Ga0075429_100073230 3300006880 Bacteria 2984
72 Ga0068865_100049265 3300006881 Bacteria 2903
73 Ga0097620_100997397 3300006931 Bacteria 920
74 Ga0097620_101344253 3300006931 Bacteria 788
75 Ga0075435_100341066 3300007076 Bacteria 1284
76 Ga0111539_10017470 3300009094 Bacteria 8881
77 Ga0111539_10331603 3300009094 Bacteria 1771
78 Ga0111539_11403559 3300009094 Bacteria 810
79 Ga0105245_10000328 3300009098 Bacteria 44782
80 Ga0105245_10198764 3300009098 Bacteria 1924
81 Ga0105245_10469207 3300009098 Bacteria 1270
82 Ga0105243_10789560 3300009148 Bacteria 935
83 Ga0105242_10105230 3300009176 Bacteria 2396
84 Ga0105248_12697693 3300009177 Bacteria 567
85 Ga0105237_10538439 3300009545 Bacteria 1174
86 Ga0105238_10409738 3300009551 Bacteria 1349
87 Ga0105238_12002255 3300009551 Bacteria 613
88 Ga0105249_10425690 3300009553 Bacteria 1362
89 Ga0105249_10624275 3300009553 Bacteria 1134
90 Ga0105239_10101760 3300010375 Bacteria 3179
91 Ga0157374_10150817 3300013296 Bacteria 2260
92 Ga0157374_11226926 3300013296 Bacteria 771
93 Ga0157378_10101256 3300013297 Bacteria 2631
94 Ga0157378_10265997 3300013297 Bacteria 1647
95 Ga0157378_10272282 3300013297 Bacteria 1629
96 Ga0163162_12007596 3300013306 Bacteria 663
97 Ga0157372_10391307 3300013307 Bacteria 1620
98 Ga0157375_11892382 3300013308 Bacteria 708
99 Ga0157379_10573839 3300014968 Bacteria 1051
100 Ga0157376_10389711 3300014969 Bacteria 1344
101 Ga0157376_10409617 3300014969 Bacteria 1313
102 Ga0157376_11817411 3300014969 Bacteria 646
103 Ga0157376_11839024 3300014969 Bacteria 642
104 Ga0213873_10098799 3300021358 Bacteria 837
105 Ga0213874_10047254 3300021377 Bacteria 1309
106 Ga0207653_10068621 3300025885 Bacteria 1208
107 Ga0207643_10573163 3300025908 Bacteria 725
108 Ga0207705_10188389 3300025909 Bacteria 1559
109 Ga0207705_10285857 3300025909 Bacteria 1263
110 Ga0207684_10038334 3300025910 Bacteria 4066
111 Ga0207684_10588823 3300025910 Bacteria 950
112 Ga0207654_10120262 3300025911 Bacteria 1648
113 Ga0207671_10811773 3300025914 Bacteria 742
114 Ga0207660_10104975 3300025917 Bacteria 2116
115 Ga0207660_10499983 3300025917 Bacteria 986
116 Ga0207660_10513075 3300025917 Bacteria 973
117 Ga0207662_10073852 3300025918 Bacteria 2069
118 Ga0207652_10007932 3300025921 Bacteria 8525
119 Ga0207652_10153250 3300025921 Bacteria 2064
120 Ga0207652_10175549 3300025921 Bacteria 1924
121 Ga0207652_10226148 3300025921 Bacteria 1686
122 Ga0207652_10443583 3300025921 Bacteria 1170
123 Ga0207646_10372483 3300025922 Bacteria 1290
124 Ga0207687_10000068 3300025927 Bacteria 78924
125 Ga0207687_11160666 3300025927 Bacteria 664
126 Ga0207686_10340706 3300025934 Bacteria 1126
127 Ga0207709_10733742 3300025935 Bacteria 793
128 Ga0207670_10019414 3300025936 Bacteria 4152
129 Ga0207669_10114453 3300025937 Bacteria 1816
130 Ga0207704_10058031 3300025938 Bacteria 2381
131 Ga0207704_10299777 3300025938 Bacteria 1231
132 Ga0207689_10045368 3300025942 Bacteria 3634
133 Ga0207689_10201093 3300025942 Bacteria 1644
134 Ga0207689_10307060 3300025942 Bacteria 1315
135 Ga0207661_10037240 3300025944 Bacteria 3803
136 Ga0207667_10689890 3300025949 Bacteria 1024
137 Ga0207712_10817616 3300025961 Bacteria 820
138 Ga0207708_10041354 3300026075 Bacteria 3515
139 Ga0207702_10098904 3300026078 Bacteria 2571
140 Ga0207702_10154559 3300026078 Bacteria 2090
141 Ga0207702_10279575 3300026078 Bacteria 1577
142 Ga0207641_10045821 3300026088 Bacteria 3685
143 Ga0207641_10508955 3300026088 Bacteria 1170
144 Ga0207676_10613726 3300026095 Bacteria 1046
145 Ga0207674_10110385 3300026116 Bacteria 2726
146 Ga0207675_100074154 3300026118 Bacteria 3184
147 Ga0207683_10002142 3300026121 Bacteria 17337
148 Ga0207428_10058203 3300027907 Bacteria 3067
149 Ga0268266_10005571 3300028379 Bacteria 11706
150 Ga0268266_10956252 3300028379 Bacteria 829
151 Ga0268265_10847609 3300028380 Bacteria 894
152 Ga0268264_10224592 3300028381 Bacteria 1731
153 Ga0268264_10604144 3300028381 Bacteria 1081
154 Ga0265337_1030634 3300028556 Bacteria 1601
155 Ga0265326_10047357 3300028558 Bacteria 1219
156 Ga0265319_1134643 3300028563 Bacteria 768
157 Ga0265318_10152420 3300028577 Bacteria 848
158 Ga0265323_10000960 3300028653 Bacteria 15055
159 Ga0307517_10025013 3300028786 Bacteria 7327
160 Ga0307515_10013848 3300028794 Bacteria 15017
161 Ga0265338_10009788 3300028800 Bacteria 11373
162 Ga0265338_10015062 3300028800 Bacteria 8535
163 Ga0265338_10050984 3300028800 Bacteria 3734
164 Ga0265338_10455170 3300028800 Bacteria 905
165 Ga0265324_10000167 3300029957 Bacteria 50706
166 Ga0265324_10005980 3300029957 Bacteria 5152
167 Ga0265330_10006968 3300031235 Bacteria 5550
168 Ga0265330_10014447 3300031235 Bacteria 3665
169 Ga0265332_10006903 3300031238 Bacteria 5147
170 Ga0265325_10028113 3300031241 Bacteria 3034
171 Ga0265329_10000421 3300031242 Bacteria 22309
172 Ga0265329_10003064 3300031242 Bacteria 7407
173 Ga0265339_10000087 3300031249 Bacteria 78504
174 Ga0265339_10024663 3300031249 Bacteria 3461
175 Ga0265331_10013487 3300031250 Bacteria 4390
176 Ga0265316_10000210 3300031344 Bacteria 67922
177 Ga0265316_10002440 3300031344 Bacteria 19314
178 Ga0265316_10003018 3300031344 Bacteria 17205
179 Ga0265316_10022317 3300031344 Bacteria 5339
180 Ga0265316_10241256 3300031344 Bacteria 1329
181 Ga0307513_10009686 3300031456 Bacteria 12172
182 Ga0307513_10087395 3300031456 Bacteria 3191
183 Ga0307509_10000605 3300031507 Bacteria 61068
184 Ga0307509_10016317 3300031507 Bacteria 8600
185 Ga0307509_10038412 3300031507 Bacteria 5223
186 Ga0307509_10039642 3300031507 Bacteria 5130
187 Ga0307509_10085968 3300031507 Bacteria 3235
188 Ga0265313_10007093 3300031595 Bacteria 7736
189 Ga0307508_10045395 3300031616 Bacteria 3927
190 Ga0307508_10503625 3300031616 Bacteria 806
191 Ga0316575_10315046 3300031665 Bacteria 663
192 Ga0265314_10002918 3300031711 Bacteria 16958
193 Ga0265314_10008714 3300031711 Bacteria 8672
194 Ga0265314_10076375 3300031711 Bacteria 2226
195 Ga0265314_10100735 3300031711 Bacteria 1857
196 Ga0265342_10001147 3300031712 Bacteria 25333
197 Ga0265342_10005447 3300031712 Bacteria 9697
198 Ga0265342_10008649 3300031712 Bacteria 7279
199 Ga0265342_10010078 3300031712 Bacteria 6589
200 Ga0265342_10036041 3300031712 Bacteria 3024
201 Ga0316576_10305135 3300031727 Bacteria 1189
202 Ga0316578_10215008 3300031728 Bacteria 1156
203 Ga0307406_10001348 3300031901 Bacteria 13762
204 Ga0307412_10542139 3300031911 Bacteria 976
205 Ga0307415_100018424 3300032126 Bacteria 4217
206 Ga0307415_100156017 3300032126 Bacteria 1763
207 Ga0307507_10445152 3300033179 Bacteria 718
208 Ga0373949_0000215 3300035090 Bacteria 21866
209 Ga0373951_0106438 3300035091 Bacteria 751
210 Ga0373936_0000013 3300035113 Bacteria 219069
211 Ga0373941_0105374 3300035115 Bacteria 987
212 Ga0373941_0272880 3300035115 Bacteria 667
213 Ga0373961_0000049 3300035241 Bacteria 70367
214 Ga0395899_0048038 3300037312 Bacteria 3176
215 Ga0395899_0207190 3300037312 Bacteria 1364
216 Ga0395900_0051023 3300037418 Bacteria 4261
217 Ga0395898_0578582 3300037466 Bacteria 1065
218 Ga0395905_0143319 3300037471 Bacteria 2248
219 Ga0395905_0177554 3300037471 Bacteria 1999
220 Ga0395901_0023027 3300038443 Bacteria 6384
221 Ga0395901_1222802 3300038443 Bacteria 716
222 Ga0436365_0083484 3300039437 Bacteria 1498
223 Ga0436365_1292797 3300039437 Bacteria 629
224 Ga0436363_1020135 3300039450 Bacteria 1754
225 Ga0436362_0014083 3300039453 Bacteria 1088
226 Ga0451791_0021913 3300041451 Bacteria 890
227 Ga0451793_0990100 3300041452 Bacteria 1639
228 Ga0451797_0296619 3300041453 Bacteria 556
229 Ga0451577_0152943 3300042876 Bacteria 2076
230 Ga0453683_0072813 3300044673 Bacteria 2151
231 Ga0466966_0268800 3300044684 Bacteria 1026
232 Ga0466961_0165087 3300044693 Bacteria 1379
233 Ga0453684_0000078 3300044712 Bacteria 428794
234 Ga0453684_0490975 3300044712 Bacteria 1361
235 Ga0453684_0587370 3300044712 Bacteria 1222
236 Ga0453684_0714438 3300044712 Bacteria 1088
237 Ga0466959_0187865 3300045049 Bacteria 1443
238 Ga0466967_0377311 3300045976 Bacteria 1376
239 Ga0495629_0044602 3300046459 Bacteria 3112
240 Ga0495638_0332333 3300046460 Bacteria 808
241 Ga0495651_0095536 3300046462 Bacteria 2223
242 Ga0495650_0094160 3300046471 Bacteria 1134
243 Ga0495610_0238170 3300046512 Bacteria 727
244 Ga0495632_0383511 3300046519 Bacteria 615
245 Ga0495586_0438594 3300046535 Bacteria 753
246 Ga0495622_0124833 3300046557 Bacteria 1174
247 Ga0495623_0087589 3300046679 Bacteria 1918
248 Ga0495581_0459571 3300047315 Bacteria 741
249 Ga0495604_0227535 3300047317 Bacteria 1281
250 Ga0495686_0046749 3300047472 Bacteria 2735
251 Ga0495602_0042164 3300048088 Bacteria 4161
252 Ga0496101_0204713 3300048904 Bacteria 1527
253 Ga0496112_0035350 3300048915 Bacteria 4867
254 Ga0501291_071490 3300049514 Bacteria 673
255 Ga0501292_003734 3300049515 Bacteria 2050
256 Ga0501292_028529 3300049515 Bacteria 930
257 Ga0501298_116526 3300049521 Bacteria 625
258 Ga0501037_0435763 3300049573 Bacteria 896
259 Ga0501043_0208551 3300049579 Bacteria 1515
260 Ga0501043_0710886 3300049579 Bacteria 733
261 Ga0501047_0074003 3300049581 Bacteria 3279
262 Ga0501047_0176557 3300049581 Bacteria 2003
263 Ga0501069_0085747 3300049585 Bacteria 1777
264 Ga0501070_0032848 3300049586 Bacteria 4342
265 Ga0501072_0365394 3300049588 Bacteria 1145
266 Ga0501073_0814090 3300049589 Bacteria 644
267 Ga0501074_0338506 3300049590 Bacteria 1068
268 Ga0501202_130419 3300049652 Bacteria 640
269 Ga0501217_008783 3300049661 Bacteria 2189
270 Ga0501227_000766 3300049665 Bacteria 7010
271 Ga0501227_003472 3300049665 Bacteria 3419
272 Ga0501230_002578 3300049667 Bacteria 2325
273 Ga0501233_032177 3300049668 Bacteria 1191
274 Ga0501235_027204 3300049669 Bacteria 1282
275 Ga0501249_124905 3300049679 Bacteria 631
276 Ga0501225_0005046 3300049705 Bacteria 3894
277 Ga0501229_031748 3300049706 Bacteria 726
278 Ga0501229_033190 3300049706 Bacteria 714
279 Ga0501080_0594118 3300049742 Bacteria 983
280 Ga0501080_0853941 3300049742 Bacteria 796
281 Ga0501081_0091353 3300049743 Bacteria 2141
282 Ga0501083_0037054 3300049744 Bacteria 3323
283 Ga0501267_005130 3300049764 Bacteria 1233
284 Ga0501035_0654252 3300049822 Bacteria 852
285 Ga0501044_0044495 3300049823 Bacteria 4606
286 Ga0501044_0637270 3300049823 Bacteria 956
287 Ga0501044_0661173 3300049823 Bacteria 933
288 nmdc:mga09592_14584_c1 3300050508 Bacteria 6415
289 nmdc:mga09592_19146_c1 3300050508 Bacteria 5617
290 nmdc:mga09592_95499_c1 3300050508 Bacteria 2543
291 nmdc:mga0qj67_209788_c1 3300050509 Bacteria 1582
292 nmdc:mga0qj67_229038_c1 3300050509 Bacteria 1508
293 nmdc:mga08y16_7181_c1 3300050511 Bacteria 11689
294 nmdc:mga0rr50_908446_c1 3300050513 Bacteria 751
295 nmdc:mga0rr50_970947_c1 3300050513 Bacteria 724
296 nmdc:mga08x19_464904_c1 3300050514 Bacteria 891
297 Ga0500635_0013204 3300053080 Bacteria 2393
298 Ga0500578_0307545 3300053086 Bacteria 938
299 Ga0500646_0249950 3300053090 Unclassified 624
300 Ga0500647_0211809 3300053091 Bacteria 873
301 Ga0500566_0005001 3300053094 Bacteria 7897
302 Ga0500566_0013653 3300053094 Bacteria 4776
303 Ga0500566_0124578 3300053094 Bacteria 1385
304 Ga0500640_034799 3300053095 Bacteria 2213
305 Ga0500654_069758 3300053099 Bacteria 1723
306 Ga0500554_000322 3300053102 Bacteria 10338
307 Ga0500554_013047 3300053102 Bacteria 2107
308 Ga0500572_006566 3300053111 Bacteria 2669
309 Ga0500595_000249 3300053119 Bacteria 36246
310 Ga0500597_002360 3300053120 Bacteria 5218
311 Ga0500597_246896 3300053120 Bacteria 732
312 Ga0500614_001476 3300053123 Bacteria 5613
313 Ga0500614_005020 3300053123 Bacteria 2781
314 Ga0500614_190721 3300053123 Bacteria 629
315 Ga0500614_212705 3300053123 Bacteria 598
316 Ga0500642_0003095 3300053130 Bacteria 4978
317 Ga0500652_201799 3300053131 Bacteria 807
318 Ga0500658_0027446 3300053134 Bacteria 2202
319 Ga0500559_0013009 3300053136 Bacteria 3530
320 Ga0500585_057108 3300053144 Bacteria 1400
321 Ga0500603_001594 3300053150 Bacteria 5126
322 Ga0500619_126621 3300053154 Bacteria 870
323 Ga0500630_159398 3300053159 Bacteria 943
324 Ga0500639_029470 3300053163 Bacteria 2902
325 Ga0500636_0017735 3300053177 Bacteria 4208
326 Ga0500637_0117966 3300053178 Bacteria 1540
327 Ga0500601_001840 3300053737 Bacteria 2273
328 Ga0501084_1125738 3300054114 Bacteria 659
329 Ga0068869_100069278
330 Ga0058859_11656746
331 Ga0070658_10275409
332 Ga0070683_100132057
333 Ga0070690_100031170
334 Ga0068869_100216643
335 Ga0068869_100774647
336 Ga0070680_100038830
337 Ga0070680_100320030
338 Ga0070680_100437348
339 Ga0070680_100693967
340 Ga0070689_100052103
341 Ga0070689_100117369
342 Ga0070691_10440496
343 Ga0070687_100057299
344 Ga0070692_10144483
345 Ga0070692_10488132
346 Ga0070675_100375998
347 Ga0070674_100474623
348 Ga0070673_101324367
349 Ga0070688_100149654
350 Ga0070688_100431087
351 Ga0070688_100540946
352 Ga0070694_100026354
353 Ga0070708_100031184
354 Ga0070678_100464318
355 Ga0070681_10182228
356 Ga0070706_100012935
357 Ga0070706_100353777
358 Ga0070706_100885727
359 Ga0070707_100560276
360 Ga0070707_100657264
361 Ga0070698_100001081
362 Ga0070698_100039781
363 Ga0070679_100066921
364 Ga0070679_100109946
365 Ga0070679_100242089
366 Ga0070679_100418981
367 Ga0070684_100107523
368 Ga0070684_100183151
369 Ga0070684_101415768
370 Ga0070695_101415905
371 Ga0070665_100040890
372 Ga0070665_100334529
373 Ga0070665_100823957
374 Ga0070665_101383664
375 Ga0070704_100324542
376 Ga0068855_100947537
377 Ga0068857_100063595
378 Ga0068857_100180339
379 Ga0068856_100065196
380 Ga0068856_100084732
381 Ga0068859_100997443
382 Ga0068859_101344221
383 Ga0068864_100158976
384 Ga0068861_100080604
385 Ga0068863_100037242
386 Ga0068863_100468403
387 Ga0068860_100306100
388 Ga0068860_101871555
389 Ga0068862_100352683
390 Ga0070717_10004763
391 Ga0070717_10784772
392 Ga0068871_100321874
393 Ga0075430_100347610
394 Ga0075430_100508842
395 Ga0075431_100097443
396 Ga0075434_100855288
397 Ga0075429_100021311
398 Ga0075429_100040265
399 Ga0075429_100073230
400 Ga0068865_100049265
401 Ga0097620_100997397
402 Ga0097620_101344253
403 Ga0075435_100341066
404 Ga0111539_10017470
405 Ga0111539_10331603
406 Ga0111539_11403559
407 Ga0105245_10000328
408 Ga0105245_10198764
409 Ga0105245_10469207
410 Ga0105243_10789560
411 Ga0105242_10105230
412 Ga0105248_12697693
413 Ga0105237_10538439
414 Ga0105238_10409738
415 Ga0105238_12002255
416 Ga0105249_10425690
417 Ga0105249_10624275
418 Ga0105239_10101760
419 Ga0157374_10150817
420 Ga0157374_11226926
421 Ga0157378_10101256
422 Ga0157378_10265997
423 Ga0157378_10272282
424 Ga0163162_12007596
425 Ga0157372_10391307
426 Ga0157375_11892382
427 Ga0157379_10573839
428 Ga0157376_10389711
429 Ga0157376_10409617
430 Ga0157376_11817411
431 Ga0157376_11839024
432 Ga0213873_10098799
433 Ga0213874_10047254
434 Ga0207653_10068621
435 Ga0207643_10573163
436 Ga0207705_10188389
437 Ga0207705_10285857
438 Ga0207684_10038334
439 Ga0207684_10588823
440 Ga0207654_10120262
441 Ga0207671_10811773
442 Ga0207660_10104975
443 Ga0207660_10499983
444 Ga0207660_10513075
445 Ga0207662_10073852
446 Ga0207652_10007932
447 Ga0207652_10153250
448 Ga0207652_10175549
449 Ga0207652_10226148
450 Ga0207652_10443583
451 Ga0207646_10372483
452 Ga0207687_10000068
453 Ga0207687_11160666
454 Ga0207686_10340706
455 Ga0207709_10733742
456 Ga0207670_10019414
457 Ga0207669_10114453
458 Ga0207704_10058031
459 Ga0207704_10299777
460 Ga0207689_10045368
461 Ga0207689_10201093
462 Ga0207689_10307060
463 Ga0207661_10037240
464 Ga0207667_10689890
465 Ga0207712_10817616
466 Ga0207708_10041354
467 Ga0207702_10098904
468 Ga0207702_10154559
469 Ga0207702_10279575
470 Ga0207641_10045821
471 Ga0207641_10508955
472 Ga0207676_10613726
473 Ga0207674_10110385
474 Ga0207675_100074154
475 Ga0207683_10002142
476 Ga0207428_10058203
477 Ga0268266_10005571
478 Ga0268266_10956252
479 Ga0268265_10847609
480 Ga0268264_10224592
481 Ga0268264_10604144
482 Ga0265337_1030634
483 Ga0265326_10047357
484 Ga0265319_1134643
485 Ga0265318_10152420
486 Ga0265323_10000960
487 Ga0307517_10025013
488 Ga0307515_10013848
489 Ga0265338_10009788
490 Ga0265338_10015062
491 Ga0265338_10050984
492 Ga0265338_10455170
493 Ga0265324_10000167
494 Ga0265324_10005980
495 Ga0265330_10006968
496 Ga0265330_10014447
497 Ga0265332_10006903
498 Ga0265325_10028113
499 Ga0265329_10000421
500 Ga0265329_10003064
501 Ga0265339_10000087
502 Ga0265339_10024663
503 Ga0265331_10013487
504 Ga0265316_10000210
505 Ga0265316_10002440
506 Ga0265316_10003018
507 Ga0265316_10022317
508 Ga0265316_10241256
509 Ga0307513_10009686
510 Ga0307513_10087395
511 Ga0307509_10000605
512 Ga0307509_10016317
513 Ga0307509_10038412
514 Ga0307509_10039642
515 Ga0307509_10085968
516 Ga0265313_10007093
517 Ga0307508_10045395
518 Ga0307508_10503625
519 Ga0316575_10315046
520 Ga0265314_10002918
521 Ga0265314_10008714
522 Ga0265314_10076375
523 Ga0265314_10100735
524 Ga0265342_10001147
525 Ga0265342_10005447
526 Ga0265342_10008649
527 Ga0265342_10010078
528 Ga0265342_10036041
529 Ga0316576_10305135
530 Ga0316578_10215008
531 Ga0307406_10001348
532 Ga0307412_10542139
533 Ga0307415_100018424
534 Ga0307415_100156017
535 Ga0307507_10445152
536 Ga0373949_0000215
537 Ga0373951_0106438
538 Ga0373936_0000013
539 Ga0373941_0105374
540 Ga0373941_0272880
541 Ga0373961_0000049
542 Ga0395899_0048038
543 Ga0395899_0207190
544 Ga0395900_0051023
545 Ga0395898_0578582
546 Ga0395905_0143319
547 Ga0395905_0177554
548 Ga0395901_0023027
549 Ga0395901_1222802
550 Ga0436365_0083484
551 Ga0436365_1292797
552 Ga0436363_1020135
553 Ga0436362_0014083
554 Ga0451791_0021913
555 Ga0451793_0990100
556 Ga0451797_0296619
557 Ga0451577_0152943
558 Ga0453683_0072813
559 Ga0466966_0268800
560 Ga0466961_0165087
561 Ga0453684_0000078
562 Ga0453684_0490975
563 Ga0453684_0587370
564 Ga0453684_0714438
565 Ga0466959_0187865
566 Ga0466967_0377311
567 Ga0495629_0044602
568 Ga0495638_0332333
569 Ga0495651_0095536
570 Ga0495650_0094160
571 Ga0495610_0238170
572 Ga0495632_0383511
573 Ga0495586_0438594
574 Ga0495622_0124833
575 Ga0495623_0087589
576 Ga0495581_0459571
577 Ga0495604_0227535
578 Ga0495686_0046749
579 Ga0495602_0042164
580 Ga0496101_0204713
581 Ga0496112_0035350
582 Ga0501291_071490
583 Ga0501292_003734
584 Ga0501292_028529
585 Ga0501298_116526
586 Ga0501037_0435763
587 Ga0501043_0208551
588 Ga0501043_0710886
589 Ga0501047_0074003
590 Ga0501047_0176557
591 Ga0501069_0085747
592 Ga0501070_0032848
593 Ga0501072_0365394
594 Ga0501073_0814090
595 Ga0501074_0338506
596 Ga0501202_130419
597 Ga0501217_008783
598 Ga0501227_000766
599 Ga0501227_003472
600 Ga0501230_002578
601 Ga0501233_032177
602 Ga0501235_027204
603 Ga0501249_124905
604 Ga0501225_0005046
605 Ga0501229_031748
606 Ga0501229_033190
607 Ga0501080_0594118
608 Ga0501080_0853941
609 Ga0501081_0091353
610 Ga0501083_0037054
611 Ga0501267_005130
612 Ga0501035_0654252
613 Ga0501044_0044495
614 Ga0501044_0637270
615 Ga0501044_0661173
616 nmdc:mga09592_14584_c1
617 nmdc:mga09592_19146_c1
618 nmdc:mga09592_95499_c1
619 nmdc:mga0qj67_209788_c1
620 nmdc:mga0qj67_229038_c1
621 nmdc:mga08y16_7181_c1
622 nmdc:mga0rr50_908446_c1
623 nmdc:mga0rr50_970947_c1
624 nmdc:mga08x19_464904_c1
625 Ga0500635_0013204
626 Ga0500578_0307545
627 Ga0500646_0249950
628 Ga0500647_0211809
629 Ga0500566_0005001
630 Ga0500566_0013653
631 Ga0500566_0124578
632 Ga0500640_034799
633 Ga0500654_069758
634 Ga0500554_000322
635 Ga0500554_013047
636 Ga0500572_006566
637 Ga0500595_000249
638 Ga0500597_002360
639 Ga0500597_246896
640 Ga0500614_001476
641 Ga0500614_005020
642 Ga0500614_190721
643 Ga0500614_212705
644 Ga0500642_0003095
645 Ga0500652_201799
646 Ga0500658_0027446
647 Ga0500559_0013009
648 Ga0500585_057108
649 Ga0500603_001594
650 Ga0500619_126621
651 Ga0500630_159398
652 Ga0500639_029470
653 Ga0500636_0017735
654 Ga0500637_0117966
655 Ga0500601_001840
656 Ga0501084_1125738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

9

139

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yyb-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 15 0.948 6 163
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9467 6 163
7yy0-assembly1.cif.gz_C crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with 4'-phosphopantetheine 0.9467 6 163
7yy6-assembly1.cif.gz_C-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 10 0.9461 6 163
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9451 6 162
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9451 6 162 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9311 3 161 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9266 6 162 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9238 6 158 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9218 5 160 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A538QMH4-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9609 1 162 GO:0004595
GO:0005524
GO:0005737
GO:0006520
GO:0008483
GO:0015937
GO:0030170
AF-K9TPM2-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9531 7 163 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A5C8C6E2-F1-model_v4 deleted 0.9498 3 163
AF-A0A5S4ZXI8-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9481 6 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A1F9MGS8-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.948 5 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map