F407860
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 219 | 312 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10158482|Ga0207705_101584821 |
| Length | 120 |
| Sequence | MTSYYICSQIATQMNLRRDVFQAIADPTRRAILLLLASQSLTAGAIAANFDTARPTVSKHLQILTKCELLQQEQNGREIYYHINAKKMKEVADFIEPFRKMWDERFNKIETIMKKYKSKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 2 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 3 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 4 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 5 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 6 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 7 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 8 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 9 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 10 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 11 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 12 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 13 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 14 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 196 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 212 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 218 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 219 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 0 |
| Isolates | 4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.15 |
| Nodule | 0 |
| Rhizoplane | 1.23 |
| Rhizosphere | 91.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1005388 | 3300002739 | Bacteria | 1877 |
| 2 | rootL2_10082341 | 3300003322 | Bacteria | 1020 |
| 3 | Ga0065165_1005675 | 3300005262 | Bacteria | 6882 |
| 4 | Ga0065714_10002191 | 3300005288 | Bacteria | 100067 |
| 5 | Ga0065714_10108113 | 3300005288 | Bacteria | 1510 |
| 6 | Ga0065712_10007293 | 3300005290 | Bacteria | 2927 |
| 7 | Ga0070658_10102958 | 3300005327 | Bacteria | 2361 |
| 8 | Ga0070658_10217848 | 3300005327 | Bacteria | 1614 |
| 9 | Ga0070658_10853498 | 3300005327 | Bacteria | 791 |
| 10 | Ga0070676_10032730 | 3300005328 | Bacteria | 2980 |
| 11 | Ga0070670_100182275 | 3300005331 | Bacteria | 1823 |
| 12 | Ga0068869_100026622 | 3300005334 | Bacteria | 4027 |
| 13 | Ga0070666_10164448 | 3300005335 | Bacteria | 1552 |
| 14 | Ga0070666_11404419 | 3300005335 | Bacteria | 522 |
| 15 | Ga0070680_100025200 | 3300005336 | Bacteria | 4752 |
| 16 | Ga0070680_100111771 | 3300005336 | Bacteria | 2275 |
| 17 | Ga0070680_100546957 | 3300005336 | Bacteria | 992 |
| 18 | Ga0070680_101586744 | 3300005336 | Bacteria | 567 |
| 19 | Ga0070660_100242658 | 3300005339 | Bacteria | 1468 |
| 20 | Ga0070660_100549955 | 3300005339 | Bacteria | 963 |
| 21 | Ga0070691_10599038 | 3300005341 | Bacteria | 650 |
| 22 | Ga0070661_100381551 | 3300005344 | Bacteria | 1111 |
| 23 | Ga0070692_10277655 | 3300005345 | Bacteria | 1014 |
| 24 | Ga0070668_100062448 | 3300005347 | Bacteria | 2886 |
| 25 | Ga0070669_100006925 | 3300005353 | Bacteria | 8147 |
| 26 | Ga0070674_100157002 | 3300005356 | Bacteria | 1722 |
| 27 | Ga0070673_100075535 | 3300005364 | Bacteria | 2718 |
| 28 | Ga0070688_101083531 | 3300005365 | Bacteria | 640 |
| 29 | Ga0070667_100110951 | 3300005367 | Bacteria | 2378 |
| 30 | Ga0070667_100476405 | 3300005367 | Bacteria | 1142 |
| 31 | Ga0070663_100543730 | 3300005455 | Bacteria | 970 |
| 32 | Ga0070678_100154315 | 3300005456 | Bacteria | 1853 |
| 33 | Ga0070678_100652897 | 3300005456 | Bacteria | 944 |
| 34 | Ga0070681_10038719 | 3300005458 | Bacteria | 4779 |
| 35 | Ga0070681_11057099 | 3300005458 | Bacteria | 732 |
| 36 | Ga0068867_100041223 | 3300005459 | Bacteria | 3373 |
| 37 | Ga0070699_100614009 | 3300005518 | Bacteria | 992 |
| 38 | Ga0070679_100453910 | 3300005530 | Bacteria | 1226 |
| 39 | Ga0070679_100556962 | 3300005530 | Bacteria | 1090 |
| 40 | Ga0070679_101099671 | 3300005530 | Bacteria | 740 |
| 41 | Ga0070679_101862989 | 3300005530 | Bacteria | 550 |
| 42 | Ga0070684_101088875 | 3300005535 | Bacteria | 751 |
| 43 | Ga0070684_102107245 | 3300005535 | Bacteria | 532 |
| 44 | Ga0070697_100563490 | 3300005536 | Bacteria | 999 |
| 45 | Ga0068853_100003662 | 3300005539 | Bacteria | 11786 |
| 46 | Ga0068853_100044920 | 3300005539 | Bacteria | 3783 |
| 47 | Ga0070695_101714779 | 3300005545 | Bacteria | 526 |
| 48 | Ga0070665_100109134 | 3300005548 | Bacteria | 2769 |
| 49 | Ga0070704_100830656 | 3300005549 | Bacteria | 827 |
| 50 | Ga0068855_100005764 | 3300005563 | Bacteria | 15123 |
| 51 | Ga0068855_100854823 | 3300005563 | Bacteria | 964 |
| 52 | Ga0070664_100231911 | 3300005564 | Bacteria | 1655 |
| 53 | Ga0068857_101365146 | 3300005577 | Bacteria | 689 |
| 54 | Ga0068854_100102163 | 3300005578 | Bacteria | 2150 |
| 55 | Ga0068854_100103528 | 3300005578 | Bacteria | 2137 |
| 56 | Ga0068854_100805865 | 3300005578 | Bacteria | 819 |
| 57 | Ga0068856_100037046 | 3300005614 | Bacteria | 4785 |
| 58 | Ga0068856_100112633 | 3300005614 | Bacteria | 2719 |
| 59 | Ga0068856_101314903 | 3300005614 | Bacteria | 738 |
| 60 | Ga0068856_101370781 | 3300005614 | Bacteria | 722 |
| 61 | Ga0068852_100282121 | 3300005616 | Bacteria | 1602 |
| 62 | Ga0068859_100058501 | 3300005617 | Bacteria | 3883 |
| 63 | Ga0068859_100584931 | 3300005617 | Bacteria | 1210 |
| 64 | Ga0068859_100660686 | 3300005617 | Bacteria | 1137 |
| 65 | Ga0068866_10005460 | 3300005718 | Bacteria | 5247 |
| 66 | Ga0068861_100295442 | 3300005719 | Bacteria | 1401 |
| 67 | Ga0068851_10822327 | 3300005834 | Bacteria | 578 |
| 68 | Ga0068863_100181212 | 3300005841 | Bacteria | 2022 |
| 69 | Ga0068863_100289769 | 3300005841 | Bacteria | 1587 |
| 70 | Ga0068863_101504337 | 3300005841 | Bacteria | 682 |
| 71 | Ga0068860_100103240 | 3300005843 | Bacteria | 2721 |
| 72 | Ga0068860_100118639 | 3300005843 | Bacteria | 2532 |
| 73 | Ga0070716_100501182 | 3300006173 | Bacteria | 896 |
| 74 | Ga0097621_100009866 | 3300006237 | Bacteria | 6953 |
| 75 | Ga0097621_100148823 | 3300006237 | Bacteria | 2007 |
| 76 | Ga0097621_101638812 | 3300006237 | Bacteria | 612 |
| 77 | Ga0068871_100089131 | 3300006358 | Bacteria | 2567 |
| 78 | Ga0068871_100921393 | 3300006358 | Bacteria | 811 |
| 79 | Ga0075434_100364893 | 3300006871 | Bacteria | 1465 |
| 80 | Ga0068865_100051819 | 3300006881 | Bacteria | 2842 |
| 81 | Ga0097620_100058501 | 3300006931 | Bacteria | 3883 |
| 82 | Ga0097620_100584848 | 3300006931 | Bacteria | 1210 |
| 83 | Ga0097620_100660664 | 3300006931 | Bacteria | 1137 |
| 84 | Ga0099794_10570051 | 3300007265 | Bacteria | 598 |
| 85 | Ga0105244_10064985 | 3300009036 | Bacteria | 1829 |
| 86 | Ga0105240_10286177 | 3300009093 | Bacteria | 1891 |
| 87 | Ga0105240_10302501 | 3300009093 | Bacteria | 1829 |
| 88 | Ga0105240_12438520 | 3300009093 | Bacteria | 541 |
| 89 | Ga0114129_12839049 | 3300009147 | Bacteria | 575 |
| 90 | Ga0105241_10144426 | 3300009174 | Bacteria | 1941 |
| 91 | Ga0105241_10166638 | 3300009174 | Bacteria | 1816 |
| 92 | Ga0105242_10196425 | 3300009176 | Bacteria | 1789 |
| 93 | Ga0105248_10115803 | 3300009177 | Bacteria | 3023 |
| 94 | Ga0105237_10007564 | 3300009545 | Bacteria | 11875 |
| 95 | Ga0105237_10493457 | 3300009545 | Bacteria | 1231 |
| 96 | Ga0105238_13050718 | 3300009551 | Bacteria | 503 |
| 97 | Ga0105249_10828619 | 3300009553 | Bacteria | 990 |
| 98 | Ga0105239_10034268 | 3300010375 | Bacteria | 5574 |
| 99 | Ga0105239_10514584 | 3300010375 | Bacteria | 1361 |
| 100 | Ga0157373_10000009 | 3300013100 | Bacteria | 201551 |
| 101 | Ga0157371_10000401 | 3300013102 | Bacteria | 54323 |
| 102 | Ga0157371_10047837 | 3300013102 | Bacteria | 3040 |
| 103 | Ga0157371_10060647 | 3300013102 | Bacteria | 2682 |
| 104 | Ga0157371_10409188 | 3300013102 | Bacteria | 993 |
| 105 | Ga0157370_10007219 | 3300013104 | Bacteria | 12126 |
| 106 | Ga0157370_10039260 | 3300013104 | Bacteria | 4575 |
| 107 | Ga0157370_10043532 | 3300013104 | Bacteria | 4319 |
| 108 | Ga0157370_10046015 | 3300013104 | Bacteria | 4184 |
| 109 | Ga0157369_10022001 | 3300013105 | Bacteria | 7125 |
| 110 | Ga0157369_10261340 | 3300013105 | Bacteria | 1805 |
| 111 | Ga0157369_12272946 | 3300013105 | Bacteria | 550 |
| 112 | Ga0157369_12344106 | 3300013105 | Bacteria | 541 |
| 113 | Ga0157374_10590353 | 3300013296 | Bacteria | 1120 |
| 114 | Ga0157378_10219842 | 3300013297 | Bacteria | 1805 |
| 115 | Ga0157378_10585097 | 3300013297 | Bacteria | 1126 |
| 116 | Ga0157378_10702853 | 3300013297 | Bacteria | 1030 |
| 117 | Ga0163162_10111794 | 3300013306 | Bacteria | 2830 |
| 118 | Ga0157372_10153312 | 3300013307 | Bacteria | 2660 |
| 119 | Ga0157372_10190160 | 3300013307 | Bacteria | 2378 |
| 120 | Ga0157372_10724895 | 3300013307 | Bacteria | 1156 |
| 121 | Ga0157372_11624368 | 3300013307 | Bacteria | 744 |
| 122 | Ga0157372_11706930 | 3300013307 | Bacteria | 724 |
| 123 | Ga0157372_12630343 | 3300013307 | Bacteria | 577 |
| 124 | Ga0157375_10128297 | 3300013308 | Bacteria | 2654 |
| 125 | Ga0157375_10218929 | 3300013308 | Bacteria | 2062 |
| 126 | Ga0182008_10000028 | 3300014497 | Bacteria | 176968 |
| 127 | Ga0157377_10137841 | 3300014745 | Bacteria | 1497 |
| 128 | Ga0157377_10437339 | 3300014745 | Bacteria | 900 |
| 129 | Ga0157379_10455460 | 3300014968 | Bacteria | 1182 |
| 130 | Ga0157379_10824908 | 3300014968 | Bacteria | 876 |
| 131 | Ga0157379_11913967 | 3300014968 | Bacteria | 585 |
| 132 | Ga0157376_10757311 | 3300014969 | Bacteria | 981 |
| 133 | Ga0182005_1000249 | 3300015265 | Bacteria | 34293 |
| 134 | Ga0163161_10420442 | 3300017792 | Bacteria | 1075 |
| 135 | Ga0209436_103083 | 3300025208 | Bacteria | 4590 |
| 136 | Ga0209026_1039883 | 3300025250 | Bacteria | 682 |
| 137 | Ga0207426_1004538 | 3300025302 | Bacteria | 6716 |
| 138 | Ga0207656_10425900 | 3300025321 | Bacteria | 669 |
| 139 | Ga0207655_1059215 | 3300025728 | Bacteria | 1492 |
| 140 | Ga0207688_10012410 | 3300025901 | Bacteria | 4634 |
| 141 | Ga0207688_10303099 | 3300025901 | Bacteria | 977 |
| 142 | Ga0207680_10616814 | 3300025903 | Bacteria | 776 |
| 143 | Ga0207685_10623932 | 3300025905 | Bacteria | 580 |
| 144 | Ga0207645_10000979 | 3300025907 | Bacteria | 23614 |
| 145 | Ga0207705_10003083 | 3300025909 | Bacteria | 12708 |
| 146 | Ga0207705_10158482 | 3300025909 | Bacteria | 1699 |
| 147 | Ga0207705_10165067 | 3300025909 | Bacteria | 1665 |
| 148 | Ga0207654_10638924 | 3300025911 | Bacteria | 761 |
| 149 | Ga0207654_10825921 | 3300025911 | Bacteria | 670 |
| 150 | Ga0207707_10246816 | 3300025912 | Bacteria | 1551 |
| 151 | Ga0207707_11043320 | 3300025912 | Bacteria | 669 |
| 152 | Ga0207695_10039005 | 3300025913 | Bacteria | 5108 |
| 153 | Ga0207695_10205089 | 3300025913 | Bacteria | 1884 |
| 154 | Ga0207671_10002560 | 3300025914 | Bacteria | 19306 |
| 155 | Ga0207671_10088730 | 3300025914 | Bacteria | 2327 |
| 156 | Ga0207660_11315740 | 3300025917 | Bacteria | 587 |
| 157 | Ga0207657_10489981 | 3300025919 | Bacteria | 963 |
| 158 | Ga0207649_10290145 | 3300025920 | Bacteria | 1193 |
| 159 | Ga0207652_10000344 | 3300025921 | Bacteria | 48178 |
| 160 | Ga0207681_10004756 | 3300025923 | Bacteria | 8357 |
| 161 | Ga0207650_10204537 | 3300025925 | Bacteria | 1583 |
| 162 | Ga0207686_10249669 | 3300025934 | Bacteria | 1295 |
| 163 | Ga0207669_11135877 | 3300025937 | Bacteria | 660 |
| 164 | Ga0207669_11593795 | 3300025937 | Bacteria | 557 |
| 165 | Ga0207704_10031676 | 3300025938 | Bacteria | 2982 |
| 166 | Ga0207691_10328354 | 3300025940 | Bacteria | 1311 |
| 167 | Ga0207689_10006030 | 3300025942 | Bacteria | 10716 |
| 168 | Ga0207667_10009512 | 3300025949 | Bacteria | 11436 |
| 169 | Ga0207651_10148509 | 3300025960 | Bacteria | 1821 |
| 170 | Ga0207668_11134220 | 3300025972 | Bacteria | 701 |
| 171 | Ga0207640_10067546 | 3300025981 | Bacteria | 2393 |
| 172 | Ga0207640_10106841 | 3300025981 | Bacteria | 1975 |
| 173 | Ga0207640_10253988 | 3300025981 | Bacteria | 1366 |
| 174 | Ga0207640_10539580 | 3300025981 | Bacteria | 978 |
| 175 | Ga0207640_11669962 | 3300025981 | Bacteria | 575 |
| 176 | Ga0207658_10241154 | 3300025986 | Bacteria | 1531 |
| 177 | Ga0207677_10013617 | 3300026023 | Bacteria | 4719 |
| 178 | Ga0207677_10153668 | 3300026023 | Bacteria | 1779 |
| 179 | Ga0207677_10310711 | 3300026023 | Bacteria | 1306 |
| 180 | Ga0207703_10048394 | 3300026035 | Bacteria | 3432 |
| 181 | Ga0207639_10046777 | 3300026041 | Bacteria | 3266 |
| 182 | Ga0207639_10320881 | 3300026041 | Bacteria | 1375 |
| 183 | Ga0207678_10095803 | 3300026067 | Bacteria | 2536 |
| 184 | Ga0207678_10135698 | 3300026067 | Bacteria | 2099 |
| 185 | Ga0207702_10024200 | 3300026078 | Bacteria | 5038 |
| 186 | Ga0207702_10469252 | 3300026078 | Bacteria | 1223 |
| 187 | Ga0207702_11534337 | 3300026078 | Bacteria | 659 |
| 188 | Ga0207641_10098513 | 3300026088 | Bacteria | 2571 |
| 189 | Ga0207641_10223302 | 3300026088 | Bacteria | 1748 |
| 190 | Ga0207641_10260907 | 3300026088 | Bacteria | 1622 |
| 191 | Ga0207648_10019703 | 3300026089 | Bacteria | 6087 |
| 192 | Ga0207674_10108424 | 3300026116 | Bacteria | 2753 |
| 193 | Ga0207675_100238465 | 3300026118 | Bacteria | 1757 |
| 194 | Ga0207683_10004452 | 3300026121 | Bacteria | 12100 |
| 195 | Ga0207683_10478263 | 3300026121 | Bacteria | 1149 |
| 196 | Ga0207698_10362481 | 3300026142 | Bacteria | 1373 |
| 197 | Ga0209995_1005758 | 3300027471 | Bacteria | 1991 |
| 198 | Ga0209968_1083410 | 3300027526 | Bacteria | 576 |
| 199 | Ga0265337_1000106 | 3300028556 | Bacteria | 41891 |
| 200 | Ga0265326_10027707 | 3300028558 | Bacteria | 1615 |
| 201 | Ga0265319_1000149 | 3300028563 | Bacteria | 51786 |
| 202 | Ga0265334_10038089 | 3300028573 | Bacteria | 1893 |
| 203 | Ga0265334_10113743 | 3300028573 | Bacteria | 971 |
| 204 | Ga0265318_10006298 | 3300028577 | Bacteria | 5481 |
| 205 | Ga0265322_10003883 | 3300028654 | Bacteria | 4482 |
| 206 | Ga0265336_10000236 | 3300028666 | Bacteria | 39539 |
| 207 | Ga0265338_10014152 | 3300028800 | Bacteria | 8917 |
| 208 | Ga0265338_10014186 | 3300028800 | Bacteria | 8898 |
| 209 | Ga0265324_10018782 | 3300029957 | Bacteria | 2494 |
| 210 | Ga0265332_10070175 | 3300031238 | Bacteria | 1493 |
| 211 | Ga0265320_10003596 | 3300031240 | Bacteria | 10365 |
| 212 | Ga0265325_10019872 | 3300031241 | Bacteria | 3708 |
| 213 | Ga0265329_10075290 | 3300031242 | Bacteria | 1068 |
| 214 | Ga0265329_10199063 | 3300031242 | Bacteria | 659 |
| 215 | Ga0265340_10021382 | 3300031247 | Bacteria | 3318 |
| 216 | Ga0265316_10009957 | 3300031344 | Bacteria | 8707 |
| 217 | Ga0307408_100119510 | 3300031548 | Bacteria | 2039 |
| 218 | Ga0265313_10003748 | 3300031595 | Bacteria | 12086 |
| 219 | Ga0265314_10281244 | 3300031711 | Bacteria | 941 |
| 220 | Ga0265342_10003022 | 3300031712 | Bacteria | 14098 |
| 221 | Ga0307405_10377608 | 3300031731 | Bacteria | 1102 |
| 222 | Ga0307413_11021378 | 3300031824 | Bacteria | 710 |
| 223 | Ga0307410_11284448 | 3300031852 | Bacteria | 640 |
| 224 | Ga0326468_10108532 | 3300031889 | Bacteria | 523 |
| 225 | Ga0307412_10094988 | 3300031911 | Bacteria | 2095 |
| 226 | Ga0307414_10000030 | 3300032004 | Bacteria | 187373 |
| 227 | Ga0307414_10202749 | 3300032004 | Bacteria | 1615 |
| 228 | Ga0307414_10618400 | 3300032004 | Bacteria | 973 |
| 229 | Ga0307414_10859666 | 3300032004 | Bacteria | 830 |
| 230 | Ga0307414_11753972 | 3300032004 | Bacteria | 579 |
| 231 | Ga0307510_10192157 | 3300033180 | Bacteria | 1588 |
| 232 | Ga0373934_0354958 | 3300035086 | Bacteria | 611 |
| 233 | Ga0373944_0193194 | 3300035089 | Bacteria | 734 |
| 234 | Ga0373943_0474047 | 3300035170 | Bacteria | 729 |
| 235 | Ga0373935_0214496 | 3300035692 | Bacteria | 1335 |
| 236 | Ga0373937_0040237 | 3300036401 | Bacteria | 4261 |
| 237 | Ga0373937_0389148 | 3300036401 | Bacteria | 1323 |
| 238 | Ga0373925_0758781 | 3300037068 | Bacteria | 800 |
| 239 | Ga0395899_0058629 | 3300037312 | Bacteria | 2839 |
| 240 | Ga0395900_0120911 | 3300037418 | Bacteria | 2687 |
| 241 | Ga0395900_0246809 | 3300037418 | Bacteria | 1788 |
| 242 | Ga0395898_0324719 | 3300037466 | Bacteria | 1468 |
| 243 | Ga0395898_0469843 | 3300037466 | Bacteria | 1197 |
| 244 | Ga0395898_1154967 | 3300037466 | Bacteria | 706 |
| 245 | Ga0395905_0610945 | 3300037471 | Bacteria | 992 |
| 246 | Ga0395901_0163767 | 3300038443 | Bacteria | 2335 |
| 247 | Ga0395901_0355725 | 3300038443 | Bacteria | 1511 |
| 248 | Ga0436361_1076984 | 3300039447 | Bacteria | 654 |
| 249 | Ga0451797_0911949 | 3300041453 | Bacteria | 575 |
| 250 | Ga0451802_0311974 | 3300041460 | Bacteria | 658 |
| 251 | Ga0451841_0043835 | 3300041498 | Bacteria | 518 |
| 252 | Ga0451841_0990982 | 3300041498 | Bacteria | 542 |
| 253 | Ga0451853_3166572 | 3300041512 | Bacteria | 595 |
| 254 | Ga0451853_3466682 | 3300041512 | Bacteria | 596 |
| 255 | Ga0453684_0003647 | 3300044712 | Bacteria | 34203 |
| 256 | Ga0453684_0021779 | 3300044712 | Bacteria | 9551 |
| 257 | Ga0466957_0004677 | 3300044842 | Bacteria | 7654 |
| 258 | Ga0451576_0019704 | 3300045051 | Bacteria | 7362 |
| 259 | Ga0495585_0000323 | 3300046492 | Bacteria | 47094 |
| 260 | Ga0495606_0045200 | 3300046507 | Bacteria | 2921 |
| 261 | Ga0495616_0024831 | 3300046513 | Bacteria | 3209 |
| 262 | Ga0495643_0001477 | 3300046522 | Bacteria | 21476 |
| 263 | Ga0495648_0006718 | 3300046524 | Bacteria | 9305 |
| 264 | Ga0495652_0473652 | 3300046529 | Bacteria | 873 |
| 265 | Ga0495654_0081705 | 3300046530 | Bacteria | 1514 |
| 266 | Ga0495609_0008096 | 3300046538 | Bacteria | 5178 |
| 267 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 268 | Ga0495625_0000239 | 3300046660 | Bacteria | 85876 |
| 269 | Ga0495625_0000462 | 3300046660 | Bacteria | 60985 |
| 270 | Ga0495625_0018654 | 3300046660 | Bacteria | 5408 |
| 271 | Ga0495658_0126432 | 3300046683 | Bacteria | 1551 |
| 272 | Ga0495670_0398946 | 3300046691 | Bacteria | 743 |
| 273 | Ga0495581_0470585 | 3300047315 | Bacteria | 731 |
| 274 | Ga0495686_0001041 | 3300047472 | Bacteria | 33277 |
| 275 | Ga0495686_0668091 | 3300047472 | Bacteria | 532 |
| 276 | Ga0495614_0098173 | 3300048089 | Bacteria | 1278 |
| 277 | Ga0496106_1026817 | 3300048909 | Bacteria | 648 |
| 278 | Ga0496114_0164957 | 3300048917 | Bacteria | 1928 |
| 279 | Ga0495682_0019380 | 3300049460 | Bacteria | 2559 |
| 280 | Ga0501298_200395 | 3300049521 | Bacteria | 507 |
| 281 | Ga0501033_0450479 | 3300049570 | Bacteria | 894 |
| 282 | Ga0501034_0002741 | 3300049571 | Bacteria | 20734 |
| 283 | Ga0501034_0008801 | 3300049571 | Bacteria | 10621 |
| 284 | Ga0501036_0423633 | 3300049572 | Bacteria | 1110 |
| 285 | Ga0501036_0988023 | 3300049572 | Bacteria | 689 |
| 286 | Ga0501037_0122121 | 3300049573 | Bacteria | 1872 |
| 287 | Ga0501038_0102608 | 3300049574 | Bacteria | 2380 |
| 288 | Ga0501043_1091755 | 3300049579 | Bacteria | 564 |
| 289 | Ga0501043_1248192 | 3300049579 | Bacteria | 520 |
| 290 | Ga0501043_1272648 | 3300049579 | Bacteria | 514 |
| 291 | Ga0501047_0031774 | 3300049581 | Bacteria | 5093 |
| 292 | Ga0501047_1402718 | 3300049581 | Bacteria | 514 |
| 293 | Ga0501048_0664545 | 3300049582 | Bacteria | 748 |
| 294 | Ga0501048_1186876 | 3300049582 | Bacteria | 549 |
| 295 | Ga0501071_0737541 | 3300049587 | Bacteria | 759 |
| 296 | Ga0501074_1252100 | 3300049590 | Bacteria | 520 |
| 297 | Ga0501199_070021 | 3300049650 | Bacteria | 502 |
| 298 | Ga0501223_005878 | 3300049663 | Bacteria | 2562 |
| 299 | Ga0501223_029772 | 3300049663 | Bacteria | 1062 |
| 300 | Ga0501250_098742 | 3300049680 | Bacteria | 517 |
| 301 | Ga0501257_009406 | 3300049686 | Bacteria | 2207 |
| 302 | Ga0501080_0391991 | 3300049742 | Bacteria | 1250 |
| 303 | Ga0501264_002228 | 3300049761 | Bacteria | 1830 |
| 304 | Ga0501035_0381353 | 3300049822 | Bacteria | 1176 |
| 305 | Ga0501044_0008254 | 3300049823 | Bacteria | 11420 |
| 306 | Ga0501044_0052053 | 3300049823 | Bacteria | 4221 |
| 307 | Ga0501044_0084495 | 3300049823 | Bacteria | 3208 |
| 308 | Ga0501044_0116673 | 3300049823 | Bacteria | 2675 |
| 309 | nmdc:mga0n895_108043_c1 | 3300050512 | Bacteria | 2796 |
| 310 | Ga0500614_066287 | 3300053123 | Bacteria | 981 |
| 311 | Ga0500628_122645 | 3300053129 | Bacteria | 707 |
| 312 | Ga0500568_0006445 | 3300053139 | Bacteria | 5888 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028556 | Ga0265337_1000106 | Ga0265337_100010626 | 97 |
| 2 | 3300028563 | Ga0265319_1000149 | Ga0265319_100014924 | 97 |
| 3 | 3300028577 | Ga0265318_10006298 | Ga0265318_100062987 | 97 |
| 4 | 3300028666 | Ga0265336_10000236 | Ga0265336_1000023619 | 97 |
| 5 | 3300028800 | Ga0265338_10014186 | Ga0265338_1001418610 | 97 |
| 6 | 3300031238 | Ga0265332_10070175 | Ga0265332_100701752 | 97 |
| 7 | 3300031240 | Ga0265320_10003596 | Ga0265320_100035963 | 97 |
| 8 | 3300031242 | Ga0265329_10075290 | Ga0265329_100752902 | 97 |
| 9 | 3300031344 | Ga0265316_10009957 | Ga0265316_1000995710 | 97 |
| 10 | 3300031595 | Ga0265313_10003748 | Ga0265313_1000374813 | 97 |
| 11 | 3300031711 | Ga0265314_10281244 | Ga0265314_102812441 | 97 |
| 12 | 3300031712 | Ga0265342_10003022 | Ga0265342_100030224 | 97 |
| 13 | iso_pu_bacteria | 2881955468 | 2881957877 | 98 |
| 14 | iso_pu_bacteria | 2993480792 | 2993484112 | 102 |
| 15 | iso_pu_bacteria | 2585427687 | 2586210353 | 103 |
| 16 | iso_pu_bacteria | 2775506987 | 2776614444 | 103 |
| 17 | iso_pu_bacteria | 2818991437 | 2819547718 | 103 |
| 18 | iso_pu_bacteria | 2818991442 | 2819577596 | 103 |
| 19 | iso_pu_bacteria | 2818991460 | 2819679653 | 103 |
| 20 | iso_pu_bacteria | 2821136567 | 2821142233 | 103 |
| 21 | iso_pu_bacteria | 2842722452 | 2842726725 | 103 |
| 22 | iso_pu_bacteria | 2842909656 | 2842911564 | 103 |
| 23 | iso_pu_bacteria | 2904467357 | 2904470599 | 103 |
| 24 | iso_pu_bacteria | 2954016120 | 2954019833 | 103 |
| 25 | 3300028573 | Ga0265334_10113743 | Ga0265334_101137431 | 104 |
| 26 | iso_pu_bacteria | 2739367651 | 2739587271 | 104 |
| 27 | 3300005288 | Ga0065714_10108113 | Ga0065714_101081131 | 105 |
| 28 | 3300033180 | Ga0307510_10192157 | Ga0307510_101921572 | 105 |
| 29 | 3300003322 | rootL2_10082341 | rootL2_100823412 | 106 |
| 30 | 3300005327 | Ga0070658_10102958 | Ga0070658_101029584 | 106 |
| 31 | 3300005327 | Ga0070658_10853498 | Ga0070658_108534982 | 106 |
| 32 | 3300005336 | Ga0070680_100025200 | Ga0070680_1000252004 | 106 |
| 33 | 3300005336 | Ga0070680_100546957 | Ga0070680_1005469571 | 106 |
| 34 | 3300005339 | Ga0070660_100242658 | Ga0070660_1002426581 | 106 |
| 35 | 3300005339 | Ga0070660_100549955 | Ga0070660_1005499552 | 106 |
| 36 | 3300005345 | Ga0070692_10277655 | Ga0070692_102776552 | 106 |
| 37 | 3300005458 | Ga0070681_10038719 | Ga0070681_100387192 | 106 |
| 38 | 3300005518 | Ga0070699_100614009 | Ga0070699_1006140092 | 106 |
| 39 | 3300005530 | Ga0070679_100453910 | Ga0070679_1004539101 | 106 |
| 40 | 3300005535 | Ga0070684_102107245 | Ga0070684_1021072451 | 106 |
| 41 | 3300005536 | Ga0070697_100563490 | Ga0070697_1005634902 | 106 |
| 42 | 3300005545 | Ga0070695_101714779 | Ga0070695_1017147791 | 106 |
| 43 | 3300005563 | Ga0068855_100005764 | Ga0068855_1000057647 | 106 |
| 44 | 3300005578 | Ga0068854_100103528 | Ga0068854_1001035282 | 106 |
| 45 | 3300005614 | Ga0068856_100112633 | Ga0068856_1001126331 | 106 |
| 46 | 3300005614 | Ga0068856_101370781 | Ga0068856_1013707811 | 106 |
| 47 | 3300005841 | Ga0068863_100181212 | Ga0068863_1001812122 | 106 |
| 48 | 3300006173 | Ga0070716_100501182 | Ga0070716_1005011822 | 106 |
| 49 | 3300006358 | Ga0068871_100921393 | Ga0068871_1009213932 | 106 |
| 50 | 3300009551 | Ga0105238_13050718 | Ga0105238_130507182 | 106 |
| 51 | 3300013102 | Ga0157371_10000401 | Ga0157371_1000040142 | 106 |
| 52 | 3300013102 | Ga0157371_10060647 | Ga0157371_100606472 | 106 |
| 53 | 3300013105 | Ga0157369_10022001 | Ga0157369_100220016 | 106 |
| 54 | 3300013105 | Ga0157369_12344106 | Ga0157369_123441061 | 106 |
| 55 | 3300013297 | Ga0157378_10219842 | Ga0157378_102198421 | 106 |
| 56 | 3300013297 | Ga0157378_10702853 | Ga0157378_107028532 | 106 |
| 57 | 3300013307 | Ga0157372_10153312 | Ga0157372_101533122 | 106 |
| 58 | 3300013307 | Ga0157372_11624368 | Ga0157372_116243682 | 106 |
| 59 | 3300013307 | Ga0157372_11706930 | Ga0157372_117069302 | 106 |
| 60 | 3300013308 | Ga0157375_10218929 | Ga0157375_102189292 | 106 |
| 61 | 3300014968 | Ga0157379_11913967 | Ga0157379_119139672 | 106 |
| 62 | 3300025909 | Ga0207705_10003083 | Ga0207705_100030835 | 106 |
| 63 | 3300025909 | Ga0207705_10165067 | Ga0207705_101650672 | 106 |
| 64 | 3300025912 | Ga0207707_10246816 | Ga0207707_102468161 | 106 |
| 65 | 3300025919 | Ga0207657_10489981 | Ga0207657_104899811 | 106 |
| 66 | 3300025921 | Ga0207652_10000344 | Ga0207652_1000034430 | 106 |
| 67 | 3300025940 | Ga0207691_10328354 | Ga0207691_103283542 | 106 |
| 68 | 3300025949 | Ga0207667_10009512 | Ga0207667_100095128 | 106 |
| 69 | 3300025981 | Ga0207640_10067546 | Ga0207640_100675462 | 106 |
| 70 | 3300026067 | Ga0207678_10095803 | Ga0207678_100958035 | 106 |
| 71 | 3300026067 | Ga0207678_10135698 | Ga0207678_101356982 | 106 |
| 72 | 3300026078 | Ga0207702_10469252 | Ga0207702_104692523 | 106 |
| 73 | 3300026088 | Ga0207641_10223302 | Ga0207641_102233022 | 106 |
| 74 | 3300031242 | Ga0265329_10199063 | Ga0265329_101990632 | 106 |
| 75 | 3300031824 | Ga0307413_11021378 | Ga0307413_110213782 | 106 |
| 76 | 3300032004 | Ga0307414_10000030 | Ga0307414_1000003068 | 106 |
| 77 | 3300036401 | Ga0373937_0389148 | Ga0373937_0389148_62_382 | 106 |
| 78 | 3300037312 | Ga0395899_0058629 | Ga0395899_0058629_538_858 | 106 |
| 79 | 3300037418 | Ga0395900_0120911 | Ga0395900_0120911_668_988 | 106 |
| 80 | 3300037418 | Ga0395900_0246809 | Ga0395900_0246809_648_968 | 106 |
| 81 | 3300037466 | Ga0395898_0324719 | Ga0395898_0324719_927_1247 | 106 |
| 82 | 3300037466 | Ga0395898_1154967 | Ga0395898_1154967_220_540 | 106 |
| 83 | 3300038443 | Ga0395901_0163767 | Ga0395901_0163767_681_1001 | 106 |
| 84 | 3300038443 | Ga0395901_0355725 | Ga0395901_0355725_802_1122 | 106 |
| 85 | 3300041453 | Ga0451797_0911949 | Ga0451797_0911949_146_466 | 106 |
| 86 | 3300044712 | Ga0453684_0003647 | Ga0453684_0003647_27631_27951 | 106 |
| 87 | 3300044842 | Ga0466957_0004677 | Ga0466957_0004677_5847_6167 | 106 |
| 88 | 3300046507 | Ga0495606_0045200 | Ga0495606_0045200_1211_1531 | 106 |
| 89 | 3300046513 | Ga0495616_0024831 | Ga0495616_0024831_593_913 | 106 |
| 90 | 3300046522 | Ga0495643_0001477 | Ga0495643_0001477_5421_5741 | 106 |
| 91 | 3300046660 | Ga0495625_0018654 | Ga0495625_0018654_3230_3550 | 106 |
| 92 | 3300049572 | Ga0501036_0988023 | Ga0501036_0988023_206_526 | 106 |
| 93 | 3300049579 | Ga0501043_1091755 | Ga0501043_1091755_159_479 | 106 |
| 94 | 3300049581 | Ga0501047_0031774 | Ga0501047_0031774_1093_1413 | 106 |
| 95 | 3300049582 | Ga0501048_0664545 | Ga0501048_0664545_304_624 | 106 |
| 96 | 3300049822 | Ga0501035_0381353 | Ga0501035_0381353_821_1141 | 106 |
| 97 | 3300049823 | Ga0501044_0084495 | Ga0501044_0084495_509_829 | 106 |
| 98 | 3300002739 | JGI25158J39367_1005388 | JGI25158J39367_10053882 | 107 |
| 99 | 3300005262 | Ga0065165_1005675 | Ga0065165_10056753 | 107 |
| 100 | 3300005288 | Ga0065714_10002191 | Ga0065714_1000219135 | 107 |
| 101 | 3300005290 | Ga0065712_10007293 | Ga0065712_100072932 | 107 |
| 102 | 3300005327 | Ga0070658_10217848 | Ga0070658_102178481 | 107 |
| 103 | 3300005328 | Ga0070676_10032730 | Ga0070676_100327302 | 107 |
| 104 | 3300005331 | Ga0070670_100182275 | Ga0070670_1001822752 | 107 |
| 105 | 3300005334 | Ga0068869_100026622 | Ga0068869_1000266226 | 107 |
| 106 | 3300005335 | Ga0070666_10164448 | Ga0070666_101644482 | 107 |
| 107 | 3300005335 | Ga0070666_11404419 | Ga0070666_114044191 | 107 |
| 108 | 3300005336 | Ga0070680_100111771 | Ga0070680_1001117713 | 107 |
| 109 | 3300005336 | Ga0070680_101586744 | Ga0070680_1015867441 | 107 |
| 110 | 3300005341 | Ga0070691_10599038 | Ga0070691_105990381 | 107 |
| 111 | 3300005344 | Ga0070661_100381551 | Ga0070661_1003815512 | 107 |
| 112 | 3300005347 | Ga0070668_100062448 | Ga0070668_1000624481 | 107 |
| 113 | 3300005353 | Ga0070669_100006925 | Ga0070669_1000069254 | 107 |
| 114 | 3300005356 | Ga0070674_100157002 | Ga0070674_1001570022 | 107 |
| 115 | 3300005364 | Ga0070673_100075535 | Ga0070673_1000755352 | 107 |
| 116 | 3300005365 | Ga0070688_101083531 | Ga0070688_1010835311 | 107 |
| 117 | 3300005367 | Ga0070667_100110951 | Ga0070667_1001109511 | 107 |
| 118 | 3300005367 | Ga0070667_100476405 | Ga0070667_1004764052 | 107 |
| 119 | 3300005455 | Ga0070663_100543730 | Ga0070663_1005437301 | 107 |
| 120 | 3300005456 | Ga0070678_100154315 | Ga0070678_1001543153 | 107 |
| 121 | 3300005456 | Ga0070678_100652897 | Ga0070678_1006528972 | 107 |
| 122 | 3300005458 | Ga0070681_11057099 | Ga0070681_110570992 | 107 |
| 123 | 3300005459 | Ga0068867_100041223 | Ga0068867_1000412235 | 107 |
| 124 | 3300005530 | Ga0070679_100556962 | Ga0070679_1005569621 | 107 |
| 125 | 3300005530 | Ga0070679_101099671 | Ga0070679_1010996711 | 107 |
| 126 | 3300005530 | Ga0070679_101862989 | Ga0070679_1018629892 | 107 |
| 127 | 3300005535 | Ga0070684_101088875 | Ga0070684_1010888752 | 107 |
| 128 | 3300005539 | Ga0068853_100003662 | Ga0068853_10000366211 | 107 |
| 129 | 3300005539 | Ga0068853_100044920 | Ga0068853_1000449203 | 107 |
| 130 | 3300005548 | Ga0070665_100109134 | Ga0070665_1001091341 | 107 |
| 131 | 3300005549 | Ga0070704_100830656 | Ga0070704_1008306561 | 107 |
| 132 | 3300005563 | Ga0068855_100854823 | Ga0068855_1008548232 | 107 |
| 133 | 3300005564 | Ga0070664_100231911 | Ga0070664_1002319113 | 107 |
| 134 | 3300005577 | Ga0068857_101365146 | Ga0068857_1013651461 | 107 |
| 135 | 3300005578 | Ga0068854_100102163 | Ga0068854_1001021634 | 107 |
| 136 | 3300005578 | Ga0068854_100805865 | Ga0068854_1008058652 | 107 |
| 137 | 3300005614 | Ga0068856_100037046 | Ga0068856_1000370469 | 107 |
| 138 | 3300005614 | Ga0068856_101314903 | Ga0068856_1013149032 | 107 |
| 139 | 3300005616 | Ga0068852_100282121 | Ga0068852_1002821212 | 107 |
| 140 | 3300005617 | Ga0068859_100058501 | Ga0068859_1000585012 | 107 |
| 141 | 3300005617 | Ga0068859_100584931 | Ga0068859_1005849313 | 107 |
| 142 | 3300005617 | Ga0068859_100660686 | Ga0068859_1006606862 | 107 |
| 143 | 3300005718 | Ga0068866_10005460 | Ga0068866_100054608 | 107 |
| 144 | 3300005719 | Ga0068861_100295442 | Ga0068861_1002954421 | 107 |
| 145 | 3300005834 | Ga0068851_10822327 | Ga0068851_108223272 | 107 |
| 146 | 3300005841 | Ga0068863_100289769 | Ga0068863_1002897692 | 107 |
| 147 | 3300005841 | Ga0068863_101504337 | Ga0068863_1015043372 | 107 |
| 148 | 3300005843 | Ga0068860_100103240 | Ga0068860_1001032402 | 107 |
| 149 | 3300005843 | Ga0068860_100118639 | Ga0068860_1001186392 | 107 |
| 150 | 3300006237 | Ga0097621_100009866 | Ga0097621_1000098665 | 107 |
| 151 | 3300006237 | Ga0097621_100148823 | Ga0097621_1001488232 | 107 |
| 152 | 3300006237 | Ga0097621_101638812 | Ga0097621_1016388122 | 107 |
| 153 | 3300006358 | Ga0068871_100089131 | Ga0068871_1000891315 | 107 |
| 154 | 3300006871 | Ga0075434_100364893 | Ga0075434_1003648931 | 107 |
| 155 | 3300006881 | Ga0068865_100051819 | Ga0068865_1000518191 | 107 |
| 156 | 3300006931 | Ga0097620_100058501 | Ga0097620_1000585012 | 107 |
| 157 | 3300006931 | Ga0097620_100584848 | Ga0097620_1005848481 | 107 |
| 158 | 3300006931 | Ga0097620_100660664 | Ga0097620_1006606642 | 107 |
| 159 | 3300007265 | Ga0099794_10570051 | Ga0099794_105700511 | 107 |
| 160 | 3300009036 | Ga0105244_10064985 | Ga0105244_100649852 | 107 |
| 161 | 3300009093 | Ga0105240_10286177 | Ga0105240_102861774 | 107 |
| 162 | 3300009093 | Ga0105240_10302501 | Ga0105240_103025012 | 107 |
| 163 | 3300009093 | Ga0105240_12438520 | Ga0105240_124385202 | 107 |
| 164 | 3300009147 | Ga0114129_12839049 | Ga0114129_128390492 | 107 |
| 165 | 3300009174 | Ga0105241_10144426 | Ga0105241_101444263 | 107 |
| 166 | 3300009174 | Ga0105241_10166638 | Ga0105241_101666382 | 107 |
| 167 | 3300009176 | Ga0105242_10196425 | Ga0105242_101964252 | 107 |
| 168 | 3300009177 | Ga0105248_10115803 | Ga0105248_101158034 | 107 |
| 169 | 3300009545 | Ga0105237_10007564 | Ga0105237_1000756417 | 107 |
| 170 | 3300009545 | Ga0105237_10493457 | Ga0105237_104934571 | 107 |
| 171 | 3300009553 | Ga0105249_10828619 | Ga0105249_108286193 | 107 |
| 172 | 3300010375 | Ga0105239_10034268 | Ga0105239_100342688 | 107 |
| 173 | 3300010375 | Ga0105239_10514584 | Ga0105239_105145843 | 107 |
| 174 | 3300013100 | Ga0157373_10000009 | Ga0157373_10000009148 | 107 |
| 175 | 3300013102 | Ga0157371_10047837 | Ga0157371_100478371 | 107 |
| 176 | 3300013102 | Ga0157371_10409188 | Ga0157371_104091883 | 107 |
| 177 | 3300013104 | Ga0157370_10007219 | Ga0157370_1000721910 | 107 |
| 178 | 3300013104 | Ga0157370_10039260 | Ga0157370_100392608 | 107 |
| 179 | 3300013104 | Ga0157370_10043532 | Ga0157370_100435323 | 107 |
| 180 | 3300013104 | Ga0157370_10046015 | Ga0157370_100460152 | 107 |
| 181 | 3300013105 | Ga0157369_10261340 | Ga0157369_102613402 | 107 |
| 182 | 3300013105 | Ga0157369_12272946 | Ga0157369_122729461 | 107 |
| 183 | 3300013296 | Ga0157374_10590353 | Ga0157374_105903532 | 107 |
| 184 | 3300013297 | Ga0157378_10585097 | Ga0157378_105850972 | 107 |
| 185 | 3300013306 | Ga0163162_10111794 | Ga0163162_101117943 | 107 |
| 186 | 3300013307 | Ga0157372_10190160 | Ga0157372_101901603 | 107 |
| 187 | 3300013307 | Ga0157372_10724895 | Ga0157372_107248953 | 107 |
| 188 | 3300013307 | Ga0157372_12630343 | Ga0157372_126303432 | 107 |
| 189 | 3300013308 | Ga0157375_10128297 | Ga0157375_101282972 | 107 |
| 190 | 3300014497 | Ga0182008_10000028 | Ga0182008_1000002848 | 107 |
| 191 | 3300014745 | Ga0157377_10137841 | Ga0157377_101378414 | 107 |
| 192 | 3300014745 | Ga0157377_10437339 | Ga0157377_104373392 | 107 |
| 193 | 3300014968 | Ga0157379_10455460 | Ga0157379_104554603 | 107 |
| 194 | 3300014968 | Ga0157379_10824908 | Ga0157379_108249082 | 107 |
| 195 | 3300014969 | Ga0157376_10757311 | Ga0157376_107573113 | 107 |
| 196 | 3300015265 | Ga0182005_1000249 | Ga0182005_100024910 | 107 |
| 197 | 3300017792 | Ga0163161_10420442 | Ga0163161_104204422 | 107 |
| 198 | 3300025208 | Ga0209436_103083 | Ga0209436_1030834 | 107 |
| 199 | 3300025250 | Ga0209026_1039883 | Ga0209026_10398832 | 107 |
| 200 | 3300025302 | Ga0207426_1004538 | Ga0207426_10045384 | 107 |
| 201 | 3300025321 | Ga0207656_10425900 | Ga0207656_104259002 | 107 |
| 202 | 3300025728 | Ga0207655_1059215 | Ga0207655_10592151 | 107 |
| 203 | 3300025901 | Ga0207688_10012410 | Ga0207688_100124105 | 107 |
| 204 | 3300025901 | Ga0207688_10303099 | Ga0207688_103030992 | 107 |
| 205 | 3300025903 | Ga0207680_10616814 | Ga0207680_106168142 | 107 |
| 206 | 3300025905 | Ga0207685_10623932 | Ga0207685_106239321 | 107 |
| 207 | 3300025907 | Ga0207645_10000979 | Ga0207645_1000097912 | 107 |
| 208 | 3300025909 | Ga0207705_10158482 | Ga0207705_101584821 | 107 |
| 209 | 3300025911 | Ga0207654_10638924 | Ga0207654_106389242 | 107 |
| 210 | 3300025911 | Ga0207654_10825921 | Ga0207654_108259211 | 107 |
| 211 | 3300025912 | Ga0207707_11043320 | Ga0207707_110433202 | 107 |
| 212 | 3300025913 | Ga0207695_10039005 | Ga0207695_100390053 | 107 |
| 213 | 3300025913 | Ga0207695_10205089 | Ga0207695_102050894 | 107 |
| 214 | 3300025914 | Ga0207671_10002560 | Ga0207671_100025604 | 107 |
| 215 | 3300025914 | Ga0207671_10088730 | Ga0207671_100887302 | 107 |
| 216 | 3300025917 | Ga0207660_11315740 | Ga0207660_113157401 | 107 |
| 217 | 3300025920 | Ga0207649_10290145 | Ga0207649_102901451 | 107 |
| 218 | 3300025923 | Ga0207681_10004756 | Ga0207681_1000475610 | 107 |
| 219 | 3300025925 | Ga0207650_10204537 | Ga0207650_102045373 | 107 |
| 220 | 3300025934 | Ga0207686_10249669 | Ga0207686_102496692 | 107 |
| 221 | 3300025937 | Ga0207669_11135877 | Ga0207669_111358771 | 107 |
| 222 | 3300025937 | Ga0207669_11593795 | Ga0207669_115937951 | 107 |
| 223 | 3300025938 | Ga0207704_10031676 | Ga0207704_100316764 | 107 |
| 224 | 3300025942 | Ga0207689_10006030 | Ga0207689_100060305 | 107 |
| 225 | 3300025960 | Ga0207651_10148509 | Ga0207651_101485092 | 107 |
| 226 | 3300025972 | Ga0207668_11134220 | Ga0207668_111342201 | 107 |
| 227 | 3300025981 | Ga0207640_10106841 | Ga0207640_101068414 | 107 |
| 228 | 3300025981 | Ga0207640_10253988 | Ga0207640_102539881 | 107 |
| 229 | 3300025981 | Ga0207640_10539580 | Ga0207640_105395802 | 107 |
| 230 | 3300025981 | Ga0207640_11669962 | Ga0207640_116699621 | 107 |
| 231 | 3300025986 | Ga0207658_10241154 | Ga0207658_102411542 | 107 |
| 232 | 3300026023 | Ga0207677_10013617 | Ga0207677_100136171 | 107 |
| 233 | 3300026023 | Ga0207677_10153668 | Ga0207677_101536681 | 107 |
| 234 | 3300026023 | Ga0207677_10310711 | Ga0207677_103107111 | 107 |
| 235 | 3300026035 | Ga0207703_10048394 | Ga0207703_100483943 | 107 |
| 236 | 3300026041 | Ga0207639_10046777 | Ga0207639_100467771 | 107 |
| 237 | 3300026041 | Ga0207639_10320881 | Ga0207639_103208811 | 107 |
| 238 | 3300026078 | Ga0207702_10024200 | Ga0207702_100242009 | 107 |
| 239 | 3300026078 | Ga0207702_11534337 | Ga0207702_115343372 | 107 |
| 240 | 3300026088 | Ga0207641_10098513 | Ga0207641_100985135 | 107 |
| 241 | 3300026088 | Ga0207641_10260907 | Ga0207641_102609073 | 107 |
| 242 | 3300026089 | Ga0207648_10019703 | Ga0207648_100197034 | 107 |
| 243 | 3300026116 | Ga0207674_10108424 | Ga0207674_101084242 | 107 |
| 244 | 3300026118 | Ga0207675_100238465 | Ga0207675_1002384654 | 107 |
| 245 | 3300026121 | Ga0207683_10004452 | Ga0207683_1000445213 | 107 |
| 246 | 3300026121 | Ga0207683_10478263 | Ga0207683_104782632 | 107 |
| 247 | 3300026142 | Ga0207698_10362481 | Ga0207698_103624812 | 107 |
| 248 | 3300027471 | Ga0209995_1005758 | Ga0209995_10057582 | 107 |
| 249 | 3300027526 | Ga0209968_1083410 | Ga0209968_10834101 | 107 |
| 250 | 3300028558 | Ga0265326_10027707 | Ga0265326_100277073 | 107 |
| 251 | 3300028573 | Ga0265334_10038089 | Ga0265334_100380893 | 107 |
| 252 | 3300028654 | Ga0265322_10003883 | Ga0265322_100038835 | 107 |
| 253 | 3300028800 | Ga0265338_10014152 | Ga0265338_100141527 | 107 |
| 254 | 3300029957 | Ga0265324_10018782 | Ga0265324_100187825 | 107 |
| 255 | 3300031241 | Ga0265325_10019872 | Ga0265325_100198725 | 107 |
| 256 | 3300031247 | Ga0265340_10021382 | Ga0265340_100213822 | 107 |
| 257 | 3300031548 | Ga0307408_100119510 | Ga0307408_1001195103 | 107 |
| 258 | 3300031731 | Ga0307405_10377608 | Ga0307405_103776082 | 107 |
| 259 | 3300031852 | Ga0307410_11284448 | Ga0307410_112844481 | 107 |
| 260 | 3300031889 | Ga0326468_10108532 | Ga0326468_101085321 | 107 |
| 261 | 3300031911 | Ga0307412_10094988 | Ga0307412_100949884 | 107 |
| 262 | 3300032004 | Ga0307414_10202749 | Ga0307414_102027491 | 107 |
| 263 | 3300032004 | Ga0307414_10618400 | Ga0307414_106184002 | 107 |
| 264 | 3300032004 | Ga0307414_10859666 | Ga0307414_108596661 | 107 |
| 265 | 3300032004 | Ga0307414_11753972 | Ga0307414_117539721 | 107 |
| 266 | 3300035086 | Ga0373934_0354958 | Ga0373934_0354958_133_456 | 107 |
| 267 | 3300035089 | Ga0373944_0193194 | Ga0373944_0193194_283_606 | 107 |
| 268 | 3300035170 | Ga0373943_0474047 | Ga0373943_0474047_150_473 | 107 |
| 269 | 3300035692 | Ga0373935_0214496 | Ga0373935_0214496_318_641 | 107 |
| 270 | 3300036401 | Ga0373937_0040237 | Ga0373937_0040237_2529_2852 | 107 |
| 271 | 3300037068 | Ga0373925_0758781 | Ga0373925_0758781_216_539 | 107 |
| 272 | 3300037466 | Ga0395898_0469843 | Ga0395898_0469843_70_393 | 107 |
| 273 | 3300037471 | Ga0395905_0610945 | Ga0395905_0610945_586_909 | 107 |
| 274 | 3300039447 | Ga0436361_1076984 | Ga0436361_1076984_143_466 | 107 |
| 275 | 3300041460 | Ga0451802_0311974 | Ga0451802_0311974_16_339 | 107 |
| 276 | 3300041498 | Ga0451841_0043835 | Ga0451841_0043835_43_366 | 107 |
| 277 | 3300041498 | Ga0451841_0990982 | Ga0451841_0990982_79_402 | 107 |
| 278 | 3300041512 | Ga0451853_3166572 | Ga0451853_3166572_75_398 | 107 |
| 279 | 3300041512 | Ga0451853_3466682 | Ga0451853_3466682_130_453 | 107 |
| 280 | 3300044712 | Ga0453684_0021779 | Ga0453684_0021779_1942_2304 | 107 |
| 281 | 3300045051 | Ga0451576_0019704 | Ga0451576_0019704_5663_6025 | 107 |
| 282 | 3300046492 | Ga0495585_0000323 | Ga0495585_0000323_30343_30666 | 107 |
| 283 | 3300046524 | Ga0495648_0006718 | Ga0495648_0006718_4244_4567 | 107 |
| 284 | 3300046529 | Ga0495652_0473652 | Ga0495652_0473652_362_685 | 107 |
| 285 | 3300046530 | Ga0495654_0081705 | Ga0495654_0081705_608_931 | 107 |
| 286 | 3300046538 | Ga0495609_0008096 | Ga0495609_0008096_2920_3243 | 107 |
| 287 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_242711_243034 | 107 |
| 288 | 3300046660 | Ga0495625_0000239 | Ga0495625_0000239_69986_70309 | 107 |
| 289 | 3300046660 | Ga0495625_0000462 | Ga0495625_0000462_47371_47694 | 107 |
| 290 | 3300046683 | Ga0495658_0126432 | Ga0495658_0126432_1166_1489 | 107 |
| 291 | 3300046691 | Ga0495670_0398946 | Ga0495670_0398946_199_522 | 107 |
| 292 | 3300047315 | Ga0495581_0470585 | Ga0495581_0470585_177_500 | 107 |
| 293 | 3300047472 | Ga0495686_0001041 | Ga0495686_0001041_29905_30228 | 107 |
| 294 | 3300047472 | Ga0495686_0668091 | Ga0495686_0668091_127_450 | 107 |
| 295 | 3300048089 | Ga0495614_0098173 | Ga0495614_0098173_282_605 | 107 |
| 296 | 3300048909 | Ga0496106_1026817 | Ga0496106_1026817_279_602 | 107 |
| 297 | 3300048917 | Ga0496114_0164957 | Ga0496114_0164957_582_905 | 107 |
| 298 | 3300049460 | Ga0495682_0019380 | Ga0495682_0019380_1615_1938 | 107 |
| 299 | 3300049521 | Ga0501298_200395 | Ga0501298_200395_127_450 | 107 |
| 300 | 3300049570 | Ga0501033_0450479 | Ga0501033_0450479_489_812 | 107 |
| 301 | 3300049571 | Ga0501034_0002741 | Ga0501034_0002741_17931_18254 | 107 |
| 302 | 3300049571 | Ga0501034_0008801 | Ga0501034_0008801_8214_8537 | 107 |
| 303 | 3300049572 | Ga0501036_0423633 | Ga0501036_0423633_39_362 | 107 |
| 304 | 3300049573 | Ga0501037_0122121 | Ga0501037_0122121_1395_1718 | 107 |
| 305 | 3300049574 | Ga0501038_0102608 | Ga0501038_0102608_1694_2017 | 107 |
| 306 | 3300049579 | Ga0501043_1248192 | Ga0501043_1248192_86_409 | 107 |
| 307 | 3300049579 | Ga0501043_1272648 | Ga0501043_1272648_23_346 | 107 |
| 308 | 3300049581 | Ga0501047_1402718 | Ga0501047_1402718_161_484 | 107 |
| 309 | 3300049582 | Ga0501048_1186876 | Ga0501048_1186876_160_483 | 107 |
| 310 | 3300049587 | Ga0501071_0737541 | Ga0501071_0737541_269_592 | 107 |
| 311 | 3300049590 | Ga0501074_1252100 | Ga0501074_1252100_79_402 | 107 |
| 312 | 3300049650 | Ga0501199_070021 | Ga0501199_070021_152_475 | 107 |
| 313 | 3300049663 | Ga0501223_005878 | Ga0501223_005878_819_1142 | 107 |
| 314 | 3300049663 | Ga0501223_029772 | Ga0501223_029772_729_1052 | 107 |
| 315 | 3300049680 | Ga0501250_098742 | Ga0501250_098742_82_405 | 107 |
| 316 | 3300049686 | Ga0501257_009406 | Ga0501257_009406_1579_1902 | 107 |
| 317 | 3300049742 | Ga0501080_0391991 | Ga0501080_0391991_489_812 | 107 |
| 318 | 3300049761 | Ga0501264_002228 | Ga0501264_002228_12_335 | 107 |
| 319 | 3300049823 | Ga0501044_0008254 | Ga0501044_0008254_9760_10083 | 107 |
| 320 | 3300049823 | Ga0501044_0052053 | Ga0501044_0052053_2227_2550 | 107 |
| 321 | 3300049823 | Ga0501044_0116673 | Ga0501044_0116673_788_1111 | 107 |
| 322 | 3300050512 | nmdc:mga0n895_108043_c1 | nmdc:mga0n895_108043_c1_1896_2219 | 107 |
| 323 | 3300053123 | Ga0500614_066287 | Ga0500614_066287_359_682 | 107 |
| 324 | 3300053129 | Ga0500628_122645 | Ga0500628_122645_127_450 | 107 |
| 325 | 3300053139 | Ga0500568_0006445 | Ga0500568_0006445_2528_2851 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cuq-assembly1.cif.gz_B | integrated structural and functional model of the human escrt-ii complex | 0.9148 | 15 | 71 |
| 8iuh-assembly1.cif.gz_P | rna polymerase iii pre-initiation complex open complex 1 | 0.9088 | 15 | 72 |
| 2zme-assembly1.cif.gz_B | integrated structural and functional model of the human escrt-ii complex | 0.9066 | 16 | 71 |
| 3irq-assembly1.cif.gz_D | crystal structure of a z-z junction | 0.906 | 13 | 70 |
| 1r22-assembly1.cif.gz_B | crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form | 0.9058 | 8 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9646 | 13 | 69 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9544 | 13 | 76 | 1.10.10.10 |
| 3tgnA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.951 | 13 | 71 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9311 | 9 | 70 | 1.10.10.10 |
| af_Q69XJ1_51_114_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9296 | 13 | 69 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N4EDV7-F1-model_v4 | deleted | 0.9696 | 1 | 78 |
|
| AF-A0A4R2XX57-F1-model_v4 | deleted | 0.965 | 9 | 75 |
|
| AF-A0A350I916-F1-model_v4 | Transcriptional regulator | 0.963 | 7 | 83 |
GO:0003700
GO:0005737 |
| AF-A0A511MXX2-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9605 | 8 | 75 |
GO:0003700
|
| AF-A0A2U3CU02-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9536 | 8 | 78 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar