F407860

General Info

Members Datasets Scaffolds Average Seq Length
325 219 312 106

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10158482|Ga0207705_101584821
Length 120
Sequence MTSYYICSQIATQMNLRRDVFQAIADPTRRAILLLLASQSLTAGAIAANFDTARPTVSKHLQILTKCELLQQEQNGREIYYHINAKKMKEVADFIEPFRKMWDERFNKIETIMKKYKSKK

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2739367651 Pedobacter sp. OK291 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 2818991437 Pedobacter terrae 518 Isolate Unclassified
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
9 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
10 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
11 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
12 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
13 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
211 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 1.23
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 4.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005388 3300002739 Bacteria 1877
2 rootL2_10082341 3300003322 Bacteria 1020
3 Ga0065165_1005675 3300005262 Bacteria 6882
4 Ga0065714_10002191 3300005288 Bacteria 100067
5 Ga0065714_10108113 3300005288 Bacteria 1510
6 Ga0065712_10007293 3300005290 Bacteria 2927
7 Ga0070658_10102958 3300005327 Bacteria 2361
8 Ga0070658_10217848 3300005327 Bacteria 1614
9 Ga0070658_10853498 3300005327 Bacteria 791
10 Ga0070676_10032730 3300005328 Bacteria 2980
11 Ga0070670_100182275 3300005331 Bacteria 1823
12 Ga0068869_100026622 3300005334 Bacteria 4027
13 Ga0070666_10164448 3300005335 Bacteria 1552
14 Ga0070666_11404419 3300005335 Bacteria 522
15 Ga0070680_100025200 3300005336 Bacteria 4752
16 Ga0070680_100111771 3300005336 Bacteria 2275
17 Ga0070680_100546957 3300005336 Bacteria 992
18 Ga0070680_101586744 3300005336 Bacteria 567
19 Ga0070660_100242658 3300005339 Bacteria 1468
20 Ga0070660_100549955 3300005339 Bacteria 963
21 Ga0070691_10599038 3300005341 Bacteria 650
22 Ga0070661_100381551 3300005344 Bacteria 1111
23 Ga0070692_10277655 3300005345 Bacteria 1014
24 Ga0070668_100062448 3300005347 Bacteria 2886
25 Ga0070669_100006925 3300005353 Bacteria 8147
26 Ga0070674_100157002 3300005356 Bacteria 1722
27 Ga0070673_100075535 3300005364 Bacteria 2718
28 Ga0070688_101083531 3300005365 Bacteria 640
29 Ga0070667_100110951 3300005367 Bacteria 2378
30 Ga0070667_100476405 3300005367 Bacteria 1142
31 Ga0070663_100543730 3300005455 Bacteria 970
32 Ga0070678_100154315 3300005456 Bacteria 1853
33 Ga0070678_100652897 3300005456 Bacteria 944
34 Ga0070681_10038719 3300005458 Bacteria 4779
35 Ga0070681_11057099 3300005458 Bacteria 732
36 Ga0068867_100041223 3300005459 Bacteria 3373
37 Ga0070699_100614009 3300005518 Bacteria 992
38 Ga0070679_100453910 3300005530 Bacteria 1226
39 Ga0070679_100556962 3300005530 Bacteria 1090
40 Ga0070679_101099671 3300005530 Bacteria 740
41 Ga0070679_101862989 3300005530 Bacteria 550
42 Ga0070684_101088875 3300005535 Bacteria 751
43 Ga0070684_102107245 3300005535 Bacteria 532
44 Ga0070697_100563490 3300005536 Bacteria 999
45 Ga0068853_100003662 3300005539 Bacteria 11786
46 Ga0068853_100044920 3300005539 Bacteria 3783
47 Ga0070695_101714779 3300005545 Bacteria 526
48 Ga0070665_100109134 3300005548 Bacteria 2769
49 Ga0070704_100830656 3300005549 Bacteria 827
50 Ga0068855_100005764 3300005563 Bacteria 15123
51 Ga0068855_100854823 3300005563 Bacteria 964
52 Ga0070664_100231911 3300005564 Bacteria 1655
53 Ga0068857_101365146 3300005577 Bacteria 689
54 Ga0068854_100102163 3300005578 Bacteria 2150
55 Ga0068854_100103528 3300005578 Bacteria 2137
56 Ga0068854_100805865 3300005578 Bacteria 819
57 Ga0068856_100037046 3300005614 Bacteria 4785
58 Ga0068856_100112633 3300005614 Bacteria 2719
59 Ga0068856_101314903 3300005614 Bacteria 738
60 Ga0068856_101370781 3300005614 Bacteria 722
61 Ga0068852_100282121 3300005616 Bacteria 1602
62 Ga0068859_100058501 3300005617 Bacteria 3883
63 Ga0068859_100584931 3300005617 Bacteria 1210
64 Ga0068859_100660686 3300005617 Bacteria 1137
65 Ga0068866_10005460 3300005718 Bacteria 5247
66 Ga0068861_100295442 3300005719 Bacteria 1401
67 Ga0068851_10822327 3300005834 Bacteria 578
68 Ga0068863_100181212 3300005841 Bacteria 2022
69 Ga0068863_100289769 3300005841 Bacteria 1587
70 Ga0068863_101504337 3300005841 Bacteria 682
71 Ga0068860_100103240 3300005843 Bacteria 2721
72 Ga0068860_100118639 3300005843 Bacteria 2532
73 Ga0070716_100501182 3300006173 Bacteria 896
74 Ga0097621_100009866 3300006237 Bacteria 6953
75 Ga0097621_100148823 3300006237 Bacteria 2007
76 Ga0097621_101638812 3300006237 Bacteria 612
77 Ga0068871_100089131 3300006358 Bacteria 2567
78 Ga0068871_100921393 3300006358 Bacteria 811
79 Ga0075434_100364893 3300006871 Bacteria 1465
80 Ga0068865_100051819 3300006881 Bacteria 2842
81 Ga0097620_100058501 3300006931 Bacteria 3883
82 Ga0097620_100584848 3300006931 Bacteria 1210
83 Ga0097620_100660664 3300006931 Bacteria 1137
84 Ga0099794_10570051 3300007265 Bacteria 598
85 Ga0105244_10064985 3300009036 Bacteria 1829
86 Ga0105240_10286177 3300009093 Bacteria 1891
87 Ga0105240_10302501 3300009093 Bacteria 1829
88 Ga0105240_12438520 3300009093 Bacteria 541
89 Ga0114129_12839049 3300009147 Bacteria 575
90 Ga0105241_10144426 3300009174 Bacteria 1941
91 Ga0105241_10166638 3300009174 Bacteria 1816
92 Ga0105242_10196425 3300009176 Bacteria 1789
93 Ga0105248_10115803 3300009177 Bacteria 3023
94 Ga0105237_10007564 3300009545 Bacteria 11875
95 Ga0105237_10493457 3300009545 Bacteria 1231
96 Ga0105238_13050718 3300009551 Bacteria 503
97 Ga0105249_10828619 3300009553 Bacteria 990
98 Ga0105239_10034268 3300010375 Bacteria 5574
99 Ga0105239_10514584 3300010375 Bacteria 1361
100 Ga0157373_10000009 3300013100 Bacteria 201551
101 Ga0157371_10000401 3300013102 Bacteria 54323
102 Ga0157371_10047837 3300013102 Bacteria 3040
103 Ga0157371_10060647 3300013102 Bacteria 2682
104 Ga0157371_10409188 3300013102 Bacteria 993
105 Ga0157370_10007219 3300013104 Bacteria 12126
106 Ga0157370_10039260 3300013104 Bacteria 4575
107 Ga0157370_10043532 3300013104 Bacteria 4319
108 Ga0157370_10046015 3300013104 Bacteria 4184
109 Ga0157369_10022001 3300013105 Bacteria 7125
110 Ga0157369_10261340 3300013105 Bacteria 1805
111 Ga0157369_12272946 3300013105 Bacteria 550
112 Ga0157369_12344106 3300013105 Bacteria 541
113 Ga0157374_10590353 3300013296 Bacteria 1120
114 Ga0157378_10219842 3300013297 Bacteria 1805
115 Ga0157378_10585097 3300013297 Bacteria 1126
116 Ga0157378_10702853 3300013297 Bacteria 1030
117 Ga0163162_10111794 3300013306 Bacteria 2830
118 Ga0157372_10153312 3300013307 Bacteria 2660
119 Ga0157372_10190160 3300013307 Bacteria 2378
120 Ga0157372_10724895 3300013307 Bacteria 1156
121 Ga0157372_11624368 3300013307 Bacteria 744
122 Ga0157372_11706930 3300013307 Bacteria 724
123 Ga0157372_12630343 3300013307 Bacteria 577
124 Ga0157375_10128297 3300013308 Bacteria 2654
125 Ga0157375_10218929 3300013308 Bacteria 2062
126 Ga0182008_10000028 3300014497 Bacteria 176968
127 Ga0157377_10137841 3300014745 Bacteria 1497
128 Ga0157377_10437339 3300014745 Bacteria 900
129 Ga0157379_10455460 3300014968 Bacteria 1182
130 Ga0157379_10824908 3300014968 Bacteria 876
131 Ga0157379_11913967 3300014968 Bacteria 585
132 Ga0157376_10757311 3300014969 Bacteria 981
133 Ga0182005_1000249 3300015265 Bacteria 34293
134 Ga0163161_10420442 3300017792 Bacteria 1075
135 Ga0209436_103083 3300025208 Bacteria 4590
136 Ga0209026_1039883 3300025250 Bacteria 682
137 Ga0207426_1004538 3300025302 Bacteria 6716
138 Ga0207656_10425900 3300025321 Bacteria 669
139 Ga0207655_1059215 3300025728 Bacteria 1492
140 Ga0207688_10012410 3300025901 Bacteria 4634
141 Ga0207688_10303099 3300025901 Bacteria 977
142 Ga0207680_10616814 3300025903 Bacteria 776
143 Ga0207685_10623932 3300025905 Bacteria 580
144 Ga0207645_10000979 3300025907 Bacteria 23614
145 Ga0207705_10003083 3300025909 Bacteria 12708
146 Ga0207705_10158482 3300025909 Bacteria 1699
147 Ga0207705_10165067 3300025909 Bacteria 1665
148 Ga0207654_10638924 3300025911 Bacteria 761
149 Ga0207654_10825921 3300025911 Bacteria 670
150 Ga0207707_10246816 3300025912 Bacteria 1551
151 Ga0207707_11043320 3300025912 Bacteria 669
152 Ga0207695_10039005 3300025913 Bacteria 5108
153 Ga0207695_10205089 3300025913 Bacteria 1884
154 Ga0207671_10002560 3300025914 Bacteria 19306
155 Ga0207671_10088730 3300025914 Bacteria 2327
156 Ga0207660_11315740 3300025917 Bacteria 587
157 Ga0207657_10489981 3300025919 Bacteria 963
158 Ga0207649_10290145 3300025920 Bacteria 1193
159 Ga0207652_10000344 3300025921 Bacteria 48178
160 Ga0207681_10004756 3300025923 Bacteria 8357
161 Ga0207650_10204537 3300025925 Bacteria 1583
162 Ga0207686_10249669 3300025934 Bacteria 1295
163 Ga0207669_11135877 3300025937 Bacteria 660
164 Ga0207669_11593795 3300025937 Bacteria 557
165 Ga0207704_10031676 3300025938 Bacteria 2982
166 Ga0207691_10328354 3300025940 Bacteria 1311
167 Ga0207689_10006030 3300025942 Bacteria 10716
168 Ga0207667_10009512 3300025949 Bacteria 11436
169 Ga0207651_10148509 3300025960 Bacteria 1821
170 Ga0207668_11134220 3300025972 Bacteria 701
171 Ga0207640_10067546 3300025981 Bacteria 2393
172 Ga0207640_10106841 3300025981 Bacteria 1975
173 Ga0207640_10253988 3300025981 Bacteria 1366
174 Ga0207640_10539580 3300025981 Bacteria 978
175 Ga0207640_11669962 3300025981 Bacteria 575
176 Ga0207658_10241154 3300025986 Bacteria 1531
177 Ga0207677_10013617 3300026023 Bacteria 4719
178 Ga0207677_10153668 3300026023 Bacteria 1779
179 Ga0207677_10310711 3300026023 Bacteria 1306
180 Ga0207703_10048394 3300026035 Bacteria 3432
181 Ga0207639_10046777 3300026041 Bacteria 3266
182 Ga0207639_10320881 3300026041 Bacteria 1375
183 Ga0207678_10095803 3300026067 Bacteria 2536
184 Ga0207678_10135698 3300026067 Bacteria 2099
185 Ga0207702_10024200 3300026078 Bacteria 5038
186 Ga0207702_10469252 3300026078 Bacteria 1223
187 Ga0207702_11534337 3300026078 Bacteria 659
188 Ga0207641_10098513 3300026088 Bacteria 2571
189 Ga0207641_10223302 3300026088 Bacteria 1748
190 Ga0207641_10260907 3300026088 Bacteria 1622
191 Ga0207648_10019703 3300026089 Bacteria 6087
192 Ga0207674_10108424 3300026116 Bacteria 2753
193 Ga0207675_100238465 3300026118 Bacteria 1757
194 Ga0207683_10004452 3300026121 Bacteria 12100
195 Ga0207683_10478263 3300026121 Bacteria 1149
196 Ga0207698_10362481 3300026142 Bacteria 1373
197 Ga0209995_1005758 3300027471 Bacteria 1991
198 Ga0209968_1083410 3300027526 Bacteria 576
199 Ga0265337_1000106 3300028556 Bacteria 41891
200 Ga0265326_10027707 3300028558 Bacteria 1615
201 Ga0265319_1000149 3300028563 Bacteria 51786
202 Ga0265334_10038089 3300028573 Bacteria 1893
203 Ga0265334_10113743 3300028573 Bacteria 971
204 Ga0265318_10006298 3300028577 Bacteria 5481
205 Ga0265322_10003883 3300028654 Bacteria 4482
206 Ga0265336_10000236 3300028666 Bacteria 39539
207 Ga0265338_10014152 3300028800 Bacteria 8917
208 Ga0265338_10014186 3300028800 Bacteria 8898
209 Ga0265324_10018782 3300029957 Bacteria 2494
210 Ga0265332_10070175 3300031238 Bacteria 1493
211 Ga0265320_10003596 3300031240 Bacteria 10365
212 Ga0265325_10019872 3300031241 Bacteria 3708
213 Ga0265329_10075290 3300031242 Bacteria 1068
214 Ga0265329_10199063 3300031242 Bacteria 659
215 Ga0265340_10021382 3300031247 Bacteria 3318
216 Ga0265316_10009957 3300031344 Bacteria 8707
217 Ga0307408_100119510 3300031548 Bacteria 2039
218 Ga0265313_10003748 3300031595 Bacteria 12086
219 Ga0265314_10281244 3300031711 Bacteria 941
220 Ga0265342_10003022 3300031712 Bacteria 14098
221 Ga0307405_10377608 3300031731 Bacteria 1102
222 Ga0307413_11021378 3300031824 Bacteria 710
223 Ga0307410_11284448 3300031852 Bacteria 640
224 Ga0326468_10108532 3300031889 Bacteria 523
225 Ga0307412_10094988 3300031911 Bacteria 2095
226 Ga0307414_10000030 3300032004 Bacteria 187373
227 Ga0307414_10202749 3300032004 Bacteria 1615
228 Ga0307414_10618400 3300032004 Bacteria 973
229 Ga0307414_10859666 3300032004 Bacteria 830
230 Ga0307414_11753972 3300032004 Bacteria 579
231 Ga0307510_10192157 3300033180 Bacteria 1588
232 Ga0373934_0354958 3300035086 Bacteria 611
233 Ga0373944_0193194 3300035089 Bacteria 734
234 Ga0373943_0474047 3300035170 Bacteria 729
235 Ga0373935_0214496 3300035692 Bacteria 1335
236 Ga0373937_0040237 3300036401 Bacteria 4261
237 Ga0373937_0389148 3300036401 Bacteria 1323
238 Ga0373925_0758781 3300037068 Bacteria 800
239 Ga0395899_0058629 3300037312 Bacteria 2839
240 Ga0395900_0120911 3300037418 Bacteria 2687
241 Ga0395900_0246809 3300037418 Bacteria 1788
242 Ga0395898_0324719 3300037466 Bacteria 1468
243 Ga0395898_0469843 3300037466 Bacteria 1197
244 Ga0395898_1154967 3300037466 Bacteria 706
245 Ga0395905_0610945 3300037471 Bacteria 992
246 Ga0395901_0163767 3300038443 Bacteria 2335
247 Ga0395901_0355725 3300038443 Bacteria 1511
248 Ga0436361_1076984 3300039447 Bacteria 654
249 Ga0451797_0911949 3300041453 Bacteria 575
250 Ga0451802_0311974 3300041460 Bacteria 658
251 Ga0451841_0043835 3300041498 Bacteria 518
252 Ga0451841_0990982 3300041498 Bacteria 542
253 Ga0451853_3166572 3300041512 Bacteria 595
254 Ga0451853_3466682 3300041512 Bacteria 596
255 Ga0453684_0003647 3300044712 Bacteria 34203
256 Ga0453684_0021779 3300044712 Bacteria 9551
257 Ga0466957_0004677 3300044842 Bacteria 7654
258 Ga0451576_0019704 3300045051 Bacteria 7362
259 Ga0495585_0000323 3300046492 Bacteria 47094
260 Ga0495606_0045200 3300046507 Bacteria 2921
261 Ga0495616_0024831 3300046513 Bacteria 3209
262 Ga0495643_0001477 3300046522 Bacteria 21476
263 Ga0495648_0006718 3300046524 Bacteria 9305
264 Ga0495652_0473652 3300046529 Bacteria 873
265 Ga0495654_0081705 3300046530 Bacteria 1514
266 Ga0495609_0008096 3300046538 Bacteria 5178
267 Ga0495633_0000006 3300046558 Bacteria 326774
268 Ga0495625_0000239 3300046660 Bacteria 85876
269 Ga0495625_0000462 3300046660 Bacteria 60985
270 Ga0495625_0018654 3300046660 Bacteria 5408
271 Ga0495658_0126432 3300046683 Bacteria 1551
272 Ga0495670_0398946 3300046691 Bacteria 743
273 Ga0495581_0470585 3300047315 Bacteria 731
274 Ga0495686_0001041 3300047472 Bacteria 33277
275 Ga0495686_0668091 3300047472 Bacteria 532
276 Ga0495614_0098173 3300048089 Bacteria 1278
277 Ga0496106_1026817 3300048909 Bacteria 648
278 Ga0496114_0164957 3300048917 Bacteria 1928
279 Ga0495682_0019380 3300049460 Bacteria 2559
280 Ga0501298_200395 3300049521 Bacteria 507
281 Ga0501033_0450479 3300049570 Bacteria 894
282 Ga0501034_0002741 3300049571 Bacteria 20734
283 Ga0501034_0008801 3300049571 Bacteria 10621
284 Ga0501036_0423633 3300049572 Bacteria 1110
285 Ga0501036_0988023 3300049572 Bacteria 689
286 Ga0501037_0122121 3300049573 Bacteria 1872
287 Ga0501038_0102608 3300049574 Bacteria 2380
288 Ga0501043_1091755 3300049579 Bacteria 564
289 Ga0501043_1248192 3300049579 Bacteria 520
290 Ga0501043_1272648 3300049579 Bacteria 514
291 Ga0501047_0031774 3300049581 Bacteria 5093
292 Ga0501047_1402718 3300049581 Bacteria 514
293 Ga0501048_0664545 3300049582 Bacteria 748
294 Ga0501048_1186876 3300049582 Bacteria 549
295 Ga0501071_0737541 3300049587 Bacteria 759
296 Ga0501074_1252100 3300049590 Bacteria 520
297 Ga0501199_070021 3300049650 Bacteria 502
298 Ga0501223_005878 3300049663 Bacteria 2562
299 Ga0501223_029772 3300049663 Bacteria 1062
300 Ga0501250_098742 3300049680 Bacteria 517
301 Ga0501257_009406 3300049686 Bacteria 2207
302 Ga0501080_0391991 3300049742 Bacteria 1250
303 Ga0501264_002228 3300049761 Bacteria 1830
304 Ga0501035_0381353 3300049822 Bacteria 1176
305 Ga0501044_0008254 3300049823 Bacteria 11420
306 Ga0501044_0052053 3300049823 Bacteria 4221
307 Ga0501044_0084495 3300049823 Bacteria 3208
308 Ga0501044_0116673 3300049823 Bacteria 2675
309 nmdc:mga0n895_108043_c1 3300050512 Bacteria 2796
310 Ga0500614_066287 3300053123 Bacteria 981
311 Ga0500628_122645 3300053129 Bacteria 707
312 Ga0500568_0006445 3300053139 Bacteria 5888

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1000106 Ga0265337_100010626 97
2 3300028563 Ga0265319_1000149 Ga0265319_100014924 97
3 3300028577 Ga0265318_10006298 Ga0265318_100062987 97
4 3300028666 Ga0265336_10000236 Ga0265336_1000023619 97
5 3300028800 Ga0265338_10014186 Ga0265338_1001418610 97
6 3300031238 Ga0265332_10070175 Ga0265332_100701752 97
7 3300031240 Ga0265320_10003596 Ga0265320_100035963 97
8 3300031242 Ga0265329_10075290 Ga0265329_100752902 97
9 3300031344 Ga0265316_10009957 Ga0265316_1000995710 97
10 3300031595 Ga0265313_10003748 Ga0265313_1000374813 97
11 3300031711 Ga0265314_10281244 Ga0265314_102812441 97
12 3300031712 Ga0265342_10003022 Ga0265342_100030224 97
13 iso_pu_bacteria 2881955468 2881957877 98
14 iso_pu_bacteria 2993480792 2993484112 102
15 iso_pu_bacteria 2585427687 2586210353 103
16 iso_pu_bacteria 2775506987 2776614444 103
17 iso_pu_bacteria 2818991437 2819547718 103
18 iso_pu_bacteria 2818991442 2819577596 103
19 iso_pu_bacteria 2818991460 2819679653 103
20 iso_pu_bacteria 2821136567 2821142233 103
21 iso_pu_bacteria 2842722452 2842726725 103
22 iso_pu_bacteria 2842909656 2842911564 103
23 iso_pu_bacteria 2904467357 2904470599 103
24 iso_pu_bacteria 2954016120 2954019833 103
25 3300028573 Ga0265334_10113743 Ga0265334_101137431 104
26 iso_pu_bacteria 2739367651 2739587271 104
27 3300005288 Ga0065714_10108113 Ga0065714_101081131 105
28 3300033180 Ga0307510_10192157 Ga0307510_101921572 105
29 3300003322 rootL2_10082341 rootL2_100823412 106
30 3300005327 Ga0070658_10102958 Ga0070658_101029584 106
31 3300005327 Ga0070658_10853498 Ga0070658_108534982 106
32 3300005336 Ga0070680_100025200 Ga0070680_1000252004 106
33 3300005336 Ga0070680_100546957 Ga0070680_1005469571 106
34 3300005339 Ga0070660_100242658 Ga0070660_1002426581 106
35 3300005339 Ga0070660_100549955 Ga0070660_1005499552 106
36 3300005345 Ga0070692_10277655 Ga0070692_102776552 106
37 3300005458 Ga0070681_10038719 Ga0070681_100387192 106
38 3300005518 Ga0070699_100614009 Ga0070699_1006140092 106
39 3300005530 Ga0070679_100453910 Ga0070679_1004539101 106
40 3300005535 Ga0070684_102107245 Ga0070684_1021072451 106
41 3300005536 Ga0070697_100563490 Ga0070697_1005634902 106
42 3300005545 Ga0070695_101714779 Ga0070695_1017147791 106
43 3300005563 Ga0068855_100005764 Ga0068855_1000057647 106
44 3300005578 Ga0068854_100103528 Ga0068854_1001035282 106
45 3300005614 Ga0068856_100112633 Ga0068856_1001126331 106
46 3300005614 Ga0068856_101370781 Ga0068856_1013707811 106
47 3300005841 Ga0068863_100181212 Ga0068863_1001812122 106
48 3300006173 Ga0070716_100501182 Ga0070716_1005011822 106
49 3300006358 Ga0068871_100921393 Ga0068871_1009213932 106
50 3300009551 Ga0105238_13050718 Ga0105238_130507182 106
51 3300013102 Ga0157371_10000401 Ga0157371_1000040142 106
52 3300013102 Ga0157371_10060647 Ga0157371_100606472 106
53 3300013105 Ga0157369_10022001 Ga0157369_100220016 106
54 3300013105 Ga0157369_12344106 Ga0157369_123441061 106
55 3300013297 Ga0157378_10219842 Ga0157378_102198421 106
56 3300013297 Ga0157378_10702853 Ga0157378_107028532 106
57 3300013307 Ga0157372_10153312 Ga0157372_101533122 106
58 3300013307 Ga0157372_11624368 Ga0157372_116243682 106
59 3300013307 Ga0157372_11706930 Ga0157372_117069302 106
60 3300013308 Ga0157375_10218929 Ga0157375_102189292 106
61 3300014968 Ga0157379_11913967 Ga0157379_119139672 106
62 3300025909 Ga0207705_10003083 Ga0207705_100030835 106
63 3300025909 Ga0207705_10165067 Ga0207705_101650672 106
64 3300025912 Ga0207707_10246816 Ga0207707_102468161 106
65 3300025919 Ga0207657_10489981 Ga0207657_104899811 106
66 3300025921 Ga0207652_10000344 Ga0207652_1000034430 106
67 3300025940 Ga0207691_10328354 Ga0207691_103283542 106
68 3300025949 Ga0207667_10009512 Ga0207667_100095128 106
69 3300025981 Ga0207640_10067546 Ga0207640_100675462 106
70 3300026067 Ga0207678_10095803 Ga0207678_100958035 106
71 3300026067 Ga0207678_10135698 Ga0207678_101356982 106
72 3300026078 Ga0207702_10469252 Ga0207702_104692523 106
73 3300026088 Ga0207641_10223302 Ga0207641_102233022 106
74 3300031242 Ga0265329_10199063 Ga0265329_101990632 106
75 3300031824 Ga0307413_11021378 Ga0307413_110213782 106
76 3300032004 Ga0307414_10000030 Ga0307414_1000003068 106
77 3300036401 Ga0373937_0389148 Ga0373937_0389148_62_382 106
78 3300037312 Ga0395899_0058629 Ga0395899_0058629_538_858 106
79 3300037418 Ga0395900_0120911 Ga0395900_0120911_668_988 106
80 3300037418 Ga0395900_0246809 Ga0395900_0246809_648_968 106
81 3300037466 Ga0395898_0324719 Ga0395898_0324719_927_1247 106
82 3300037466 Ga0395898_1154967 Ga0395898_1154967_220_540 106
83 3300038443 Ga0395901_0163767 Ga0395901_0163767_681_1001 106
84 3300038443 Ga0395901_0355725 Ga0395901_0355725_802_1122 106
85 3300041453 Ga0451797_0911949 Ga0451797_0911949_146_466 106
86 3300044712 Ga0453684_0003647 Ga0453684_0003647_27631_27951 106
87 3300044842 Ga0466957_0004677 Ga0466957_0004677_5847_6167 106
88 3300046507 Ga0495606_0045200 Ga0495606_0045200_1211_1531 106
89 3300046513 Ga0495616_0024831 Ga0495616_0024831_593_913 106
90 3300046522 Ga0495643_0001477 Ga0495643_0001477_5421_5741 106
91 3300046660 Ga0495625_0018654 Ga0495625_0018654_3230_3550 106
92 3300049572 Ga0501036_0988023 Ga0501036_0988023_206_526 106
93 3300049579 Ga0501043_1091755 Ga0501043_1091755_159_479 106
94 3300049581 Ga0501047_0031774 Ga0501047_0031774_1093_1413 106
95 3300049582 Ga0501048_0664545 Ga0501048_0664545_304_624 106
96 3300049822 Ga0501035_0381353 Ga0501035_0381353_821_1141 106
97 3300049823 Ga0501044_0084495 Ga0501044_0084495_509_829 106
98 3300002739 JGI25158J39367_1005388 JGI25158J39367_10053882 107
99 3300005262 Ga0065165_1005675 Ga0065165_10056753 107
100 3300005288 Ga0065714_10002191 Ga0065714_1000219135 107
101 3300005290 Ga0065712_10007293 Ga0065712_100072932 107
102 3300005327 Ga0070658_10217848 Ga0070658_102178481 107
103 3300005328 Ga0070676_10032730 Ga0070676_100327302 107
104 3300005331 Ga0070670_100182275 Ga0070670_1001822752 107
105 3300005334 Ga0068869_100026622 Ga0068869_1000266226 107
106 3300005335 Ga0070666_10164448 Ga0070666_101644482 107
107 3300005335 Ga0070666_11404419 Ga0070666_114044191 107
108 3300005336 Ga0070680_100111771 Ga0070680_1001117713 107
109 3300005336 Ga0070680_101586744 Ga0070680_1015867441 107
110 3300005341 Ga0070691_10599038 Ga0070691_105990381 107
111 3300005344 Ga0070661_100381551 Ga0070661_1003815512 107
112 3300005347 Ga0070668_100062448 Ga0070668_1000624481 107
113 3300005353 Ga0070669_100006925 Ga0070669_1000069254 107
114 3300005356 Ga0070674_100157002 Ga0070674_1001570022 107
115 3300005364 Ga0070673_100075535 Ga0070673_1000755352 107
116 3300005365 Ga0070688_101083531 Ga0070688_1010835311 107
117 3300005367 Ga0070667_100110951 Ga0070667_1001109511 107
118 3300005367 Ga0070667_100476405 Ga0070667_1004764052 107
119 3300005455 Ga0070663_100543730 Ga0070663_1005437301 107
120 3300005456 Ga0070678_100154315 Ga0070678_1001543153 107
121 3300005456 Ga0070678_100652897 Ga0070678_1006528972 107
122 3300005458 Ga0070681_11057099 Ga0070681_110570992 107
123 3300005459 Ga0068867_100041223 Ga0068867_1000412235 107
124 3300005530 Ga0070679_100556962 Ga0070679_1005569621 107
125 3300005530 Ga0070679_101099671 Ga0070679_1010996711 107
126 3300005530 Ga0070679_101862989 Ga0070679_1018629892 107
127 3300005535 Ga0070684_101088875 Ga0070684_1010888752 107
128 3300005539 Ga0068853_100003662 Ga0068853_10000366211 107
129 3300005539 Ga0068853_100044920 Ga0068853_1000449203 107
130 3300005548 Ga0070665_100109134 Ga0070665_1001091341 107
131 3300005549 Ga0070704_100830656 Ga0070704_1008306561 107
132 3300005563 Ga0068855_100854823 Ga0068855_1008548232 107
133 3300005564 Ga0070664_100231911 Ga0070664_1002319113 107
134 3300005577 Ga0068857_101365146 Ga0068857_1013651461 107
135 3300005578 Ga0068854_100102163 Ga0068854_1001021634 107
136 3300005578 Ga0068854_100805865 Ga0068854_1008058652 107
137 3300005614 Ga0068856_100037046 Ga0068856_1000370469 107
138 3300005614 Ga0068856_101314903 Ga0068856_1013149032 107
139 3300005616 Ga0068852_100282121 Ga0068852_1002821212 107
140 3300005617 Ga0068859_100058501 Ga0068859_1000585012 107
141 3300005617 Ga0068859_100584931 Ga0068859_1005849313 107
142 3300005617 Ga0068859_100660686 Ga0068859_1006606862 107
143 3300005718 Ga0068866_10005460 Ga0068866_100054608 107
144 3300005719 Ga0068861_100295442 Ga0068861_1002954421 107
145 3300005834 Ga0068851_10822327 Ga0068851_108223272 107
146 3300005841 Ga0068863_100289769 Ga0068863_1002897692 107
147 3300005841 Ga0068863_101504337 Ga0068863_1015043372 107
148 3300005843 Ga0068860_100103240 Ga0068860_1001032402 107
149 3300005843 Ga0068860_100118639 Ga0068860_1001186392 107
150 3300006237 Ga0097621_100009866 Ga0097621_1000098665 107
151 3300006237 Ga0097621_100148823 Ga0097621_1001488232 107
152 3300006237 Ga0097621_101638812 Ga0097621_1016388122 107
153 3300006358 Ga0068871_100089131 Ga0068871_1000891315 107
154 3300006871 Ga0075434_100364893 Ga0075434_1003648931 107
155 3300006881 Ga0068865_100051819 Ga0068865_1000518191 107
156 3300006931 Ga0097620_100058501 Ga0097620_1000585012 107
157 3300006931 Ga0097620_100584848 Ga0097620_1005848481 107
158 3300006931 Ga0097620_100660664 Ga0097620_1006606642 107
159 3300007265 Ga0099794_10570051 Ga0099794_105700511 107
160 3300009036 Ga0105244_10064985 Ga0105244_100649852 107
161 3300009093 Ga0105240_10286177 Ga0105240_102861774 107
162 3300009093 Ga0105240_10302501 Ga0105240_103025012 107
163 3300009093 Ga0105240_12438520 Ga0105240_124385202 107
164 3300009147 Ga0114129_12839049 Ga0114129_128390492 107
165 3300009174 Ga0105241_10144426 Ga0105241_101444263 107
166 3300009174 Ga0105241_10166638 Ga0105241_101666382 107
167 3300009176 Ga0105242_10196425 Ga0105242_101964252 107
168 3300009177 Ga0105248_10115803 Ga0105248_101158034 107
169 3300009545 Ga0105237_10007564 Ga0105237_1000756417 107
170 3300009545 Ga0105237_10493457 Ga0105237_104934571 107
171 3300009553 Ga0105249_10828619 Ga0105249_108286193 107
172 3300010375 Ga0105239_10034268 Ga0105239_100342688 107
173 3300010375 Ga0105239_10514584 Ga0105239_105145843 107
174 3300013100 Ga0157373_10000009 Ga0157373_10000009148 107
175 3300013102 Ga0157371_10047837 Ga0157371_100478371 107
176 3300013102 Ga0157371_10409188 Ga0157371_104091883 107
177 3300013104 Ga0157370_10007219 Ga0157370_1000721910 107
178 3300013104 Ga0157370_10039260 Ga0157370_100392608 107
179 3300013104 Ga0157370_10043532 Ga0157370_100435323 107
180 3300013104 Ga0157370_10046015 Ga0157370_100460152 107
181 3300013105 Ga0157369_10261340 Ga0157369_102613402 107
182 3300013105 Ga0157369_12272946 Ga0157369_122729461 107
183 3300013296 Ga0157374_10590353 Ga0157374_105903532 107
184 3300013297 Ga0157378_10585097 Ga0157378_105850972 107
185 3300013306 Ga0163162_10111794 Ga0163162_101117943 107
186 3300013307 Ga0157372_10190160 Ga0157372_101901603 107
187 3300013307 Ga0157372_10724895 Ga0157372_107248953 107
188 3300013307 Ga0157372_12630343 Ga0157372_126303432 107
189 3300013308 Ga0157375_10128297 Ga0157375_101282972 107
190 3300014497 Ga0182008_10000028 Ga0182008_1000002848 107
191 3300014745 Ga0157377_10137841 Ga0157377_101378414 107
192 3300014745 Ga0157377_10437339 Ga0157377_104373392 107
193 3300014968 Ga0157379_10455460 Ga0157379_104554603 107
194 3300014968 Ga0157379_10824908 Ga0157379_108249082 107
195 3300014969 Ga0157376_10757311 Ga0157376_107573113 107
196 3300015265 Ga0182005_1000249 Ga0182005_100024910 107
197 3300017792 Ga0163161_10420442 Ga0163161_104204422 107
198 3300025208 Ga0209436_103083 Ga0209436_1030834 107
199 3300025250 Ga0209026_1039883 Ga0209026_10398832 107
200 3300025302 Ga0207426_1004538 Ga0207426_10045384 107
201 3300025321 Ga0207656_10425900 Ga0207656_104259002 107
202 3300025728 Ga0207655_1059215 Ga0207655_10592151 107
203 3300025901 Ga0207688_10012410 Ga0207688_100124105 107
204 3300025901 Ga0207688_10303099 Ga0207688_103030992 107
205 3300025903 Ga0207680_10616814 Ga0207680_106168142 107
206 3300025905 Ga0207685_10623932 Ga0207685_106239321 107
207 3300025907 Ga0207645_10000979 Ga0207645_1000097912 107
208 3300025909 Ga0207705_10158482 Ga0207705_101584821 107
209 3300025911 Ga0207654_10638924 Ga0207654_106389242 107
210 3300025911 Ga0207654_10825921 Ga0207654_108259211 107
211 3300025912 Ga0207707_11043320 Ga0207707_110433202 107
212 3300025913 Ga0207695_10039005 Ga0207695_100390053 107
213 3300025913 Ga0207695_10205089 Ga0207695_102050894 107
214 3300025914 Ga0207671_10002560 Ga0207671_100025604 107
215 3300025914 Ga0207671_10088730 Ga0207671_100887302 107
216 3300025917 Ga0207660_11315740 Ga0207660_113157401 107
217 3300025920 Ga0207649_10290145 Ga0207649_102901451 107
218 3300025923 Ga0207681_10004756 Ga0207681_1000475610 107
219 3300025925 Ga0207650_10204537 Ga0207650_102045373 107
220 3300025934 Ga0207686_10249669 Ga0207686_102496692 107
221 3300025937 Ga0207669_11135877 Ga0207669_111358771 107
222 3300025937 Ga0207669_11593795 Ga0207669_115937951 107
223 3300025938 Ga0207704_10031676 Ga0207704_100316764 107
224 3300025942 Ga0207689_10006030 Ga0207689_100060305 107
225 3300025960 Ga0207651_10148509 Ga0207651_101485092 107
226 3300025972 Ga0207668_11134220 Ga0207668_111342201 107
227 3300025981 Ga0207640_10106841 Ga0207640_101068414 107
228 3300025981 Ga0207640_10253988 Ga0207640_102539881 107
229 3300025981 Ga0207640_10539580 Ga0207640_105395802 107
230 3300025981 Ga0207640_11669962 Ga0207640_116699621 107
231 3300025986 Ga0207658_10241154 Ga0207658_102411542 107
232 3300026023 Ga0207677_10013617 Ga0207677_100136171 107
233 3300026023 Ga0207677_10153668 Ga0207677_101536681 107
234 3300026023 Ga0207677_10310711 Ga0207677_103107111 107
235 3300026035 Ga0207703_10048394 Ga0207703_100483943 107
236 3300026041 Ga0207639_10046777 Ga0207639_100467771 107
237 3300026041 Ga0207639_10320881 Ga0207639_103208811 107
238 3300026078 Ga0207702_10024200 Ga0207702_100242009 107
239 3300026078 Ga0207702_11534337 Ga0207702_115343372 107
240 3300026088 Ga0207641_10098513 Ga0207641_100985135 107
241 3300026088 Ga0207641_10260907 Ga0207641_102609073 107
242 3300026089 Ga0207648_10019703 Ga0207648_100197034 107
243 3300026116 Ga0207674_10108424 Ga0207674_101084242 107
244 3300026118 Ga0207675_100238465 Ga0207675_1002384654 107
245 3300026121 Ga0207683_10004452 Ga0207683_1000445213 107
246 3300026121 Ga0207683_10478263 Ga0207683_104782632 107
247 3300026142 Ga0207698_10362481 Ga0207698_103624812 107
248 3300027471 Ga0209995_1005758 Ga0209995_10057582 107
249 3300027526 Ga0209968_1083410 Ga0209968_10834101 107
250 3300028558 Ga0265326_10027707 Ga0265326_100277073 107
251 3300028573 Ga0265334_10038089 Ga0265334_100380893 107
252 3300028654 Ga0265322_10003883 Ga0265322_100038835 107
253 3300028800 Ga0265338_10014152 Ga0265338_100141527 107
254 3300029957 Ga0265324_10018782 Ga0265324_100187825 107
255 3300031241 Ga0265325_10019872 Ga0265325_100198725 107
256 3300031247 Ga0265340_10021382 Ga0265340_100213822 107
257 3300031548 Ga0307408_100119510 Ga0307408_1001195103 107
258 3300031731 Ga0307405_10377608 Ga0307405_103776082 107
259 3300031852 Ga0307410_11284448 Ga0307410_112844481 107
260 3300031889 Ga0326468_10108532 Ga0326468_101085321 107
261 3300031911 Ga0307412_10094988 Ga0307412_100949884 107
262 3300032004 Ga0307414_10202749 Ga0307414_102027491 107
263 3300032004 Ga0307414_10618400 Ga0307414_106184002 107
264 3300032004 Ga0307414_10859666 Ga0307414_108596661 107
265 3300032004 Ga0307414_11753972 Ga0307414_117539721 107
266 3300035086 Ga0373934_0354958 Ga0373934_0354958_133_456 107
267 3300035089 Ga0373944_0193194 Ga0373944_0193194_283_606 107
268 3300035170 Ga0373943_0474047 Ga0373943_0474047_150_473 107
269 3300035692 Ga0373935_0214496 Ga0373935_0214496_318_641 107
270 3300036401 Ga0373937_0040237 Ga0373937_0040237_2529_2852 107
271 3300037068 Ga0373925_0758781 Ga0373925_0758781_216_539 107
272 3300037466 Ga0395898_0469843 Ga0395898_0469843_70_393 107
273 3300037471 Ga0395905_0610945 Ga0395905_0610945_586_909 107
274 3300039447 Ga0436361_1076984 Ga0436361_1076984_143_466 107
275 3300041460 Ga0451802_0311974 Ga0451802_0311974_16_339 107
276 3300041498 Ga0451841_0043835 Ga0451841_0043835_43_366 107
277 3300041498 Ga0451841_0990982 Ga0451841_0990982_79_402 107
278 3300041512 Ga0451853_3166572 Ga0451853_3166572_75_398 107
279 3300041512 Ga0451853_3466682 Ga0451853_3466682_130_453 107
280 3300044712 Ga0453684_0021779 Ga0453684_0021779_1942_2304 107
281 3300045051 Ga0451576_0019704 Ga0451576_0019704_5663_6025 107
282 3300046492 Ga0495585_0000323 Ga0495585_0000323_30343_30666 107
283 3300046524 Ga0495648_0006718 Ga0495648_0006718_4244_4567 107
284 3300046529 Ga0495652_0473652 Ga0495652_0473652_362_685 107
285 3300046530 Ga0495654_0081705 Ga0495654_0081705_608_931 107
286 3300046538 Ga0495609_0008096 Ga0495609_0008096_2920_3243 107
287 3300046558 Ga0495633_0000006 Ga0495633_0000006_242711_243034 107
288 3300046660 Ga0495625_0000239 Ga0495625_0000239_69986_70309 107
289 3300046660 Ga0495625_0000462 Ga0495625_0000462_47371_47694 107
290 3300046683 Ga0495658_0126432 Ga0495658_0126432_1166_1489 107
291 3300046691 Ga0495670_0398946 Ga0495670_0398946_199_522 107
292 3300047315 Ga0495581_0470585 Ga0495581_0470585_177_500 107
293 3300047472 Ga0495686_0001041 Ga0495686_0001041_29905_30228 107
294 3300047472 Ga0495686_0668091 Ga0495686_0668091_127_450 107
295 3300048089 Ga0495614_0098173 Ga0495614_0098173_282_605 107
296 3300048909 Ga0496106_1026817 Ga0496106_1026817_279_602 107
297 3300048917 Ga0496114_0164957 Ga0496114_0164957_582_905 107
298 3300049460 Ga0495682_0019380 Ga0495682_0019380_1615_1938 107
299 3300049521 Ga0501298_200395 Ga0501298_200395_127_450 107
300 3300049570 Ga0501033_0450479 Ga0501033_0450479_489_812 107
301 3300049571 Ga0501034_0002741 Ga0501034_0002741_17931_18254 107
302 3300049571 Ga0501034_0008801 Ga0501034_0008801_8214_8537 107
303 3300049572 Ga0501036_0423633 Ga0501036_0423633_39_362 107
304 3300049573 Ga0501037_0122121 Ga0501037_0122121_1395_1718 107
305 3300049574 Ga0501038_0102608 Ga0501038_0102608_1694_2017 107
306 3300049579 Ga0501043_1248192 Ga0501043_1248192_86_409 107
307 3300049579 Ga0501043_1272648 Ga0501043_1272648_23_346 107
308 3300049581 Ga0501047_1402718 Ga0501047_1402718_161_484 107
309 3300049582 Ga0501048_1186876 Ga0501048_1186876_160_483 107
310 3300049587 Ga0501071_0737541 Ga0501071_0737541_269_592 107
311 3300049590 Ga0501074_1252100 Ga0501074_1252100_79_402 107
312 3300049650 Ga0501199_070021 Ga0501199_070021_152_475 107
313 3300049663 Ga0501223_005878 Ga0501223_005878_819_1142 107
314 3300049663 Ga0501223_029772 Ga0501223_029772_729_1052 107
315 3300049680 Ga0501250_098742 Ga0501250_098742_82_405 107
316 3300049686 Ga0501257_009406 Ga0501257_009406_1579_1902 107
317 3300049742 Ga0501080_0391991 Ga0501080_0391991_489_812 107
318 3300049761 Ga0501264_002228 Ga0501264_002228_12_335 107
319 3300049823 Ga0501044_0008254 Ga0501044_0008254_9760_10083 107
320 3300049823 Ga0501044_0052053 Ga0501044_0052053_2227_2550 107
321 3300049823 Ga0501044_0116673 Ga0501044_0116673_788_1111 107
322 3300050512 nmdc:mga0n895_108043_c1 nmdc:mga0n895_108043_c1_1896_2219 107
323 3300053123 Ga0500614_066287 Ga0500614_066287_359_682 107
324 3300053129 Ga0500628_122645 Ga0500628_122645_127_450 107
325 3300053139 Ga0500568_0006445 Ga0500568_0006445_2528_2851 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

26

72

0.97

PF12840

HTH_20

Helix-turn-helix domain

24

73

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9148 15 71
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9088 15 72
2zme-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9066 16 71
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.906 13 70
1r22-assembly1.cif.gz_B crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form 0.9058 8 89
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9646 13 69 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9544 13 76 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.951 13 71 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9311 9 70 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9296 13 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6N4EDV7-F1-model_v4 deleted 0.9696 1 78
AF-A0A4R2XX57-F1-model_v4 deleted 0.965 9 75
AF-A0A350I916-F1-model_v4 Transcriptional regulator 0.963 7 83 GO:0003700
GO:0005737
AF-A0A511MXX2-F1-model_v4 HTH arsR-type domain-containing protein 0.9605 8 75 GO:0003700
AF-A0A2U3CU02-F1-model_v4 HTH arsR-type domain-containing protein 0.9536 8 78 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
87.18 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map