F407124
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 217 | 320 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_994496_c1|nmdc:mga05p37_994496_c1_130_516 |
| Length | 128 |
| Sequence | VEAAVGRFATQCTAAAEHFMKMTDIPFGTTDWSTIEPTEHAGDAGFAYWRTRNFGSIRVRMVEYTPGYIANHWCSKGHILFCIEGELHTELEDGRQFVLRPGMSYQVADNAEPHRSSTERGARLFIVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 2 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 3 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 173 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 191 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 192 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 193 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 194 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 205 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 208 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0 |
| Rhizoplane | 3.1 |
| Rhizosphere | 90.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c024108 | 3300000043 | Bacteria | 520 |
| 2 | JGI25157J39369_1000938 | 3300002741 | Bacteria | 13774 |
| 3 | Ga0065714_10101447 | 3300005288 | Bacteria | 1635 |
| 4 | Ga0065712_10076927 | 3300005290 | Bacteria | 3578 |
| 5 | Ga0065715_10216980 | 3300005293 | Bacteria | 1288 |
| 6 | Ga0070690_100015899 | 3300005330 | Bacteria | 4497 |
| 7 | Ga0070670_100055472 | 3300005331 | Bacteria | 3401 |
| 8 | Ga0070670_100063263 | 3300005331 | Bacteria | 3176 |
| 9 | Ga0068869_100004112 | 3300005334 | Bacteria | 9018 |
| 10 | Ga0068869_100020524 | 3300005334 | Bacteria | 4531 |
| 11 | Ga0068869_100572450 | 3300005334 | Unclassified | 951 |
| 12 | Ga0070666_10000008 | 3300005335 | Bacteria | 293415 |
| 13 | Ga0070666_10104158 | 3300005335 | Bacteria | 1958 |
| 14 | Ga0070666_11519760 | 3300005335 | Bacteria | 501 |
| 15 | Ga0070682_100080791 | 3300005337 | Bacteria | 2103 |
| 16 | Ga0068868_100026500 | 3300005338 | Bacteria | 4419 |
| 17 | Ga0068868_100117879 | 3300005338 | Bacteria | 2163 |
| 18 | Ga0068868_100723444 | 3300005338 | Bacteria | 892 |
| 19 | Ga0070660_100475247 | 3300005339 | Bacteria | 1038 |
| 20 | Ga0070689_100001609 | 3300005340 | Bacteria | 14410 |
| 21 | Ga0070689_100462196 | 3300005340 | Bacteria | 1081 |
| 22 | Ga0070691_10580120 | 3300005341 | Bacteria | 659 |
| 23 | Ga0070687_100341335 | 3300005343 | Bacteria | 964 |
| 24 | Ga0070661_100026498 | 3300005344 | Bacteria | 4170 |
| 25 | Ga0070692_10143948 | 3300005345 | Bacteria | 1352 |
| 26 | Ga0070692_10290841 | 3300005345 | Unclassified | 994 |
| 27 | Ga0070668_100111749 | 3300005347 | Bacteria | 2175 |
| 28 | Ga0070668_100608018 | 3300005347 | Bacteria | 957 |
| 29 | Ga0070669_100023949 | 3300005353 | Bacteria | 4374 |
| 30 | Ga0070669_100052643 | 3300005353 | Bacteria | 2979 |
| 31 | Ga0070675_100000934 | 3300005354 | Bacteria | 20807 |
| 32 | Ga0070675_100097014 | 3300005354 | Bacteria | 2478 |
| 33 | Ga0070675_100266208 | 3300005354 | Bacteria | 1503 |
| 34 | Ga0070674_101926252 | 3300005356 | Bacteria | 537 |
| 35 | Ga0070673_100284004 | 3300005364 | Bacteria | 1452 |
| 36 | Ga0070688_100233501 | 3300005365 | Bacteria | 1302 |
| 37 | Ga0070688_100359398 | 3300005365 | Bacteria | 1068 |
| 38 | Ga0070659_100010774 | 3300005366 | Bacteria | 6741 |
| 39 | Ga0070667_100153157 | 3300005367 | Bacteria | 2027 |
| 40 | Ga0070714_100083194 | 3300005435 | Bacteria | 2790 |
| 41 | Ga0070713_100004662 | 3300005436 | Bacteria | 9252 |
| 42 | Ga0070710_10448106 | 3300005437 | Bacteria | 874 |
| 43 | Ga0070701_10015634 | 3300005438 | Bacteria | 3510 |
| 44 | Ga0070711_100092759 | 3300005439 | Bacteria | 2179 |
| 45 | Ga0070711_100217764 | 3300005439 | Bacteria | 1482 |
| 46 | Ga0070705_100005995 | 3300005440 | Bacteria | 5944 |
| 47 | Ga0070700_100265908 | 3300005441 | Bacteria | 1237 |
| 48 | Ga0070694_100015502 | 3300005444 | Bacteria | 4789 |
| 49 | Ga0070694_100284728 | 3300005444 | Bacteria | 1261 |
| 50 | Ga0070663_100075721 | 3300005455 | Bacteria | 2460 |
| 51 | Ga0070678_100359123 | 3300005456 | Bacteria | 1255 |
| 52 | Ga0070678_102246534 | 3300005456 | Bacteria | 518 |
| 53 | Ga0070678_102365167 | 3300005456 | Bacteria | 504 |
| 54 | Ga0070662_100116934 | 3300005457 | Bacteria | 2039 |
| 55 | Ga0070685_10030138 | 3300005466 | Bacteria | 3020 |
| 56 | Ga0070706_100039819 | 3300005467 | Bacteria | 4338 |
| 57 | Ga0070707_100364157 | 3300005468 | Bacteria | 1404 |
| 58 | Ga0070679_101956804 | 3300005530 | Bacteria | 535 |
| 59 | Ga0070684_100004485 | 3300005535 | Bacteria | 10627 |
| 60 | Ga0068853_100229974 | 3300005539 | Bacteria | 1696 |
| 61 | Ga0068853_100553445 | 3300005539 | Bacteria | 1090 |
| 62 | Ga0070672_100013555 | 3300005543 | Bacteria | 5762 |
| 63 | Ga0070672_100231630 | 3300005543 | Bacteria | 1552 |
| 64 | Ga0070686_100004993 | 3300005544 | Bacteria | 7321 |
| 65 | Ga0070686_101919937 | 3300005544 | Bacteria | 506 |
| 66 | Ga0070695_100499526 | 3300005545 | Unclassified | 940 |
| 67 | Ga0070693_100216791 | 3300005547 | Bacteria | 1252 |
| 68 | Ga0070665_100156992 | 3300005548 | Bacteria | 2277 |
| 69 | Ga0070664_100049332 | 3300005564 | Bacteria | 3560 |
| 70 | Ga0068857_101195895 | 3300005577 | Bacteria | 736 |
| 71 | Ga0068854_102061564 | 3300005578 | Bacteria | 526 |
| 72 | Ga0068856_100003391 | 3300005614 | Bacteria | 16130 |
| 73 | Ga0070702_100008624 | 3300005615 | Bacteria | 4947 |
| 74 | Ga0070702_100289285 | 3300005615 | Bacteria | 1128 |
| 75 | Ga0068852_102316939 | 3300005616 | Bacteria | 558 |
| 76 | Ga0068859_100032933 | 3300005617 | Bacteria | 5206 |
| 77 | Ga0068859_100048820 | 3300005617 | Bacteria | 4252 |
| 78 | Ga0068864_100022145 | 3300005618 | Bacteria | 5327 |
| 79 | Ga0068864_101356650 | 3300005618 | Bacteria | 712 |
| 80 | Ga0068866_10160552 | 3300005718 | Bacteria | 1310 |
| 81 | Ga0068861_100014100 | 3300005719 | Bacteria | 5604 |
| 82 | Ga0068861_100055480 | 3300005719 | Bacteria | 3021 |
| 83 | Ga0068861_100241025 | 3300005719 | Bacteria | 1538 |
| 84 | Ga0068863_100144668 | 3300005841 | Bacteria | 2273 |
| 85 | Ga0068858_100040312 | 3300005842 | Bacteria | 4330 |
| 86 | Ga0068858_100106146 | 3300005842 | Bacteria | 2622 |
| 87 | Ga0068860_100032207 | 3300005843 | Bacteria | 5039 |
| 88 | Ga0068860_100033255 | 3300005843 | Bacteria | 4949 |
| 89 | Ga0068860_100092724 | 3300005843 | Bacteria | 2878 |
| 90 | Ga0068862_100002858 | 3300005844 | Bacteria | 15133 |
| 91 | Ga0068862_100048049 | 3300005844 | Bacteria | 3643 |
| 92 | Ga0075427_10114692 | 3300006194 | Bacteria | 509 |
| 93 | Ga0097621_102235925 | 3300006237 | Bacteria | 523 |
| 94 | Ga0068871_100079094 | 3300006358 | Bacteria | 2720 |
| 95 | Ga0068871_102379656 | 3300006358 | Bacteria | 505 |
| 96 | Ga0075428_100193009 | 3300006844 | Bacteria | 2203 |
| 97 | Ga0075428_100207896 | 3300006844 | Bacteria | 2115 |
| 98 | Ga0075430_100018627 | 3300006846 | Bacteria | 5908 |
| 99 | Ga0075430_100080136 | 3300006846 | Bacteria | 2735 |
| 100 | Ga0075430_100692615 | 3300006846 | Bacteria | 840 |
| 101 | Ga0075431_100023046 | 3300006847 | Bacteria | 6365 |
| 102 | Ga0075431_100477747 | 3300006847 | Bacteria | 1239 |
| 103 | Ga0075433_10534622 | 3300006852 | Bacteria | 1031 |
| 104 | Ga0075434_100475278 | 3300006871 | Bacteria | 1271 |
| 105 | Ga0075429_100011953 | 3300006880 | Bacteria | 7526 |
| 106 | Ga0075429_101551999 | 3300006880 | Bacteria | 576 |
| 107 | Ga0068865_100682616 | 3300006881 | Bacteria | 876 |
| 108 | Ga0068865_101758482 | 3300006881 | Bacteria | 560 |
| 109 | Ga0068865_101855161 | 3300006881 | Bacteria | 545 |
| 110 | Ga0097620_100032933 | 3300006931 | Bacteria | 5206 |
| 111 | Ga0097620_100048820 | 3300006931 | Bacteria | 4252 |
| 112 | Ga0105250_10154848 | 3300009092 | Bacteria | 955 |
| 113 | Ga0105240_10001334 | 3300009093 | Bacteria | 42438 |
| 114 | Ga0105240_10480048 | 3300009093 | Bacteria | 1386 |
| 115 | Ga0105240_10834641 | 3300009093 | Bacteria | 996 |
| 116 | Ga0111539_10153743 | 3300009094 | Bacteria | 2692 |
| 117 | Ga0111539_10881511 | 3300009094 | Bacteria | 1041 |
| 118 | Ga0111539_12872708 | 3300009094 | Bacteria | 558 |
| 119 | Ga0105245_10393550 | 3300009098 | Bacteria | 1383 |
| 120 | Ga0105245_10423357 | 3300009098 | Bacteria | 1335 |
| 121 | Ga0105247_10025956 | 3300009101 | Bacteria | 3536 |
| 122 | Ga0105247_10364896 | 3300009101 | Bacteria | 1019 |
| 123 | Ga0105247_11627568 | 3300009101 | Bacteria | 531 |
| 124 | Ga0114129_10011568 | 3300009147 | Bacteria | 12565 |
| 125 | Ga0114129_10603221 | 3300009147 | Bacteria | 1422 |
| 126 | Ga0105243_10021344 | 3300009148 | Bacteria | 4915 |
| 127 | Ga0105241_10500890 | 3300009174 | Unclassified | 1083 |
| 128 | Ga0105242_10267372 | 3300009176 | Bacteria | 1547 |
| 129 | Ga0105242_10438473 | 3300009176 | Bacteria | 1228 |
| 130 | Ga0105248_10019723 | 3300009177 | Bacteria | 7465 |
| 131 | Ga0105248_10290319 | 3300009177 | Bacteria | 1842 |
| 132 | Ga0105248_10403251 | 3300009177 | Bacteria | 1540 |
| 133 | Ga0105237_10062232 | 3300009545 | Bacteria | 3732 |
| 134 | Ga0105237_10305069 | 3300009545 | Bacteria | 1595 |
| 135 | Ga0105238_10000576 | 3300009551 | Bacteria | 38530 |
| 136 | Ga0105238_10349572 | 3300009551 | Bacteria | 1467 |
| 137 | Ga0105238_10895977 | 3300009551 | Bacteria | 905 |
| 138 | Ga0105249_10015667 | 3300009553 | Bacteria | 6712 |
| 139 | Ga0105249_11084539 | 3300009553 | Bacteria | 871 |
| 140 | Ga0105239_10010078 | 3300010375 | Bacteria | 10593 |
| 141 | Ga0105239_10894965 | 3300010375 | Bacteria | 1019 |
| 142 | Ga0157371_11397350 | 3300013102 | Bacteria | 544 |
| 143 | Ga0157370_10023824 | 3300013104 | Bacteria | 6073 |
| 144 | Ga0157370_10101637 | 3300013104 | Bacteria | 2693 |
| 145 | Ga0157370_11859006 | 3300013104 | Unclassified | 540 |
| 146 | Ga0157369_10811432 | 3300013105 | Bacteria | 961 |
| 147 | Ga0157374_10066426 | 3300013296 | Bacteria | 3389 |
| 148 | Ga0157378_10242192 | 3300013297 | Bacteria | 1723 |
| 149 | Ga0163162_10002160 | 3300013306 | Bacteria | 18447 |
| 150 | Ga0163162_10017958 | 3300013306 | Bacteria | 6922 |
| 151 | Ga0163162_12658773 | 3300013306 | Bacteria | 576 |
| 152 | Ga0157375_10046838 | 3300013308 | Bacteria | 4219 |
| 153 | Ga0157375_10213723 | 3300013308 | Bacteria | 2086 |
| 154 | Ga0157375_10835317 | 3300013308 | Bacteria | 1068 |
| 155 | Ga0163163_10000787 | 3300014325 | Bacteria | 26884 |
| 156 | Ga0163163_10450212 | 3300014325 | Bacteria | 1348 |
| 157 | Ga0163163_12151032 | 3300014325 | Bacteria | 617 |
| 158 | Ga0182008_10017459 | 3300014497 | Bacteria | 3723 |
| 159 | Ga0157377_10000749 | 3300014745 | Bacteria | 13459 |
| 160 | Ga0157379_10519736 | 3300014968 | Bacteria | 1105 |
| 161 | Ga0157376_10163892 | 3300014969 | Bacteria | 2018 |
| 162 | Ga0157376_10504704 | 3300014969 | Bacteria | 1189 |
| 163 | Ga0157376_10816483 | 3300014969 | Bacteria | 946 |
| 164 | Ga0182007_10006487 | 3300015262 | Bacteria | 5019 |
| 165 | Ga0163161_10037712 | 3300017792 | Bacteria | 3465 |
| 166 | Ga0163161_10875537 | 3300017792 | Bacteria | 759 |
| 167 | Ga0209674_101759 | 3300025226 | Bacteria | 5259 |
| 168 | Ga0209258_104774 | 3300025242 | Bacteria | 2468 |
| 169 | Ga0209026_1000113 | 3300025250 | Bacteria | 139047 |
| 170 | Ga0209759_1010624 | 3300025256 | Bacteria | 2686 |
| 171 | Ga0207692_10084687 | 3300025898 | Bacteria | 1704 |
| 172 | Ga0207642_10229310 | 3300025899 | Bacteria | 1042 |
| 173 | Ga0207710_10203700 | 3300025900 | Bacteria | 978 |
| 174 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 175 | Ga0207680_10093726 | 3300025903 | Bacteria | 1916 |
| 176 | Ga0207684_10136720 | 3300025910 | Bacteria | 2105 |
| 177 | Ga0207654_10295762 | 3300025911 | Unclassified | 1099 |
| 178 | Ga0207695_10003395 | 3300025913 | Bacteria | 22500 |
| 179 | Ga0207695_10225427 | 3300025913 | Bacteria | 1780 |
| 180 | Ga0207693_11273194 | 3300025915 | Unclassified | 551 |
| 181 | Ga0207663_10256200 | 3300025916 | Bacteria | 1290 |
| 182 | Ga0207660_10297109 | 3300025917 | Bacteria | 1285 |
| 183 | Ga0207662_10012621 | 3300025918 | Bacteria | 4708 |
| 184 | Ga0207662_10030051 | 3300025918 | Bacteria | 3151 |
| 185 | Ga0207657_10555889 | 3300025919 | Bacteria | 897 |
| 186 | Ga0207649_10037489 | 3300025920 | Bacteria | 2928 |
| 187 | Ga0207649_11209409 | 3300025920 | Bacteria | 597 |
| 188 | Ga0207681_10300260 | 3300025923 | Bacteria | 1270 |
| 189 | Ga0207694_10122079 | 3300025924 | Bacteria | 2081 |
| 190 | Ga0207650_10015205 | 3300025925 | Bacteria | 5356 |
| 191 | Ga0207650_10785487 | 3300025925 | Bacteria | 807 |
| 192 | Ga0207659_10125826 | 3300025926 | Bacteria | 1971 |
| 193 | Ga0207659_10151167 | 3300025926 | Bacteria | 1813 |
| 194 | Ga0207700_10012298 | 3300025928 | Bacteria | 5511 |
| 195 | Ga0207690_10018142 | 3300025932 | Bacteria | 4312 |
| 196 | Ga0207706_10117157 | 3300025933 | Bacteria | 2343 |
| 197 | Ga0207709_10160702 | 3300025935 | Bacteria | 1566 |
| 198 | Ga0207670_10037558 | 3300025936 | Bacteria | 3157 |
| 199 | Ga0207670_10580535 | 3300025936 | Bacteria | 919 |
| 200 | Ga0207670_11422142 | 3300025936 | Bacteria | 589 |
| 201 | Ga0207669_10609526 | 3300025937 | Bacteria | 888 |
| 202 | Ga0207704_10014004 | 3300025938 | Bacteria | 4037 |
| 203 | Ga0207691_10015433 | 3300025940 | Bacteria | 7266 |
| 204 | Ga0207711_10005371 | 3300025941 | Bacteria | 10850 |
| 205 | Ga0207711_10077845 | 3300025941 | Bacteria | 2892 |
| 206 | Ga0207711_10279668 | 3300025941 | Bacteria | 1537 |
| 207 | Ga0207689_10030153 | 3300025942 | Bacteria | 4520 |
| 208 | Ga0207679_10056910 | 3300025945 | Bacteria | 2890 |
| 209 | Ga0207651_10024204 | 3300025960 | Bacteria | 3751 |
| 210 | Ga0207712_10002562 | 3300025961 | Bacteria | 11682 |
| 211 | Ga0207668_10017734 | 3300025972 | Bacteria | 4467 |
| 212 | Ga0207668_10075919 | 3300025972 | Bacteria | 2418 |
| 213 | Ga0207640_11898566 | 3300025981 | Bacteria | 539 |
| 214 | Ga0207658_10328190 | 3300025986 | Bacteria | 1326 |
| 215 | Ga0207677_10125814 | 3300026023 | Bacteria | 1937 |
| 216 | Ga0207677_10491349 | 3300026023 | Bacteria | 1059 |
| 217 | Ga0207703_10028523 | 3300026035 | Bacteria | 4401 |
| 218 | Ga0207703_10088214 | 3300026035 | Bacteria | 2603 |
| 219 | Ga0207639_10071629 | 3300026041 | Bacteria | 2712 |
| 220 | Ga0207639_10225093 | 3300026041 | Bacteria | 1622 |
| 221 | Ga0207678_10475733 | 3300026067 | Bacteria | 1088 |
| 222 | Ga0207678_10476715 | 3300026067 | Bacteria | 1086 |
| 223 | Ga0207708_10038243 | 3300026075 | Bacteria | 3655 |
| 224 | Ga0207702_10519409 | 3300026078 | Bacteria | 1162 |
| 225 | Ga0207641_10065008 | 3300026088 | Bacteria | 3119 |
| 226 | Ga0207648_10007695 | 3300026089 | Bacteria | 10541 |
| 227 | Ga0207676_10038607 | 3300026095 | Bacteria | 3646 |
| 228 | Ga0207674_10019603 | 3300026116 | Bacteria | 7323 |
| 229 | Ga0207674_10436319 | 3300026116 | Bacteria | 1266 |
| 230 | Ga0207675_100029635 | 3300026118 | Bacteria | 5097 |
| 231 | Ga0207675_100885636 | 3300026118 | Bacteria | 908 |
| 232 | Ga0207675_101657914 | 3300026118 | Bacteria | 660 |
| 233 | Ga0207683_10522940 | 3300026121 | Bacteria | 1096 |
| 234 | Ga0207683_10550847 | 3300026121 | Bacteria | 1066 |
| 235 | Ga0207683_12167365 | 3300026121 | Bacteria | 504 |
| 236 | Ga0268266_11139736 | 3300028379 | Bacteria | 754 |
| 237 | Ga0268265_10006042 | 3300028380 | Bacteria | 8230 |
| 238 | Ga0268265_10008291 | 3300028380 | Bacteria | 7020 |
| 239 | Ga0268264_10019237 | 3300028381 | Bacteria | 5582 |
| 240 | Ga0268264_10131421 | 3300028381 | Bacteria | 2220 |
| 241 | Ga0316182_1251408 | 3300030745 | Bacteria | 1267 |
| 242 | Ga0307408_100003879 | 3300031548 | Bacteria | 10180 |
| 243 | Ga0307408_100004186 | 3300031548 | Bacteria | 9835 |
| 244 | Ga0307405_10316618 | 3300031731 | Bacteria | 1190 |
| 245 | Ga0307405_10974900 | 3300031731 | Bacteria | 722 |
| 246 | Ga0307413_10477187 | 3300031824 | Bacteria | 996 |
| 247 | Ga0307406_10384914 | 3300031901 | Bacteria | 1107 |
| 248 | Ga0307406_10559708 | 3300031901 | Bacteria | 937 |
| 249 | Ga0307416_100029934 | 3300032002 | Bacteria | 4077 |
| 250 | Ga0307415_100451815 | 3300032126 | Bacteria | 1111 |
| 251 | Ga0307510_10000038 | 3300033180 | Bacteria | 106256 |
| 252 | Ga0373932_0382623 | 3300035112 | Bacteria | 541 |
| 253 | Ga0373946_0252657 | 3300035171 | Bacteria | 860 |
| 254 | Ga0373931_0128994 | 3300035691 | Bacteria | 1453 |
| 255 | Ga0373937_0982029 | 3300036401 | Bacteria | 793 |
| 256 | Ga0316584_1178113 | 3300036712 | Unclassified | 506 |
| 257 | Ga0373925_0013296 | 3300037068 | Bacteria | 5958 |
| 258 | Ga0395901_0202973 | 3300038443 | Bacteria | 2078 |
| 259 | Ga0436361_0352795 | 3300039447 | Bacteria | 1707 |
| 260 | Ga0439442_043567 | 3300042002 | Bacteria | 945 |
| 261 | Ga0439440_0053605 | 3300042993 | Bacteria | 1014 |
| 262 | Ga0466969_0017783 | 3300044656 | Bacteria | 3709 |
| 263 | Ga0466966_0043485 | 3300044684 | Bacteria | 2879 |
| 264 | Ga0466966_0488152 | 3300044684 | Bacteria | 741 |
| 265 | Ga0453684_0549265 | 3300044712 | Bacteria | 1273 |
| 266 | Ga0451576_0394157 | 3300045051 | Bacteria | 1451 |
| 267 | Ga0451576_0550258 | 3300045051 | Bacteria | 1212 |
| 268 | Ga0495580_0738742 | 3300046472 | Bacteria | 642 |
| 269 | Ga0495654_0000198 | 3300046530 | Bacteria | 58451 |
| 270 | Ga0495609_0396073 | 3300046538 | Bacteria | 553 |
| 271 | Ga0495633_0001416 | 3300046558 | Bacteria | 18679 |
| 272 | Ga0495588_0447472 | 3300046674 | Bacteria | 678 |
| 273 | Ga0496102_0116703 | 3300048905 | Bacteria | 2491 |
| 274 | Ga0496104_0094467 | 3300048907 | Unclassified | 2861 |
| 275 | Ga0496104_0603468 | 3300048907 | Bacteria | 1008 |
| 276 | Ga0496104_1047389 | 3300048907 | Bacteria | 720 |
| 277 | Ga0496105_0522455 | 3300048908 | Bacteria | 930 |
| 278 | Ga0496106_0256375 | 3300048909 | Bacteria | 1399 |
| 279 | Ga0496108_0438345 | 3300048911 | Bacteria | 1141 |
| 280 | Ga0496108_0456062 | 3300048911 | Bacteria | 1117 |
| 281 | Ga0496113_0504990 | 3300048916 | Bacteria | 971 |
| 282 | Ga0496115_0627807 | 3300048918 | Bacteria | 852 |
| 283 | Ga0496116_0005022 | 3300048919 | Bacteria | 12461 |
| 284 | Ga0496117_0062758 | 3300048920 | Bacteria | 2544 |
| 285 | Ga0496118_0004248 | 3300048921 | Bacteria | 17157 |
| 286 | Ga0496118_0046026 | 3300048921 | Bacteria | 3399 |
| 287 | Ga0496119_0005821 | 3300048922 | Bacteria | 11652 |
| 288 | Ga0496120_0001965 | 3300048923 | Bacteria | 22470 |
| 289 | Ga0496121_0461551 | 3300048924 | Bacteria | 816 |
| 290 | Ga0496121_0705382 | 3300048924 | Bacteria | 606 |
| 291 | Ga0496123_0007834 | 3300048926 | Bacteria | 9941 |
| 292 | Ga0496124_0227159 | 3300048927 | Bacteria | 1398 |
| 293 | Ga0496125_0000241 | 3300048928 | Bacteria | 112044 |
| 294 | Ga0501034_0042817 | 3300049571 | Bacteria | 4584 |
| 295 | Ga0501040_0643821 | 3300049576 | Bacteria | 766 |
| 296 | Ga0501047_0040308 | 3300049581 | Bacteria | 4517 |
| 297 | Ga0501070_0879250 | 3300049586 | Bacteria | 700 |
| 298 | Ga0501072_1089913 | 3300049588 | Bacteria | 621 |
| 299 | Ga0501249_017460 | 3300049679 | Bacteria | 1546 |
| 300 | Ga0501080_0486120 | 3300049742 | Bacteria | 1104 |
| 301 | Ga0501081_1024069 | 3300049743 | Bacteria | 624 |
| 302 | Ga0501269_000106 | 3300049766 | Bacteria | 26126 |
| 303 | nmdc:mga05p37_16073_c1 | 3300050507 | Bacteria | 9008 |
| 304 | nmdc:mga05p37_994496_c1 | 3300050507 | Bacteria | 892 |
| 305 | nmdc:mga09592_262915_c1 | 3300050508 | Bacteria | 1497 |
| 306 | nmdc:mga0qj67_478838_c1 | 3300050509 | Bacteria | 1002 |
| 307 | nmdc:mga0qj67_8133_c1 | 3300050509 | Bacteria | 7767 |
| 308 | nmdc:mga0qj67_95145_c1 | 3300050509 | Bacteria | 2397 |
| 309 | nmdc:mga06r32_1073917_c1 | 3300050510 | Bacteria | 755 |
| 310 | nmdc:mga06r32_13245_c1 | 3300050510 | Bacteria | 7470 |
| 311 | nmdc:mga06r32_275291_c1 | 3300050510 | Bacteria | 1671 |
| 312 | nmdc:mga08y16_389860_c1 | 3300050511 | Bacteria | 1427 |
| 313 | nmdc:mga08y16_81596_c1 | 3300050511 | Bacteria | 3371 |
| 314 | nmdc:mga0n895_414735_c1 | 3300050512 | Bacteria | 1361 |
| 315 | nmdc:mga0rr50_1009036_c1 | 3300050513 | Bacteria | 709 |
| 316 | nmdc:mga0rr50_453418_c1 | 3300050513 | Bacteria | 1087 |
| 317 | nmdc:mga0a205_313548_c1 | 3300050515 | Bacteria | 1440 |
| 318 | nmdc:mga0a205_620710_c1 | 3300050515 | Bacteria | 933 |
| 319 | Ga0500610_0000360 | 3300053079 | Bacteria | 13753 |
| 320 | Ga0500627_0141911 | 3300053158 | Bacteria | 1085 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035171 | Ga0373946_0252657 | Ga0373946_0252657_71_385 | 104 |
| 2 | 3300037068 | Ga0373925_0013296 | Ga0373925_0013296_4958_5272 | 104 |
| 3 | 3300046472 | Ga0495580_0738742 | Ga0495580_0738742_273_587 | 104 |
| 4 | iso_pu_bacteria | 2919493220 | 2919495071 | 105 |
| 5 | iso_pu_bacteria | 2919543075 | 2919546027 | 105 |
| 6 | iso_pu_bacteria | 2919704043 | 2919706986 | 105 |
| 7 | 3300000043 | ARcpr5yngRDRAFT_c024108 | ARcpr5yngRDRAFT_0241081 | 107 |
| 8 | 3300002741 | JGI25157J39369_1000938 | JGI25157J39369_10009385 | 107 |
| 9 | 3300005288 | Ga0065714_10101447 | Ga0065714_101014473 | 107 |
| 10 | 3300005290 | Ga0065712_10076927 | Ga0065712_100769274 | 107 |
| 11 | 3300005293 | Ga0065715_10216980 | Ga0065715_102169802 | 107 |
| 12 | 3300005330 | Ga0070690_100015899 | Ga0070690_1000158992 | 107 |
| 13 | 3300005331 | Ga0070670_100055472 | Ga0070670_1000554727 | 107 |
| 14 | 3300005331 | Ga0070670_100063263 | Ga0070670_1000632632 | 107 |
| 15 | 3300005334 | Ga0068869_100004112 | Ga0068869_1000041127 | 107 |
| 16 | 3300005334 | Ga0068869_100020524 | Ga0068869_1000205244 | 107 |
| 17 | 3300005334 | Ga0068869_100572450 | Ga0068869_1005724502 | 107 |
| 18 | 3300005335 | Ga0070666_10000008 | Ga0070666_10000008103 | 107 |
| 19 | 3300005335 | Ga0070666_10104158 | Ga0070666_101041583 | 107 |
| 20 | 3300005335 | Ga0070666_11519760 | Ga0070666_115197601 | 107 |
| 21 | 3300005337 | Ga0070682_100080791 | Ga0070682_1000807913 | 107 |
| 22 | 3300005338 | Ga0068868_100026500 | Ga0068868_1000265002 | 107 |
| 23 | 3300005338 | Ga0068868_100117879 | Ga0068868_1001178795 | 107 |
| 24 | 3300005338 | Ga0068868_100723444 | Ga0068868_1007234442 | 107 |
| 25 | 3300005339 | Ga0070660_100475247 | Ga0070660_1004752471 | 107 |
| 26 | 3300005340 | Ga0070689_100001609 | Ga0070689_10000160910 | 107 |
| 27 | 3300005340 | Ga0070689_100462196 | Ga0070689_1004621963 | 107 |
| 28 | 3300005341 | Ga0070691_10580120 | Ga0070691_105801201 | 107 |
| 29 | 3300005343 | Ga0070687_100341335 | Ga0070687_1003413352 | 107 |
| 30 | 3300005344 | Ga0070661_100026498 | Ga0070661_1000264984 | 107 |
| 31 | 3300005345 | Ga0070692_10143948 | Ga0070692_101439482 | 107 |
| 32 | 3300005345 | Ga0070692_10290841 | Ga0070692_102908413 | 107 |
| 33 | 3300005347 | Ga0070668_100111749 | Ga0070668_1001117492 | 107 |
| 34 | 3300005347 | Ga0070668_100608018 | Ga0070668_1006080182 | 107 |
| 35 | 3300005353 | Ga0070669_100023949 | Ga0070669_1000239499 | 107 |
| 36 | 3300005353 | Ga0070669_100052643 | Ga0070669_1000526432 | 107 |
| 37 | 3300005354 | Ga0070675_100000934 | Ga0070675_1000009347 | 107 |
| 38 | 3300005354 | Ga0070675_100097014 | Ga0070675_1000970143 | 107 |
| 39 | 3300005354 | Ga0070675_100266208 | Ga0070675_1002662082 | 107 |
| 40 | 3300005356 | Ga0070674_101926252 | Ga0070674_1019262521 | 107 |
| 41 | 3300005364 | Ga0070673_100284004 | Ga0070673_1002840041 | 107 |
| 42 | 3300005365 | Ga0070688_100233501 | Ga0070688_1002335012 | 107 |
| 43 | 3300005365 | Ga0070688_100359398 | Ga0070688_1003593983 | 107 |
| 44 | 3300005366 | Ga0070659_100010774 | Ga0070659_1000107745 | 107 |
| 45 | 3300005367 | Ga0070667_100153157 | Ga0070667_1001531574 | 107 |
| 46 | 3300005435 | Ga0070714_100083194 | Ga0070714_1000831943 | 107 |
| 47 | 3300005436 | Ga0070713_100004662 | Ga0070713_1000046625 | 107 |
| 48 | 3300005437 | Ga0070710_10448106 | Ga0070710_104481062 | 107 |
| 49 | 3300005438 | Ga0070701_10015634 | Ga0070701_100156344 | 107 |
| 50 | 3300005439 | Ga0070711_100092759 | Ga0070711_1000927593 | 107 |
| 51 | 3300005439 | Ga0070711_100217764 | Ga0070711_1002177641 | 107 |
| 52 | 3300005440 | Ga0070705_100005995 | Ga0070705_1000059951 | 107 |
| 53 | 3300005441 | Ga0070700_100265908 | Ga0070700_1002659083 | 107 |
| 54 | 3300005444 | Ga0070694_100015502 | Ga0070694_1000155021 | 107 |
| 55 | 3300005444 | Ga0070694_100284728 | Ga0070694_1002847281 | 107 |
| 56 | 3300005455 | Ga0070663_100075721 | Ga0070663_1000757214 | 107 |
| 57 | 3300005456 | Ga0070678_100359123 | Ga0070678_1003591232 | 107 |
| 58 | 3300005456 | Ga0070678_102246534 | Ga0070678_1022465341 | 107 |
| 59 | 3300005456 | Ga0070678_102365167 | Ga0070678_1023651671 | 107 |
| 60 | 3300005457 | Ga0070662_100116934 | Ga0070662_1001169344 | 107 |
| 61 | 3300005466 | Ga0070685_10030138 | Ga0070685_100301384 | 107 |
| 62 | 3300005467 | Ga0070706_100039819 | Ga0070706_1000398194 | 107 |
| 63 | 3300005468 | Ga0070707_100364157 | Ga0070707_1003641571 | 107 |
| 64 | 3300005530 | Ga0070679_101956804 | Ga0070679_1019568041 | 107 |
| 65 | 3300005535 | Ga0070684_100004485 | Ga0070684_1000044858 | 107 |
| 66 | 3300005539 | Ga0068853_100229974 | Ga0068853_1002299741 | 107 |
| 67 | 3300005539 | Ga0068853_100553445 | Ga0068853_1005534452 | 107 |
| 68 | 3300005543 | Ga0070672_100013555 | Ga0070672_1000135555 | 107 |
| 69 | 3300005543 | Ga0070672_100231630 | Ga0070672_1002316303 | 107 |
| 70 | 3300005544 | Ga0070686_100004993 | Ga0070686_1000049934 | 107 |
| 71 | 3300005544 | Ga0070686_101919937 | Ga0070686_1019199371 | 107 |
| 72 | 3300005545 | Ga0070695_100499526 | Ga0070695_1004995263 | 107 |
| 73 | 3300005547 | Ga0070693_100216791 | Ga0070693_1002167912 | 107 |
| 74 | 3300005548 | Ga0070665_100156992 | Ga0070665_1001569922 | 107 |
| 75 | 3300005564 | Ga0070664_100049332 | Ga0070664_1000493324 | 107 |
| 76 | 3300005577 | Ga0068857_101195895 | Ga0068857_1011958952 | 107 |
| 77 | 3300005578 | Ga0068854_102061564 | Ga0068854_1020615641 | 107 |
| 78 | 3300005614 | Ga0068856_100003391 | Ga0068856_10000339116 | 107 |
| 79 | 3300005615 | Ga0070702_100008624 | Ga0070702_1000086244 | 107 |
| 80 | 3300005615 | Ga0070702_100289285 | Ga0070702_1002892852 | 107 |
| 81 | 3300005616 | Ga0068852_102316939 | Ga0068852_1023169391 | 107 |
| 82 | 3300005617 | Ga0068859_100032933 | Ga0068859_1000329332 | 107 |
| 83 | 3300005617 | Ga0068859_100048820 | Ga0068859_1000488202 | 107 |
| 84 | 3300005618 | Ga0068864_100022145 | Ga0068864_1000221452 | 107 |
| 85 | 3300005618 | Ga0068864_101356650 | Ga0068864_1013566502 | 107 |
| 86 | 3300005718 | Ga0068866_10160552 | Ga0068866_101605522 | 107 |
| 87 | 3300005719 | Ga0068861_100014100 | Ga0068861_1000141003 | 107 |
| 88 | 3300005719 | Ga0068861_100055480 | Ga0068861_1000554801 | 107 |
| 89 | 3300005719 | Ga0068861_100241025 | Ga0068861_1002410252 | 107 |
| 90 | 3300005841 | Ga0068863_100144668 | Ga0068863_1001446682 | 107 |
| 91 | 3300005842 | Ga0068858_100040312 | Ga0068858_1000403124 | 107 |
| 92 | 3300005842 | Ga0068858_100106146 | Ga0068858_1001061461 | 107 |
| 93 | 3300005843 | Ga0068860_100032207 | Ga0068860_1000322072 | 107 |
| 94 | 3300005843 | Ga0068860_100033255 | Ga0068860_1000332553 | 107 |
| 95 | 3300005843 | Ga0068860_100092724 | Ga0068860_1000927242 | 107 |
| 96 | 3300005844 | Ga0068862_100002858 | Ga0068862_1000028583 | 107 |
| 97 | 3300005844 | Ga0068862_100048049 | Ga0068862_1000480499 | 107 |
| 98 | 3300006194 | Ga0075427_10114692 | Ga0075427_101146922 | 107 |
| 99 | 3300006237 | Ga0097621_102235925 | Ga0097621_1022359251 | 107 |
| 100 | 3300006358 | Ga0068871_100079094 | Ga0068871_1000790945 | 107 |
| 101 | 3300006358 | Ga0068871_102379656 | Ga0068871_1023796562 | 107 |
| 102 | 3300006844 | Ga0075428_100193009 | Ga0075428_1001930091 | 107 |
| 103 | 3300006844 | Ga0075428_100207896 | Ga0075428_1002078963 | 107 |
| 104 | 3300006846 | Ga0075430_100018627 | Ga0075430_1000186274 | 107 |
| 105 | 3300006846 | Ga0075430_100080136 | Ga0075430_1000801363 | 107 |
| 106 | 3300006846 | Ga0075430_100692615 | Ga0075430_1006926152 | 107 |
| 107 | 3300006847 | Ga0075431_100023046 | Ga0075431_1000230466 | 107 |
| 108 | 3300006847 | Ga0075431_100477747 | Ga0075431_1004777472 | 107 |
| 109 | 3300006852 | Ga0075433_10534622 | Ga0075433_105346222 | 107 |
| 110 | 3300006871 | Ga0075434_100475278 | Ga0075434_1004752782 | 107 |
| 111 | 3300006880 | Ga0075429_100011953 | Ga0075429_10001195312 | 107 |
| 112 | 3300006880 | Ga0075429_101551999 | Ga0075429_1015519991 | 107 |
| 113 | 3300006881 | Ga0068865_100682616 | Ga0068865_1006826162 | 107 |
| 114 | 3300006881 | Ga0068865_101758482 | Ga0068865_1017584822 | 107 |
| 115 | 3300006881 | Ga0068865_101855161 | Ga0068865_1018551611 | 107 |
| 116 | 3300006931 | Ga0097620_100032933 | Ga0097620_1000329336 | 107 |
| 117 | 3300006931 | Ga0097620_100048820 | Ga0097620_1000488202 | 107 |
| 118 | 3300009092 | Ga0105250_10154848 | Ga0105250_101548482 | 107 |
| 119 | 3300009093 | Ga0105240_10001334 | Ga0105240_100013348 | 107 |
| 120 | 3300009093 | Ga0105240_10480048 | Ga0105240_104800483 | 107 |
| 121 | 3300009093 | Ga0105240_10834641 | Ga0105240_108346412 | 107 |
| 122 | 3300009094 | Ga0111539_10153743 | Ga0111539_101537433 | 107 |
| 123 | 3300009094 | Ga0111539_10881511 | Ga0111539_108815112 | 107 |
| 124 | 3300009094 | Ga0111539_12872708 | Ga0111539_128727081 | 107 |
| 125 | 3300009098 | Ga0105245_10393550 | Ga0105245_103935503 | 107 |
| 126 | 3300009098 | Ga0105245_10423357 | Ga0105245_104233571 | 107 |
| 127 | 3300009101 | Ga0105247_10025956 | Ga0105247_100259561 | 107 |
| 128 | 3300009101 | Ga0105247_10364896 | Ga0105247_103648962 | 107 |
| 129 | 3300009101 | Ga0105247_11627568 | Ga0105247_116275682 | 107 |
| 130 | 3300009147 | Ga0114129_10011568 | Ga0114129_100115682 | 107 |
| 131 | 3300009147 | Ga0114129_10603221 | Ga0114129_106032213 | 107 |
| 132 | 3300009148 | Ga0105243_10021344 | Ga0105243_100213442 | 107 |
| 133 | 3300009174 | Ga0105241_10500890 | Ga0105241_105008902 | 107 |
| 134 | 3300009176 | Ga0105242_10267372 | Ga0105242_102673722 | 107 |
| 135 | 3300009176 | Ga0105242_10438473 | Ga0105242_104384732 | 107 |
| 136 | 3300009177 | Ga0105248_10019723 | Ga0105248_100197235 | 107 |
| 137 | 3300009177 | Ga0105248_10290319 | Ga0105248_102903192 | 107 |
| 138 | 3300009177 | Ga0105248_10403251 | Ga0105248_104032513 | 107 |
| 139 | 3300009545 | Ga0105237_10062232 | Ga0105237_100622325 | 107 |
| 140 | 3300009545 | Ga0105237_10305069 | Ga0105237_103050692 | 107 |
| 141 | 3300009551 | Ga0105238_10000576 | Ga0105238_1000057622 | 107 |
| 142 | 3300009551 | Ga0105238_10349572 | Ga0105238_103495723 | 107 |
| 143 | 3300009551 | Ga0105238_10895977 | Ga0105238_108959772 | 107 |
| 144 | 3300009553 | Ga0105249_10015667 | Ga0105249_100156674 | 107 |
| 145 | 3300009553 | Ga0105249_11084539 | Ga0105249_110845392 | 107 |
| 146 | 3300010375 | Ga0105239_10010078 | Ga0105239_100100785 | 107 |
| 147 | 3300010375 | Ga0105239_10894965 | Ga0105239_108949652 | 107 |
| 148 | 3300013102 | Ga0157371_11397350 | Ga0157371_113973501 | 107 |
| 149 | 3300013104 | Ga0157370_10023824 | Ga0157370_100238243 | 107 |
| 150 | 3300013104 | Ga0157370_10101637 | Ga0157370_101016372 | 107 |
| 151 | 3300013104 | Ga0157370_11859006 | Ga0157370_118590061 | 107 |
| 152 | 3300013105 | Ga0157369_10811432 | Ga0157369_108114322 | 107 |
| 153 | 3300013296 | Ga0157374_10066426 | Ga0157374_100664262 | 107 |
| 154 | 3300013297 | Ga0157378_10242192 | Ga0157378_102421922 | 107 |
| 155 | 3300013306 | Ga0163162_10002160 | Ga0163162_100021609 | 107 |
| 156 | 3300013306 | Ga0163162_10017958 | Ga0163162_100179584 | 107 |
| 157 | 3300013306 | Ga0163162_12658773 | Ga0163162_126587731 | 107 |
| 158 | 3300013308 | Ga0157375_10046838 | Ga0157375_100468384 | 107 |
| 159 | 3300013308 | Ga0157375_10213723 | Ga0157375_102137232 | 107 |
| 160 | 3300013308 | Ga0157375_10835317 | Ga0157375_108353172 | 107 |
| 161 | 3300014325 | Ga0163163_10000787 | Ga0163163_100007874 | 107 |
| 162 | 3300014325 | Ga0163163_10450212 | Ga0163163_104502122 | 107 |
| 163 | 3300014325 | Ga0163163_12151032 | Ga0163163_121510322 | 107 |
| 164 | 3300014497 | Ga0182008_10017459 | Ga0182008_100174594 | 107 |
| 165 | 3300014745 | Ga0157377_10000749 | Ga0157377_100007493 | 107 |
| 166 | 3300014968 | Ga0157379_10519736 | Ga0157379_105197362 | 107 |
| 167 | 3300014969 | Ga0157376_10163892 | Ga0157376_101638923 | 107 |
| 168 | 3300014969 | Ga0157376_10504704 | Ga0157376_105047042 | 107 |
| 169 | 3300014969 | Ga0157376_10816483 | Ga0157376_108164832 | 107 |
| 170 | 3300015262 | Ga0182007_10006487 | Ga0182007_100064874 | 107 |
| 171 | 3300017792 | Ga0163161_10037712 | Ga0163161_100377124 | 107 |
| 172 | 3300017792 | Ga0163161_10875537 | Ga0163161_108755371 | 107 |
| 173 | 3300025226 | Ga0209674_101759 | Ga0209674_1017595 | 107 |
| 174 | 3300025242 | Ga0209258_104774 | Ga0209258_1047743 | 107 |
| 175 | 3300025250 | Ga0209026_1000113 | Ga0209026_100011310 | 107 |
| 176 | 3300025256 | Ga0209759_1010624 | Ga0209759_10106243 | 107 |
| 177 | 3300025898 | Ga0207692_10084687 | Ga0207692_100846871 | 107 |
| 178 | 3300025899 | Ga0207642_10229310 | Ga0207642_102293102 | 107 |
| 179 | 3300025900 | Ga0207710_10203700 | Ga0207710_102037002 | 107 |
| 180 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005133 | 107 |
| 181 | 3300025903 | Ga0207680_10093726 | Ga0207680_100937262 | 107 |
| 182 | 3300025910 | Ga0207684_10136720 | Ga0207684_101367202 | 107 |
| 183 | 3300025911 | Ga0207654_10295762 | Ga0207654_102957622 | 107 |
| 184 | 3300025913 | Ga0207695_10003395 | Ga0207695_1000339515 | 107 |
| 185 | 3300025913 | Ga0207695_10225427 | Ga0207695_102254273 | 107 |
| 186 | 3300025915 | Ga0207693_11273194 | Ga0207693_112731941 | 107 |
| 187 | 3300025916 | Ga0207663_10256200 | Ga0207663_102562002 | 107 |
| 188 | 3300025917 | Ga0207660_10297109 | Ga0207660_102971093 | 107 |
| 189 | 3300025918 | Ga0207662_10012621 | Ga0207662_100126214 | 107 |
| 190 | 3300025918 | Ga0207662_10030051 | Ga0207662_100300515 | 107 |
| 191 | 3300025919 | Ga0207657_10555889 | Ga0207657_105558891 | 107 |
| 192 | 3300025920 | Ga0207649_10037489 | Ga0207649_100374895 | 107 |
| 193 | 3300025920 | Ga0207649_11209409 | Ga0207649_112094092 | 107 |
| 194 | 3300025923 | Ga0207681_10300260 | Ga0207681_103002602 | 107 |
| 195 | 3300025924 | Ga0207694_10122079 | Ga0207694_101220793 | 107 |
| 196 | 3300025925 | Ga0207650_10015205 | Ga0207650_100152054 | 107 |
| 197 | 3300025925 | Ga0207650_10785487 | Ga0207650_107854872 | 107 |
| 198 | 3300025926 | Ga0207659_10125826 | Ga0207659_101258263 | 107 |
| 199 | 3300025926 | Ga0207659_10151167 | Ga0207659_101511674 | 107 |
| 200 | 3300025928 | Ga0207700_10012298 | Ga0207700_100122983 | 107 |
| 201 | 3300025932 | Ga0207690_10018142 | Ga0207690_100181428 | 107 |
| 202 | 3300025933 | Ga0207706_10117157 | Ga0207706_101171574 | 107 |
| 203 | 3300025935 | Ga0207709_10160702 | Ga0207709_101607022 | 107 |
| 204 | 3300025936 | Ga0207670_10037558 | Ga0207670_100375583 | 107 |
| 205 | 3300025936 | Ga0207670_10580535 | Ga0207670_105805352 | 107 |
| 206 | 3300025936 | Ga0207670_11422142 | Ga0207670_114221421 | 107 |
| 207 | 3300025937 | Ga0207669_10609526 | Ga0207669_106095262 | 107 |
| 208 | 3300025938 | Ga0207704_10014004 | Ga0207704_100140042 | 107 |
| 209 | 3300025940 | Ga0207691_10015433 | Ga0207691_100154334 | 107 |
| 210 | 3300025941 | Ga0207711_10005371 | Ga0207711_100053714 | 107 |
| 211 | 3300025941 | Ga0207711_10077845 | Ga0207711_100778452 | 107 |
| 212 | 3300025941 | Ga0207711_10279668 | Ga0207711_102796683 | 107 |
| 213 | 3300025942 | Ga0207689_10030153 | Ga0207689_100301534 | 107 |
| 214 | 3300025945 | Ga0207679_10056910 | Ga0207679_100569104 | 107 |
| 215 | 3300025960 | Ga0207651_10024204 | Ga0207651_100242044 | 107 |
| 216 | 3300025961 | Ga0207712_10002562 | Ga0207712_1000256211 | 107 |
| 217 | 3300025972 | Ga0207668_10017734 | Ga0207668_100177346 | 107 |
| 218 | 3300025972 | Ga0207668_10075919 | Ga0207668_100759193 | 107 |
| 219 | 3300025981 | Ga0207640_11898566 | Ga0207640_118985662 | 107 |
| 220 | 3300025986 | Ga0207658_10328190 | Ga0207658_103281902 | 107 |
| 221 | 3300026023 | Ga0207677_10125814 | Ga0207677_101258141 | 107 |
| 222 | 3300026023 | Ga0207677_10491349 | Ga0207677_104913492 | 107 |
| 223 | 3300026035 | Ga0207703_10028523 | Ga0207703_100285234 | 107 |
| 224 | 3300026035 | Ga0207703_10088214 | Ga0207703_100882143 | 107 |
| 225 | 3300026041 | Ga0207639_10071629 | Ga0207639_100716294 | 107 |
| 226 | 3300026041 | Ga0207639_10225093 | Ga0207639_102250932 | 107 |
| 227 | 3300026067 | Ga0207678_10475733 | Ga0207678_104757332 | 107 |
| 228 | 3300026067 | Ga0207678_10476715 | Ga0207678_104767152 | 107 |
| 229 | 3300026075 | Ga0207708_10038243 | Ga0207708_100382433 | 107 |
| 230 | 3300026078 | Ga0207702_10519409 | Ga0207702_105194091 | 107 |
| 231 | 3300026088 | Ga0207641_10065008 | Ga0207641_100650085 | 107 |
| 232 | 3300026089 | Ga0207648_10007695 | Ga0207648_100076958 | 107 |
| 233 | 3300026095 | Ga0207676_10038607 | Ga0207676_100386072 | 107 |
| 234 | 3300026116 | Ga0207674_10019603 | Ga0207674_100196034 | 107 |
| 235 | 3300026116 | Ga0207674_10436319 | Ga0207674_104363192 | 107 |
| 236 | 3300026118 | Ga0207675_100029635 | Ga0207675_1000296354 | 107 |
| 237 | 3300026118 | Ga0207675_100885636 | Ga0207675_1008856361 | 107 |
| 238 | 3300026118 | Ga0207675_101657914 | Ga0207675_1016579141 | 107 |
| 239 | 3300026121 | Ga0207683_10522940 | Ga0207683_105229402 | 107 |
| 240 | 3300026121 | Ga0207683_10550847 | Ga0207683_105508472 | 107 |
| 241 | 3300026121 | Ga0207683_12167365 | Ga0207683_121673652 | 107 |
| 242 | 3300028379 | Ga0268266_11139736 | Ga0268266_111397362 | 107 |
| 243 | 3300028380 | Ga0268265_10006042 | Ga0268265_100060422 | 107 |
| 244 | 3300028380 | Ga0268265_10008291 | Ga0268265_100082919 | 107 |
| 245 | 3300028381 | Ga0268264_10019237 | Ga0268264_100192372 | 107 |
| 246 | 3300028381 | Ga0268264_10131421 | Ga0268264_101314214 | 107 |
| 247 | 3300030745 | Ga0316182_1251408 | Ga0316182_12514082 | 107 |
| 248 | 3300031548 | Ga0307408_100003879 | Ga0307408_1000038797 | 107 |
| 249 | 3300031548 | Ga0307408_100004186 | Ga0307408_1000041863 | 107 |
| 250 | 3300031731 | Ga0307405_10316618 | Ga0307405_103166183 | 107 |
| 251 | 3300031731 | Ga0307405_10974900 | Ga0307405_109749001 | 107 |
| 252 | 3300031824 | Ga0307413_10477187 | Ga0307413_104771872 | 107 |
| 253 | 3300031901 | Ga0307406_10384914 | Ga0307406_103849141 | 107 |
| 254 | 3300031901 | Ga0307406_10559708 | Ga0307406_105597082 | 107 |
| 255 | 3300032002 | Ga0307416_100029934 | Ga0307416_1000299342 | 107 |
| 256 | 3300032126 | Ga0307415_100451815 | Ga0307415_1004518152 | 107 |
| 257 | 3300033180 | Ga0307510_10000038 | Ga0307510_1000003886 | 107 |
| 258 | 3300035112 | Ga0373932_0382623 | Ga0373932_0382623_168_497 | 107 |
| 259 | 3300035691 | Ga0373931_0128994 | Ga0373931_0128994_634_963 | 107 |
| 260 | 3300036401 | Ga0373937_0982029 | Ga0373937_0982029_399_728 | 107 |
| 261 | 3300036712 | Ga0316584_1178113 | Ga0316584_1178113_162_491 | 107 |
| 262 | 3300038443 | Ga0395901_0202973 | Ga0395901_0202973_1111_1440 | 107 |
| 263 | 3300039447 | Ga0436361_0352795 | Ga0436361_0352795_159_488 | 107 |
| 264 | 3300042002 | Ga0439442_043567 | Ga0439442_043567_345_674 | 107 |
| 265 | 3300042993 | Ga0439440_0053605 | Ga0439440_0053605_352_681 | 107 |
| 266 | 3300044656 | Ga0466969_0017783 | Ga0466969_0017783_3084_3413 | 107 |
| 267 | 3300044684 | Ga0466966_0043485 | Ga0466966_0043485_2497_2826 | 107 |
| 268 | 3300044684 | Ga0466966_0488152 | Ga0466966_0488152_106_435 | 107 |
| 269 | 3300044712 | Ga0453684_0549265 | Ga0453684_0549265_694_1023 | 107 |
| 270 | 3300045051 | Ga0451576_0394157 | Ga0451576_0394157_116_445 | 107 |
| 271 | 3300045051 | Ga0451576_0550258 | Ga0451576_0550258_357_686 | 107 |
| 272 | 3300046530 | Ga0495654_0000198 | Ga0495654_0000198_15501_15830 | 107 |
| 273 | 3300046538 | Ga0495609_0396073 | Ga0495609_0396073_179_508 | 107 |
| 274 | 3300046558 | Ga0495633_0001416 | Ga0495633_0001416_14284_14613 | 107 |
| 275 | 3300046674 | Ga0495588_0447472 | Ga0495588_0447472_233_562 | 107 |
| 276 | 3300048905 | Ga0496102_0116703 | Ga0496102_0116703_2000_2329 | 107 |
| 277 | 3300048907 | Ga0496104_0094467 | Ga0496104_0094467_421_750 | 107 |
| 278 | 3300048907 | Ga0496104_0603468 | Ga0496104_0603468_26_355 | 107 |
| 279 | 3300048907 | Ga0496104_1047389 | Ga0496104_1047389_352_681 | 107 |
| 280 | 3300048908 | Ga0496105_0522455 | Ga0496105_0522455_539_868 | 107 |
| 281 | 3300048909 | Ga0496106_0256375 | Ga0496106_0256375_688_1017 | 107 |
| 282 | 3300048911 | Ga0496108_0438345 | Ga0496108_0438345_790_1119 | 107 |
| 283 | 3300048911 | Ga0496108_0456062 | Ga0496108_0456062_50_379 | 107 |
| 284 | 3300048916 | Ga0496113_0504990 | Ga0496113_0504990_487_816 | 107 |
| 285 | 3300048918 | Ga0496115_0627807 | Ga0496115_0627807_45_374 | 107 |
| 286 | 3300048919 | Ga0496116_0005022 | Ga0496116_0005022_6755_7084 | 107 |
| 287 | 3300048920 | Ga0496117_0062758 | Ga0496117_0062758_1611_1934 | 107 |
| 288 | 3300048921 | Ga0496118_0004248 | Ga0496118_0004248_10930_11253 | 107 |
| 289 | 3300048921 | Ga0496118_0046026 | Ga0496118_0046026_2514_2843 | 107 |
| 290 | 3300048922 | Ga0496119_0005821 | Ga0496119_0005821_3855_4184 | 107 |
| 291 | 3300048923 | Ga0496120_0001965 | Ga0496120_0001965_19436_19765 | 107 |
| 292 | 3300048924 | Ga0496121_0461551 | Ga0496121_0461551_292_615 | 107 |
| 293 | 3300048924 | Ga0496121_0705382 | Ga0496121_0705382_60_389 | 107 |
| 294 | 3300048926 | Ga0496123_0007834 | Ga0496123_0007834_5253_5582 | 107 |
| 295 | 3300048927 | Ga0496124_0227159 | Ga0496124_0227159_1035_1364 | 107 |
| 296 | 3300048928 | Ga0496125_0000241 | Ga0496125_0000241_54403_54732 | 107 |
| 297 | 3300049571 | Ga0501034_0042817 | Ga0501034_0042817_2689_3018 | 107 |
| 298 | 3300049576 | Ga0501040_0643821 | Ga0501040_0643821_39_368 | 107 |
| 299 | 3300049581 | Ga0501047_0040308 | Ga0501047_0040308_1184_1513 | 107 |
| 300 | 3300049586 | Ga0501070_0879250 | Ga0501070_0879250_188_517 | 107 |
| 301 | 3300049588 | Ga0501072_1089913 | Ga0501072_1089913_231_560 | 107 |
| 302 | 3300049679 | Ga0501249_017460 | Ga0501249_017460_916_1245 | 107 |
| 303 | 3300049742 | Ga0501080_0486120 | Ga0501080_0486120_74_403 | 107 |
| 304 | 3300049743 | Ga0501081_1024069 | Ga0501081_1024069_16_345 | 107 |
| 305 | 3300049766 | Ga0501269_000106 | Ga0501269_000106_24686_25015 | 107 |
| 306 | 3300050507 | nmdc:mga05p37_16073_c1 | nmdc:mga05p37_16073_c1_685_1014 | 107 |
| 307 | 3300050507 | nmdc:mga05p37_994496_c1 | nmdc:mga05p37_994496_c1_130_516 | 107 |
| 308 | 3300050508 | nmdc:mga09592_262915_c1 | nmdc:mga09592_262915_c1_658_987 | 107 |
| 309 | 3300050509 | nmdc:mga0qj67_478838_c1 | nmdc:mga0qj67_478838_c1_163_492 | 107 |
| 310 | 3300050509 | nmdc:mga0qj67_8133_c1 | nmdc:mga0qj67_8133_c1_2881_3210 | 107 |
| 311 | 3300050509 | nmdc:mga0qj67_95145_c1 | nmdc:mga0qj67_95145_c1_2048_2377 | 107 |
| 312 | 3300050510 | nmdc:mga06r32_1073917_c1 | nmdc:mga06r32_1073917_c1_135_464 | 107 |
| 313 | 3300050510 | nmdc:mga06r32_13245_c1 | nmdc:mga06r32_13245_c1_6109_6438 | 107 |
| 314 | 3300050510 | nmdc:mga06r32_275291_c1 | nmdc:mga06r32_275291_c1_658_987 | 107 |
| 315 | 3300050511 | nmdc:mga08y16_389860_c1 | nmdc:mga08y16_389860_c1_544_873 | 107 |
| 316 | 3300050511 | nmdc:mga08y16_81596_c1 | nmdc:mga08y16_81596_c1_777_1106 | 107 |
| 317 | 3300050512 | nmdc:mga0n895_414735_c1 | nmdc:mga0n895_414735_c1_213_542 | 107 |
| 318 | 3300050513 | nmdc:mga0rr50_1009036_c1 | nmdc:mga0rr50_1009036_c1_215_544 | 107 |
| 319 | 3300050513 | nmdc:mga0rr50_453418_c1 | nmdc:mga0rr50_453418_c1_34_363 | 107 |
| 320 | 3300050515 | nmdc:mga0a205_313548_c1 | nmdc:mga0a205_313548_c1_206_535 | 107 |
| 321 | 3300050515 | nmdc:mga0a205_620710_c1 | nmdc:mga0a205_620710_c1_86_415 | 107 |
| 322 | 3300053079 | Ga0500610_0000360 | Ga0500610_0000360_12922_13251 | 107 |
| 323 | 3300053158 | Ga0500627_0141911 | Ga0500627_0141911_207_536 | 107 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i45-assembly5.cif.gz_J | crystal structure of protein nmb1881 from neisseria meningitidis | 0.8716 | 28 | 107 |
| 2i45-assembly1.cif.gz_B | crystal structure of protein nmb1881 from neisseria meningitidis | 0.8668 | 28 | 107 |
| 3lwc-assembly1.cif.gz_A-2 | crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution | 0.8585 | 26 | 106 |
| 4fag-assembly1.cif.gz_A | crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate | 0.8558 | 26 | 106 |
| 4b29-assembly1.cif.gz_A | crystal structures of dmsp lyases rddddp and rndddqii | 0.855 | 26 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8597 | 28 | 106 | 2.60.120.10 |
| af_O94603_133_414_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.856 | 38 | 105 | 2.60.120.650 |
| 4b29A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.855 | 26 | 106 | 2.60.120.10 |
| af_Q05212_199_307_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8538 | 26 | 106 | 2.60.120.10 |
| 3elnA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8496 | 26 | 106 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B6KSK9-F1-model_v4 | deleted | 0.997 | 42 | 107 |
|
| AF-A0A0R0MLI8-F1-model_v4 | DHCW motif cupin fold protein | 0.9893 | 1 | 107 |
|
| AF-F4MYE7-F1-model_v4 | Cupin 2 conserved barrel domain-containing protein | 0.9871 | 14 | 107 |
|
| AF-A0A081CRH5-F1-model_v4 | Cupin 2 conserved barrel domain-containing protein | 0.9865 | 1 | 107 |
|
| AF-A0A1I1EC65-F1-model_v4 | DHCW motif cupin fold protein | 0.985 | 1 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar