F407124

General Info

Members Datasets Scaffolds Average Seq Length
323 217 320 109

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_994496_c1|nmdc:mga05p37_994496_c1_130_516
Length 128
Sequence VEAAVGRFATQCTAAAEHFMKMTDIPFGTTDWSTIEPTEHAGDAGFAYWRTRNFGSIRVRMVEYTPGYIANHWCSKGHILFCIEGELHTELEDGRQFVLRPGMSYQVADNAEPHRSSTERGARLFIVD

Samples

Sample ID Description Type Environment
1 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
2 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
3 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.1
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c024108 3300000043 Bacteria 520
2 JGI25157J39369_1000938 3300002741 Bacteria 13774
3 Ga0065714_10101447 3300005288 Bacteria 1635
4 Ga0065712_10076927 3300005290 Bacteria 3578
5 Ga0065715_10216980 3300005293 Bacteria 1288
6 Ga0070690_100015899 3300005330 Bacteria 4497
7 Ga0070670_100055472 3300005331 Bacteria 3401
8 Ga0070670_100063263 3300005331 Bacteria 3176
9 Ga0068869_100004112 3300005334 Bacteria 9018
10 Ga0068869_100020524 3300005334 Bacteria 4531
11 Ga0068869_100572450 3300005334 Unclassified 951
12 Ga0070666_10000008 3300005335 Bacteria 293415
13 Ga0070666_10104158 3300005335 Bacteria 1958
14 Ga0070666_11519760 3300005335 Bacteria 501
15 Ga0070682_100080791 3300005337 Bacteria 2103
16 Ga0068868_100026500 3300005338 Bacteria 4419
17 Ga0068868_100117879 3300005338 Bacteria 2163
18 Ga0068868_100723444 3300005338 Bacteria 892
19 Ga0070660_100475247 3300005339 Bacteria 1038
20 Ga0070689_100001609 3300005340 Bacteria 14410
21 Ga0070689_100462196 3300005340 Bacteria 1081
22 Ga0070691_10580120 3300005341 Bacteria 659
23 Ga0070687_100341335 3300005343 Bacteria 964
24 Ga0070661_100026498 3300005344 Bacteria 4170
25 Ga0070692_10143948 3300005345 Bacteria 1352
26 Ga0070692_10290841 3300005345 Unclassified 994
27 Ga0070668_100111749 3300005347 Bacteria 2175
28 Ga0070668_100608018 3300005347 Bacteria 957
29 Ga0070669_100023949 3300005353 Bacteria 4374
30 Ga0070669_100052643 3300005353 Bacteria 2979
31 Ga0070675_100000934 3300005354 Bacteria 20807
32 Ga0070675_100097014 3300005354 Bacteria 2478
33 Ga0070675_100266208 3300005354 Bacteria 1503
34 Ga0070674_101926252 3300005356 Bacteria 537
35 Ga0070673_100284004 3300005364 Bacteria 1452
36 Ga0070688_100233501 3300005365 Bacteria 1302
37 Ga0070688_100359398 3300005365 Bacteria 1068
38 Ga0070659_100010774 3300005366 Bacteria 6741
39 Ga0070667_100153157 3300005367 Bacteria 2027
40 Ga0070714_100083194 3300005435 Bacteria 2790
41 Ga0070713_100004662 3300005436 Bacteria 9252
42 Ga0070710_10448106 3300005437 Bacteria 874
43 Ga0070701_10015634 3300005438 Bacteria 3510
44 Ga0070711_100092759 3300005439 Bacteria 2179
45 Ga0070711_100217764 3300005439 Bacteria 1482
46 Ga0070705_100005995 3300005440 Bacteria 5944
47 Ga0070700_100265908 3300005441 Bacteria 1237
48 Ga0070694_100015502 3300005444 Bacteria 4789
49 Ga0070694_100284728 3300005444 Bacteria 1261
50 Ga0070663_100075721 3300005455 Bacteria 2460
51 Ga0070678_100359123 3300005456 Bacteria 1255
52 Ga0070678_102246534 3300005456 Bacteria 518
53 Ga0070678_102365167 3300005456 Bacteria 504
54 Ga0070662_100116934 3300005457 Bacteria 2039
55 Ga0070685_10030138 3300005466 Bacteria 3020
56 Ga0070706_100039819 3300005467 Bacteria 4338
57 Ga0070707_100364157 3300005468 Bacteria 1404
58 Ga0070679_101956804 3300005530 Bacteria 535
59 Ga0070684_100004485 3300005535 Bacteria 10627
60 Ga0068853_100229974 3300005539 Bacteria 1696
61 Ga0068853_100553445 3300005539 Bacteria 1090
62 Ga0070672_100013555 3300005543 Bacteria 5762
63 Ga0070672_100231630 3300005543 Bacteria 1552
64 Ga0070686_100004993 3300005544 Bacteria 7321
65 Ga0070686_101919937 3300005544 Bacteria 506
66 Ga0070695_100499526 3300005545 Unclassified 940
67 Ga0070693_100216791 3300005547 Bacteria 1252
68 Ga0070665_100156992 3300005548 Bacteria 2277
69 Ga0070664_100049332 3300005564 Bacteria 3560
70 Ga0068857_101195895 3300005577 Bacteria 736
71 Ga0068854_102061564 3300005578 Bacteria 526
72 Ga0068856_100003391 3300005614 Bacteria 16130
73 Ga0070702_100008624 3300005615 Bacteria 4947
74 Ga0070702_100289285 3300005615 Bacteria 1128
75 Ga0068852_102316939 3300005616 Bacteria 558
76 Ga0068859_100032933 3300005617 Bacteria 5206
77 Ga0068859_100048820 3300005617 Bacteria 4252
78 Ga0068864_100022145 3300005618 Bacteria 5327
79 Ga0068864_101356650 3300005618 Bacteria 712
80 Ga0068866_10160552 3300005718 Bacteria 1310
81 Ga0068861_100014100 3300005719 Bacteria 5604
82 Ga0068861_100055480 3300005719 Bacteria 3021
83 Ga0068861_100241025 3300005719 Bacteria 1538
84 Ga0068863_100144668 3300005841 Bacteria 2273
85 Ga0068858_100040312 3300005842 Bacteria 4330
86 Ga0068858_100106146 3300005842 Bacteria 2622
87 Ga0068860_100032207 3300005843 Bacteria 5039
88 Ga0068860_100033255 3300005843 Bacteria 4949
89 Ga0068860_100092724 3300005843 Bacteria 2878
90 Ga0068862_100002858 3300005844 Bacteria 15133
91 Ga0068862_100048049 3300005844 Bacteria 3643
92 Ga0075427_10114692 3300006194 Bacteria 509
93 Ga0097621_102235925 3300006237 Bacteria 523
94 Ga0068871_100079094 3300006358 Bacteria 2720
95 Ga0068871_102379656 3300006358 Bacteria 505
96 Ga0075428_100193009 3300006844 Bacteria 2203
97 Ga0075428_100207896 3300006844 Bacteria 2115
98 Ga0075430_100018627 3300006846 Bacteria 5908
99 Ga0075430_100080136 3300006846 Bacteria 2735
100 Ga0075430_100692615 3300006846 Bacteria 840
101 Ga0075431_100023046 3300006847 Bacteria 6365
102 Ga0075431_100477747 3300006847 Bacteria 1239
103 Ga0075433_10534622 3300006852 Bacteria 1031
104 Ga0075434_100475278 3300006871 Bacteria 1271
105 Ga0075429_100011953 3300006880 Bacteria 7526
106 Ga0075429_101551999 3300006880 Bacteria 576
107 Ga0068865_100682616 3300006881 Bacteria 876
108 Ga0068865_101758482 3300006881 Bacteria 560
109 Ga0068865_101855161 3300006881 Bacteria 545
110 Ga0097620_100032933 3300006931 Bacteria 5206
111 Ga0097620_100048820 3300006931 Bacteria 4252
112 Ga0105250_10154848 3300009092 Bacteria 955
113 Ga0105240_10001334 3300009093 Bacteria 42438
114 Ga0105240_10480048 3300009093 Bacteria 1386
115 Ga0105240_10834641 3300009093 Bacteria 996
116 Ga0111539_10153743 3300009094 Bacteria 2692
117 Ga0111539_10881511 3300009094 Bacteria 1041
118 Ga0111539_12872708 3300009094 Bacteria 558
119 Ga0105245_10393550 3300009098 Bacteria 1383
120 Ga0105245_10423357 3300009098 Bacteria 1335
121 Ga0105247_10025956 3300009101 Bacteria 3536
122 Ga0105247_10364896 3300009101 Bacteria 1019
123 Ga0105247_11627568 3300009101 Bacteria 531
124 Ga0114129_10011568 3300009147 Bacteria 12565
125 Ga0114129_10603221 3300009147 Bacteria 1422
126 Ga0105243_10021344 3300009148 Bacteria 4915
127 Ga0105241_10500890 3300009174 Unclassified 1083
128 Ga0105242_10267372 3300009176 Bacteria 1547
129 Ga0105242_10438473 3300009176 Bacteria 1228
130 Ga0105248_10019723 3300009177 Bacteria 7465
131 Ga0105248_10290319 3300009177 Bacteria 1842
132 Ga0105248_10403251 3300009177 Bacteria 1540
133 Ga0105237_10062232 3300009545 Bacteria 3732
134 Ga0105237_10305069 3300009545 Bacteria 1595
135 Ga0105238_10000576 3300009551 Bacteria 38530
136 Ga0105238_10349572 3300009551 Bacteria 1467
137 Ga0105238_10895977 3300009551 Bacteria 905
138 Ga0105249_10015667 3300009553 Bacteria 6712
139 Ga0105249_11084539 3300009553 Bacteria 871
140 Ga0105239_10010078 3300010375 Bacteria 10593
141 Ga0105239_10894965 3300010375 Bacteria 1019
142 Ga0157371_11397350 3300013102 Bacteria 544
143 Ga0157370_10023824 3300013104 Bacteria 6073
144 Ga0157370_10101637 3300013104 Bacteria 2693
145 Ga0157370_11859006 3300013104 Unclassified 540
146 Ga0157369_10811432 3300013105 Bacteria 961
147 Ga0157374_10066426 3300013296 Bacteria 3389
148 Ga0157378_10242192 3300013297 Bacteria 1723
149 Ga0163162_10002160 3300013306 Bacteria 18447
150 Ga0163162_10017958 3300013306 Bacteria 6922
151 Ga0163162_12658773 3300013306 Bacteria 576
152 Ga0157375_10046838 3300013308 Bacteria 4219
153 Ga0157375_10213723 3300013308 Bacteria 2086
154 Ga0157375_10835317 3300013308 Bacteria 1068
155 Ga0163163_10000787 3300014325 Bacteria 26884
156 Ga0163163_10450212 3300014325 Bacteria 1348
157 Ga0163163_12151032 3300014325 Bacteria 617
158 Ga0182008_10017459 3300014497 Bacteria 3723
159 Ga0157377_10000749 3300014745 Bacteria 13459
160 Ga0157379_10519736 3300014968 Bacteria 1105
161 Ga0157376_10163892 3300014969 Bacteria 2018
162 Ga0157376_10504704 3300014969 Bacteria 1189
163 Ga0157376_10816483 3300014969 Bacteria 946
164 Ga0182007_10006487 3300015262 Bacteria 5019
165 Ga0163161_10037712 3300017792 Bacteria 3465
166 Ga0163161_10875537 3300017792 Bacteria 759
167 Ga0209674_101759 3300025226 Bacteria 5259
168 Ga0209258_104774 3300025242 Bacteria 2468
169 Ga0209026_1000113 3300025250 Bacteria 139047
170 Ga0209759_1010624 3300025256 Bacteria 2686
171 Ga0207692_10084687 3300025898 Bacteria 1704
172 Ga0207642_10229310 3300025899 Bacteria 1042
173 Ga0207710_10203700 3300025900 Bacteria 978
174 Ga0207680_10000005 3300025903 Bacteria 660983
175 Ga0207680_10093726 3300025903 Bacteria 1916
176 Ga0207684_10136720 3300025910 Bacteria 2105
177 Ga0207654_10295762 3300025911 Unclassified 1099
178 Ga0207695_10003395 3300025913 Bacteria 22500
179 Ga0207695_10225427 3300025913 Bacteria 1780
180 Ga0207693_11273194 3300025915 Unclassified 551
181 Ga0207663_10256200 3300025916 Bacteria 1290
182 Ga0207660_10297109 3300025917 Bacteria 1285
183 Ga0207662_10012621 3300025918 Bacteria 4708
184 Ga0207662_10030051 3300025918 Bacteria 3151
185 Ga0207657_10555889 3300025919 Bacteria 897
186 Ga0207649_10037489 3300025920 Bacteria 2928
187 Ga0207649_11209409 3300025920 Bacteria 597
188 Ga0207681_10300260 3300025923 Bacteria 1270
189 Ga0207694_10122079 3300025924 Bacteria 2081
190 Ga0207650_10015205 3300025925 Bacteria 5356
191 Ga0207650_10785487 3300025925 Bacteria 807
192 Ga0207659_10125826 3300025926 Bacteria 1971
193 Ga0207659_10151167 3300025926 Bacteria 1813
194 Ga0207700_10012298 3300025928 Bacteria 5511
195 Ga0207690_10018142 3300025932 Bacteria 4312
196 Ga0207706_10117157 3300025933 Bacteria 2343
197 Ga0207709_10160702 3300025935 Bacteria 1566
198 Ga0207670_10037558 3300025936 Bacteria 3157
199 Ga0207670_10580535 3300025936 Bacteria 919
200 Ga0207670_11422142 3300025936 Bacteria 589
201 Ga0207669_10609526 3300025937 Bacteria 888
202 Ga0207704_10014004 3300025938 Bacteria 4037
203 Ga0207691_10015433 3300025940 Bacteria 7266
204 Ga0207711_10005371 3300025941 Bacteria 10850
205 Ga0207711_10077845 3300025941 Bacteria 2892
206 Ga0207711_10279668 3300025941 Bacteria 1537
207 Ga0207689_10030153 3300025942 Bacteria 4520
208 Ga0207679_10056910 3300025945 Bacteria 2890
209 Ga0207651_10024204 3300025960 Bacteria 3751
210 Ga0207712_10002562 3300025961 Bacteria 11682
211 Ga0207668_10017734 3300025972 Bacteria 4467
212 Ga0207668_10075919 3300025972 Bacteria 2418
213 Ga0207640_11898566 3300025981 Bacteria 539
214 Ga0207658_10328190 3300025986 Bacteria 1326
215 Ga0207677_10125814 3300026023 Bacteria 1937
216 Ga0207677_10491349 3300026023 Bacteria 1059
217 Ga0207703_10028523 3300026035 Bacteria 4401
218 Ga0207703_10088214 3300026035 Bacteria 2603
219 Ga0207639_10071629 3300026041 Bacteria 2712
220 Ga0207639_10225093 3300026041 Bacteria 1622
221 Ga0207678_10475733 3300026067 Bacteria 1088
222 Ga0207678_10476715 3300026067 Bacteria 1086
223 Ga0207708_10038243 3300026075 Bacteria 3655
224 Ga0207702_10519409 3300026078 Bacteria 1162
225 Ga0207641_10065008 3300026088 Bacteria 3119
226 Ga0207648_10007695 3300026089 Bacteria 10541
227 Ga0207676_10038607 3300026095 Bacteria 3646
228 Ga0207674_10019603 3300026116 Bacteria 7323
229 Ga0207674_10436319 3300026116 Bacteria 1266
230 Ga0207675_100029635 3300026118 Bacteria 5097
231 Ga0207675_100885636 3300026118 Bacteria 908
232 Ga0207675_101657914 3300026118 Bacteria 660
233 Ga0207683_10522940 3300026121 Bacteria 1096
234 Ga0207683_10550847 3300026121 Bacteria 1066
235 Ga0207683_12167365 3300026121 Bacteria 504
236 Ga0268266_11139736 3300028379 Bacteria 754
237 Ga0268265_10006042 3300028380 Bacteria 8230
238 Ga0268265_10008291 3300028380 Bacteria 7020
239 Ga0268264_10019237 3300028381 Bacteria 5582
240 Ga0268264_10131421 3300028381 Bacteria 2220
241 Ga0316182_1251408 3300030745 Bacteria 1267
242 Ga0307408_100003879 3300031548 Bacteria 10180
243 Ga0307408_100004186 3300031548 Bacteria 9835
244 Ga0307405_10316618 3300031731 Bacteria 1190
245 Ga0307405_10974900 3300031731 Bacteria 722
246 Ga0307413_10477187 3300031824 Bacteria 996
247 Ga0307406_10384914 3300031901 Bacteria 1107
248 Ga0307406_10559708 3300031901 Bacteria 937
249 Ga0307416_100029934 3300032002 Bacteria 4077
250 Ga0307415_100451815 3300032126 Bacteria 1111
251 Ga0307510_10000038 3300033180 Bacteria 106256
252 Ga0373932_0382623 3300035112 Bacteria 541
253 Ga0373946_0252657 3300035171 Bacteria 860
254 Ga0373931_0128994 3300035691 Bacteria 1453
255 Ga0373937_0982029 3300036401 Bacteria 793
256 Ga0316584_1178113 3300036712 Unclassified 506
257 Ga0373925_0013296 3300037068 Bacteria 5958
258 Ga0395901_0202973 3300038443 Bacteria 2078
259 Ga0436361_0352795 3300039447 Bacteria 1707
260 Ga0439442_043567 3300042002 Bacteria 945
261 Ga0439440_0053605 3300042993 Bacteria 1014
262 Ga0466969_0017783 3300044656 Bacteria 3709
263 Ga0466966_0043485 3300044684 Bacteria 2879
264 Ga0466966_0488152 3300044684 Bacteria 741
265 Ga0453684_0549265 3300044712 Bacteria 1273
266 Ga0451576_0394157 3300045051 Bacteria 1451
267 Ga0451576_0550258 3300045051 Bacteria 1212
268 Ga0495580_0738742 3300046472 Bacteria 642
269 Ga0495654_0000198 3300046530 Bacteria 58451
270 Ga0495609_0396073 3300046538 Bacteria 553
271 Ga0495633_0001416 3300046558 Bacteria 18679
272 Ga0495588_0447472 3300046674 Bacteria 678
273 Ga0496102_0116703 3300048905 Bacteria 2491
274 Ga0496104_0094467 3300048907 Unclassified 2861
275 Ga0496104_0603468 3300048907 Bacteria 1008
276 Ga0496104_1047389 3300048907 Bacteria 720
277 Ga0496105_0522455 3300048908 Bacteria 930
278 Ga0496106_0256375 3300048909 Bacteria 1399
279 Ga0496108_0438345 3300048911 Bacteria 1141
280 Ga0496108_0456062 3300048911 Bacteria 1117
281 Ga0496113_0504990 3300048916 Bacteria 971
282 Ga0496115_0627807 3300048918 Bacteria 852
283 Ga0496116_0005022 3300048919 Bacteria 12461
284 Ga0496117_0062758 3300048920 Bacteria 2544
285 Ga0496118_0004248 3300048921 Bacteria 17157
286 Ga0496118_0046026 3300048921 Bacteria 3399
287 Ga0496119_0005821 3300048922 Bacteria 11652
288 Ga0496120_0001965 3300048923 Bacteria 22470
289 Ga0496121_0461551 3300048924 Bacteria 816
290 Ga0496121_0705382 3300048924 Bacteria 606
291 Ga0496123_0007834 3300048926 Bacteria 9941
292 Ga0496124_0227159 3300048927 Bacteria 1398
293 Ga0496125_0000241 3300048928 Bacteria 112044
294 Ga0501034_0042817 3300049571 Bacteria 4584
295 Ga0501040_0643821 3300049576 Bacteria 766
296 Ga0501047_0040308 3300049581 Bacteria 4517
297 Ga0501070_0879250 3300049586 Bacteria 700
298 Ga0501072_1089913 3300049588 Bacteria 621
299 Ga0501249_017460 3300049679 Bacteria 1546
300 Ga0501080_0486120 3300049742 Bacteria 1104
301 Ga0501081_1024069 3300049743 Bacteria 624
302 Ga0501269_000106 3300049766 Bacteria 26126
303 nmdc:mga05p37_16073_c1 3300050507 Bacteria 9008
304 nmdc:mga05p37_994496_c1 3300050507 Bacteria 892
305 nmdc:mga09592_262915_c1 3300050508 Bacteria 1497
306 nmdc:mga0qj67_478838_c1 3300050509 Bacteria 1002
307 nmdc:mga0qj67_8133_c1 3300050509 Bacteria 7767
308 nmdc:mga0qj67_95145_c1 3300050509 Bacteria 2397
309 nmdc:mga06r32_1073917_c1 3300050510 Bacteria 755
310 nmdc:mga06r32_13245_c1 3300050510 Bacteria 7470
311 nmdc:mga06r32_275291_c1 3300050510 Bacteria 1671
312 nmdc:mga08y16_389860_c1 3300050511 Bacteria 1427
313 nmdc:mga08y16_81596_c1 3300050511 Bacteria 3371
314 nmdc:mga0n895_414735_c1 3300050512 Bacteria 1361
315 nmdc:mga0rr50_1009036_c1 3300050513 Bacteria 709
316 nmdc:mga0rr50_453418_c1 3300050513 Bacteria 1087
317 nmdc:mga0a205_313548_c1 3300050515 Bacteria 1440
318 nmdc:mga0a205_620710_c1 3300050515 Bacteria 933
319 Ga0500610_0000360 3300053079 Bacteria 13753
320 Ga0500627_0141911 3300053158 Bacteria 1085

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0252657 Ga0373946_0252657_71_385 104
2 3300037068 Ga0373925_0013296 Ga0373925_0013296_4958_5272 104
3 3300046472 Ga0495580_0738742 Ga0495580_0738742_273_587 104
4 iso_pu_bacteria 2919493220 2919495071 105
5 iso_pu_bacteria 2919543075 2919546027 105
6 iso_pu_bacteria 2919704043 2919706986 105
7 3300000043 ARcpr5yngRDRAFT_c024108 ARcpr5yngRDRAFT_0241081 107
8 3300002741 JGI25157J39369_1000938 JGI25157J39369_10009385 107
9 3300005288 Ga0065714_10101447 Ga0065714_101014473 107
10 3300005290 Ga0065712_10076927 Ga0065712_100769274 107
11 3300005293 Ga0065715_10216980 Ga0065715_102169802 107
12 3300005330 Ga0070690_100015899 Ga0070690_1000158992 107
13 3300005331 Ga0070670_100055472 Ga0070670_1000554727 107
14 3300005331 Ga0070670_100063263 Ga0070670_1000632632 107
15 3300005334 Ga0068869_100004112 Ga0068869_1000041127 107
16 3300005334 Ga0068869_100020524 Ga0068869_1000205244 107
17 3300005334 Ga0068869_100572450 Ga0068869_1005724502 107
18 3300005335 Ga0070666_10000008 Ga0070666_10000008103 107
19 3300005335 Ga0070666_10104158 Ga0070666_101041583 107
20 3300005335 Ga0070666_11519760 Ga0070666_115197601 107
21 3300005337 Ga0070682_100080791 Ga0070682_1000807913 107
22 3300005338 Ga0068868_100026500 Ga0068868_1000265002 107
23 3300005338 Ga0068868_100117879 Ga0068868_1001178795 107
24 3300005338 Ga0068868_100723444 Ga0068868_1007234442 107
25 3300005339 Ga0070660_100475247 Ga0070660_1004752471 107
26 3300005340 Ga0070689_100001609 Ga0070689_10000160910 107
27 3300005340 Ga0070689_100462196 Ga0070689_1004621963 107
28 3300005341 Ga0070691_10580120 Ga0070691_105801201 107
29 3300005343 Ga0070687_100341335 Ga0070687_1003413352 107
30 3300005344 Ga0070661_100026498 Ga0070661_1000264984 107
31 3300005345 Ga0070692_10143948 Ga0070692_101439482 107
32 3300005345 Ga0070692_10290841 Ga0070692_102908413 107
33 3300005347 Ga0070668_100111749 Ga0070668_1001117492 107
34 3300005347 Ga0070668_100608018 Ga0070668_1006080182 107
35 3300005353 Ga0070669_100023949 Ga0070669_1000239499 107
36 3300005353 Ga0070669_100052643 Ga0070669_1000526432 107
37 3300005354 Ga0070675_100000934 Ga0070675_1000009347 107
38 3300005354 Ga0070675_100097014 Ga0070675_1000970143 107
39 3300005354 Ga0070675_100266208 Ga0070675_1002662082 107
40 3300005356 Ga0070674_101926252 Ga0070674_1019262521 107
41 3300005364 Ga0070673_100284004 Ga0070673_1002840041 107
42 3300005365 Ga0070688_100233501 Ga0070688_1002335012 107
43 3300005365 Ga0070688_100359398 Ga0070688_1003593983 107
44 3300005366 Ga0070659_100010774 Ga0070659_1000107745 107
45 3300005367 Ga0070667_100153157 Ga0070667_1001531574 107
46 3300005435 Ga0070714_100083194 Ga0070714_1000831943 107
47 3300005436 Ga0070713_100004662 Ga0070713_1000046625 107
48 3300005437 Ga0070710_10448106 Ga0070710_104481062 107
49 3300005438 Ga0070701_10015634 Ga0070701_100156344 107
50 3300005439 Ga0070711_100092759 Ga0070711_1000927593 107
51 3300005439 Ga0070711_100217764 Ga0070711_1002177641 107
52 3300005440 Ga0070705_100005995 Ga0070705_1000059951 107
53 3300005441 Ga0070700_100265908 Ga0070700_1002659083 107
54 3300005444 Ga0070694_100015502 Ga0070694_1000155021 107
55 3300005444 Ga0070694_100284728 Ga0070694_1002847281 107
56 3300005455 Ga0070663_100075721 Ga0070663_1000757214 107
57 3300005456 Ga0070678_100359123 Ga0070678_1003591232 107
58 3300005456 Ga0070678_102246534 Ga0070678_1022465341 107
59 3300005456 Ga0070678_102365167 Ga0070678_1023651671 107
60 3300005457 Ga0070662_100116934 Ga0070662_1001169344 107
61 3300005466 Ga0070685_10030138 Ga0070685_100301384 107
62 3300005467 Ga0070706_100039819 Ga0070706_1000398194 107
63 3300005468 Ga0070707_100364157 Ga0070707_1003641571 107
64 3300005530 Ga0070679_101956804 Ga0070679_1019568041 107
65 3300005535 Ga0070684_100004485 Ga0070684_1000044858 107
66 3300005539 Ga0068853_100229974 Ga0068853_1002299741 107
67 3300005539 Ga0068853_100553445 Ga0068853_1005534452 107
68 3300005543 Ga0070672_100013555 Ga0070672_1000135555 107
69 3300005543 Ga0070672_100231630 Ga0070672_1002316303 107
70 3300005544 Ga0070686_100004993 Ga0070686_1000049934 107
71 3300005544 Ga0070686_101919937 Ga0070686_1019199371 107
72 3300005545 Ga0070695_100499526 Ga0070695_1004995263 107
73 3300005547 Ga0070693_100216791 Ga0070693_1002167912 107
74 3300005548 Ga0070665_100156992 Ga0070665_1001569922 107
75 3300005564 Ga0070664_100049332 Ga0070664_1000493324 107
76 3300005577 Ga0068857_101195895 Ga0068857_1011958952 107
77 3300005578 Ga0068854_102061564 Ga0068854_1020615641 107
78 3300005614 Ga0068856_100003391 Ga0068856_10000339116 107
79 3300005615 Ga0070702_100008624 Ga0070702_1000086244 107
80 3300005615 Ga0070702_100289285 Ga0070702_1002892852 107
81 3300005616 Ga0068852_102316939 Ga0068852_1023169391 107
82 3300005617 Ga0068859_100032933 Ga0068859_1000329332 107
83 3300005617 Ga0068859_100048820 Ga0068859_1000488202 107
84 3300005618 Ga0068864_100022145 Ga0068864_1000221452 107
85 3300005618 Ga0068864_101356650 Ga0068864_1013566502 107
86 3300005718 Ga0068866_10160552 Ga0068866_101605522 107
87 3300005719 Ga0068861_100014100 Ga0068861_1000141003 107
88 3300005719 Ga0068861_100055480 Ga0068861_1000554801 107
89 3300005719 Ga0068861_100241025 Ga0068861_1002410252 107
90 3300005841 Ga0068863_100144668 Ga0068863_1001446682 107
91 3300005842 Ga0068858_100040312 Ga0068858_1000403124 107
92 3300005842 Ga0068858_100106146 Ga0068858_1001061461 107
93 3300005843 Ga0068860_100032207 Ga0068860_1000322072 107
94 3300005843 Ga0068860_100033255 Ga0068860_1000332553 107
95 3300005843 Ga0068860_100092724 Ga0068860_1000927242 107
96 3300005844 Ga0068862_100002858 Ga0068862_1000028583 107
97 3300005844 Ga0068862_100048049 Ga0068862_1000480499 107
98 3300006194 Ga0075427_10114692 Ga0075427_101146922 107
99 3300006237 Ga0097621_102235925 Ga0097621_1022359251 107
100 3300006358 Ga0068871_100079094 Ga0068871_1000790945 107
101 3300006358 Ga0068871_102379656 Ga0068871_1023796562 107
102 3300006844 Ga0075428_100193009 Ga0075428_1001930091 107
103 3300006844 Ga0075428_100207896 Ga0075428_1002078963 107
104 3300006846 Ga0075430_100018627 Ga0075430_1000186274 107
105 3300006846 Ga0075430_100080136 Ga0075430_1000801363 107
106 3300006846 Ga0075430_100692615 Ga0075430_1006926152 107
107 3300006847 Ga0075431_100023046 Ga0075431_1000230466 107
108 3300006847 Ga0075431_100477747 Ga0075431_1004777472 107
109 3300006852 Ga0075433_10534622 Ga0075433_105346222 107
110 3300006871 Ga0075434_100475278 Ga0075434_1004752782 107
111 3300006880 Ga0075429_100011953 Ga0075429_10001195312 107
112 3300006880 Ga0075429_101551999 Ga0075429_1015519991 107
113 3300006881 Ga0068865_100682616 Ga0068865_1006826162 107
114 3300006881 Ga0068865_101758482 Ga0068865_1017584822 107
115 3300006881 Ga0068865_101855161 Ga0068865_1018551611 107
116 3300006931 Ga0097620_100032933 Ga0097620_1000329336 107
117 3300006931 Ga0097620_100048820 Ga0097620_1000488202 107
118 3300009092 Ga0105250_10154848 Ga0105250_101548482 107
119 3300009093 Ga0105240_10001334 Ga0105240_100013348 107
120 3300009093 Ga0105240_10480048 Ga0105240_104800483 107
121 3300009093 Ga0105240_10834641 Ga0105240_108346412 107
122 3300009094 Ga0111539_10153743 Ga0111539_101537433 107
123 3300009094 Ga0111539_10881511 Ga0111539_108815112 107
124 3300009094 Ga0111539_12872708 Ga0111539_128727081 107
125 3300009098 Ga0105245_10393550 Ga0105245_103935503 107
126 3300009098 Ga0105245_10423357 Ga0105245_104233571 107
127 3300009101 Ga0105247_10025956 Ga0105247_100259561 107
128 3300009101 Ga0105247_10364896 Ga0105247_103648962 107
129 3300009101 Ga0105247_11627568 Ga0105247_116275682 107
130 3300009147 Ga0114129_10011568 Ga0114129_100115682 107
131 3300009147 Ga0114129_10603221 Ga0114129_106032213 107
132 3300009148 Ga0105243_10021344 Ga0105243_100213442 107
133 3300009174 Ga0105241_10500890 Ga0105241_105008902 107
134 3300009176 Ga0105242_10267372 Ga0105242_102673722 107
135 3300009176 Ga0105242_10438473 Ga0105242_104384732 107
136 3300009177 Ga0105248_10019723 Ga0105248_100197235 107
137 3300009177 Ga0105248_10290319 Ga0105248_102903192 107
138 3300009177 Ga0105248_10403251 Ga0105248_104032513 107
139 3300009545 Ga0105237_10062232 Ga0105237_100622325 107
140 3300009545 Ga0105237_10305069 Ga0105237_103050692 107
141 3300009551 Ga0105238_10000576 Ga0105238_1000057622 107
142 3300009551 Ga0105238_10349572 Ga0105238_103495723 107
143 3300009551 Ga0105238_10895977 Ga0105238_108959772 107
144 3300009553 Ga0105249_10015667 Ga0105249_100156674 107
145 3300009553 Ga0105249_11084539 Ga0105249_110845392 107
146 3300010375 Ga0105239_10010078 Ga0105239_100100785 107
147 3300010375 Ga0105239_10894965 Ga0105239_108949652 107
148 3300013102 Ga0157371_11397350 Ga0157371_113973501 107
149 3300013104 Ga0157370_10023824 Ga0157370_100238243 107
150 3300013104 Ga0157370_10101637 Ga0157370_101016372 107
151 3300013104 Ga0157370_11859006 Ga0157370_118590061 107
152 3300013105 Ga0157369_10811432 Ga0157369_108114322 107
153 3300013296 Ga0157374_10066426 Ga0157374_100664262 107
154 3300013297 Ga0157378_10242192 Ga0157378_102421922 107
155 3300013306 Ga0163162_10002160 Ga0163162_100021609 107
156 3300013306 Ga0163162_10017958 Ga0163162_100179584 107
157 3300013306 Ga0163162_12658773 Ga0163162_126587731 107
158 3300013308 Ga0157375_10046838 Ga0157375_100468384 107
159 3300013308 Ga0157375_10213723 Ga0157375_102137232 107
160 3300013308 Ga0157375_10835317 Ga0157375_108353172 107
161 3300014325 Ga0163163_10000787 Ga0163163_100007874 107
162 3300014325 Ga0163163_10450212 Ga0163163_104502122 107
163 3300014325 Ga0163163_12151032 Ga0163163_121510322 107
164 3300014497 Ga0182008_10017459 Ga0182008_100174594 107
165 3300014745 Ga0157377_10000749 Ga0157377_100007493 107
166 3300014968 Ga0157379_10519736 Ga0157379_105197362 107
167 3300014969 Ga0157376_10163892 Ga0157376_101638923 107
168 3300014969 Ga0157376_10504704 Ga0157376_105047042 107
169 3300014969 Ga0157376_10816483 Ga0157376_108164832 107
170 3300015262 Ga0182007_10006487 Ga0182007_100064874 107
171 3300017792 Ga0163161_10037712 Ga0163161_100377124 107
172 3300017792 Ga0163161_10875537 Ga0163161_108755371 107
173 3300025226 Ga0209674_101759 Ga0209674_1017595 107
174 3300025242 Ga0209258_104774 Ga0209258_1047743 107
175 3300025250 Ga0209026_1000113 Ga0209026_100011310 107
176 3300025256 Ga0209759_1010624 Ga0209759_10106243 107
177 3300025898 Ga0207692_10084687 Ga0207692_100846871 107
178 3300025899 Ga0207642_10229310 Ga0207642_102293102 107
179 3300025900 Ga0207710_10203700 Ga0207710_102037002 107
180 3300025903 Ga0207680_10000005 Ga0207680_10000005133 107
181 3300025903 Ga0207680_10093726 Ga0207680_100937262 107
182 3300025910 Ga0207684_10136720 Ga0207684_101367202 107
183 3300025911 Ga0207654_10295762 Ga0207654_102957622 107
184 3300025913 Ga0207695_10003395 Ga0207695_1000339515 107
185 3300025913 Ga0207695_10225427 Ga0207695_102254273 107
186 3300025915 Ga0207693_11273194 Ga0207693_112731941 107
187 3300025916 Ga0207663_10256200 Ga0207663_102562002 107
188 3300025917 Ga0207660_10297109 Ga0207660_102971093 107
189 3300025918 Ga0207662_10012621 Ga0207662_100126214 107
190 3300025918 Ga0207662_10030051 Ga0207662_100300515 107
191 3300025919 Ga0207657_10555889 Ga0207657_105558891 107
192 3300025920 Ga0207649_10037489 Ga0207649_100374895 107
193 3300025920 Ga0207649_11209409 Ga0207649_112094092 107
194 3300025923 Ga0207681_10300260 Ga0207681_103002602 107
195 3300025924 Ga0207694_10122079 Ga0207694_101220793 107
196 3300025925 Ga0207650_10015205 Ga0207650_100152054 107
197 3300025925 Ga0207650_10785487 Ga0207650_107854872 107
198 3300025926 Ga0207659_10125826 Ga0207659_101258263 107
199 3300025926 Ga0207659_10151167 Ga0207659_101511674 107
200 3300025928 Ga0207700_10012298 Ga0207700_100122983 107
201 3300025932 Ga0207690_10018142 Ga0207690_100181428 107
202 3300025933 Ga0207706_10117157 Ga0207706_101171574 107
203 3300025935 Ga0207709_10160702 Ga0207709_101607022 107
204 3300025936 Ga0207670_10037558 Ga0207670_100375583 107
205 3300025936 Ga0207670_10580535 Ga0207670_105805352 107
206 3300025936 Ga0207670_11422142 Ga0207670_114221421 107
207 3300025937 Ga0207669_10609526 Ga0207669_106095262 107
208 3300025938 Ga0207704_10014004 Ga0207704_100140042 107
209 3300025940 Ga0207691_10015433 Ga0207691_100154334 107
210 3300025941 Ga0207711_10005371 Ga0207711_100053714 107
211 3300025941 Ga0207711_10077845 Ga0207711_100778452 107
212 3300025941 Ga0207711_10279668 Ga0207711_102796683 107
213 3300025942 Ga0207689_10030153 Ga0207689_100301534 107
214 3300025945 Ga0207679_10056910 Ga0207679_100569104 107
215 3300025960 Ga0207651_10024204 Ga0207651_100242044 107
216 3300025961 Ga0207712_10002562 Ga0207712_1000256211 107
217 3300025972 Ga0207668_10017734 Ga0207668_100177346 107
218 3300025972 Ga0207668_10075919 Ga0207668_100759193 107
219 3300025981 Ga0207640_11898566 Ga0207640_118985662 107
220 3300025986 Ga0207658_10328190 Ga0207658_103281902 107
221 3300026023 Ga0207677_10125814 Ga0207677_101258141 107
222 3300026023 Ga0207677_10491349 Ga0207677_104913492 107
223 3300026035 Ga0207703_10028523 Ga0207703_100285234 107
224 3300026035 Ga0207703_10088214 Ga0207703_100882143 107
225 3300026041 Ga0207639_10071629 Ga0207639_100716294 107
226 3300026041 Ga0207639_10225093 Ga0207639_102250932 107
227 3300026067 Ga0207678_10475733 Ga0207678_104757332 107
228 3300026067 Ga0207678_10476715 Ga0207678_104767152 107
229 3300026075 Ga0207708_10038243 Ga0207708_100382433 107
230 3300026078 Ga0207702_10519409 Ga0207702_105194091 107
231 3300026088 Ga0207641_10065008 Ga0207641_100650085 107
232 3300026089 Ga0207648_10007695 Ga0207648_100076958 107
233 3300026095 Ga0207676_10038607 Ga0207676_100386072 107
234 3300026116 Ga0207674_10019603 Ga0207674_100196034 107
235 3300026116 Ga0207674_10436319 Ga0207674_104363192 107
236 3300026118 Ga0207675_100029635 Ga0207675_1000296354 107
237 3300026118 Ga0207675_100885636 Ga0207675_1008856361 107
238 3300026118 Ga0207675_101657914 Ga0207675_1016579141 107
239 3300026121 Ga0207683_10522940 Ga0207683_105229402 107
240 3300026121 Ga0207683_10550847 Ga0207683_105508472 107
241 3300026121 Ga0207683_12167365 Ga0207683_121673652 107
242 3300028379 Ga0268266_11139736 Ga0268266_111397362 107
243 3300028380 Ga0268265_10006042 Ga0268265_100060422 107
244 3300028380 Ga0268265_10008291 Ga0268265_100082919 107
245 3300028381 Ga0268264_10019237 Ga0268264_100192372 107
246 3300028381 Ga0268264_10131421 Ga0268264_101314214 107
247 3300030745 Ga0316182_1251408 Ga0316182_12514082 107
248 3300031548 Ga0307408_100003879 Ga0307408_1000038797 107
249 3300031548 Ga0307408_100004186 Ga0307408_1000041863 107
250 3300031731 Ga0307405_10316618 Ga0307405_103166183 107
251 3300031731 Ga0307405_10974900 Ga0307405_109749001 107
252 3300031824 Ga0307413_10477187 Ga0307413_104771872 107
253 3300031901 Ga0307406_10384914 Ga0307406_103849141 107
254 3300031901 Ga0307406_10559708 Ga0307406_105597082 107
255 3300032002 Ga0307416_100029934 Ga0307416_1000299342 107
256 3300032126 Ga0307415_100451815 Ga0307415_1004518152 107
257 3300033180 Ga0307510_10000038 Ga0307510_1000003886 107
258 3300035112 Ga0373932_0382623 Ga0373932_0382623_168_497 107
259 3300035691 Ga0373931_0128994 Ga0373931_0128994_634_963 107
260 3300036401 Ga0373937_0982029 Ga0373937_0982029_399_728 107
261 3300036712 Ga0316584_1178113 Ga0316584_1178113_162_491 107
262 3300038443 Ga0395901_0202973 Ga0395901_0202973_1111_1440 107
263 3300039447 Ga0436361_0352795 Ga0436361_0352795_159_488 107
264 3300042002 Ga0439442_043567 Ga0439442_043567_345_674 107
265 3300042993 Ga0439440_0053605 Ga0439440_0053605_352_681 107
266 3300044656 Ga0466969_0017783 Ga0466969_0017783_3084_3413 107
267 3300044684 Ga0466966_0043485 Ga0466966_0043485_2497_2826 107
268 3300044684 Ga0466966_0488152 Ga0466966_0488152_106_435 107
269 3300044712 Ga0453684_0549265 Ga0453684_0549265_694_1023 107
270 3300045051 Ga0451576_0394157 Ga0451576_0394157_116_445 107
271 3300045051 Ga0451576_0550258 Ga0451576_0550258_357_686 107
272 3300046530 Ga0495654_0000198 Ga0495654_0000198_15501_15830 107
273 3300046538 Ga0495609_0396073 Ga0495609_0396073_179_508 107
274 3300046558 Ga0495633_0001416 Ga0495633_0001416_14284_14613 107
275 3300046674 Ga0495588_0447472 Ga0495588_0447472_233_562 107
276 3300048905 Ga0496102_0116703 Ga0496102_0116703_2000_2329 107
277 3300048907 Ga0496104_0094467 Ga0496104_0094467_421_750 107
278 3300048907 Ga0496104_0603468 Ga0496104_0603468_26_355 107
279 3300048907 Ga0496104_1047389 Ga0496104_1047389_352_681 107
280 3300048908 Ga0496105_0522455 Ga0496105_0522455_539_868 107
281 3300048909 Ga0496106_0256375 Ga0496106_0256375_688_1017 107
282 3300048911 Ga0496108_0438345 Ga0496108_0438345_790_1119 107
283 3300048911 Ga0496108_0456062 Ga0496108_0456062_50_379 107
284 3300048916 Ga0496113_0504990 Ga0496113_0504990_487_816 107
285 3300048918 Ga0496115_0627807 Ga0496115_0627807_45_374 107
286 3300048919 Ga0496116_0005022 Ga0496116_0005022_6755_7084 107
287 3300048920 Ga0496117_0062758 Ga0496117_0062758_1611_1934 107
288 3300048921 Ga0496118_0004248 Ga0496118_0004248_10930_11253 107
289 3300048921 Ga0496118_0046026 Ga0496118_0046026_2514_2843 107
290 3300048922 Ga0496119_0005821 Ga0496119_0005821_3855_4184 107
291 3300048923 Ga0496120_0001965 Ga0496120_0001965_19436_19765 107
292 3300048924 Ga0496121_0461551 Ga0496121_0461551_292_615 107
293 3300048924 Ga0496121_0705382 Ga0496121_0705382_60_389 107
294 3300048926 Ga0496123_0007834 Ga0496123_0007834_5253_5582 107
295 3300048927 Ga0496124_0227159 Ga0496124_0227159_1035_1364 107
296 3300048928 Ga0496125_0000241 Ga0496125_0000241_54403_54732 107
297 3300049571 Ga0501034_0042817 Ga0501034_0042817_2689_3018 107
298 3300049576 Ga0501040_0643821 Ga0501040_0643821_39_368 107
299 3300049581 Ga0501047_0040308 Ga0501047_0040308_1184_1513 107
300 3300049586 Ga0501070_0879250 Ga0501070_0879250_188_517 107
301 3300049588 Ga0501072_1089913 Ga0501072_1089913_231_560 107
302 3300049679 Ga0501249_017460 Ga0501249_017460_916_1245 107
303 3300049742 Ga0501080_0486120 Ga0501080_0486120_74_403 107
304 3300049743 Ga0501081_1024069 Ga0501081_1024069_16_345 107
305 3300049766 Ga0501269_000106 Ga0501269_000106_24686_25015 107
306 3300050507 nmdc:mga05p37_16073_c1 nmdc:mga05p37_16073_c1_685_1014 107
307 3300050507 nmdc:mga05p37_994496_c1 nmdc:mga05p37_994496_c1_130_516 107
308 3300050508 nmdc:mga09592_262915_c1 nmdc:mga09592_262915_c1_658_987 107
309 3300050509 nmdc:mga0qj67_478838_c1 nmdc:mga0qj67_478838_c1_163_492 107
310 3300050509 nmdc:mga0qj67_8133_c1 nmdc:mga0qj67_8133_c1_2881_3210 107
311 3300050509 nmdc:mga0qj67_95145_c1 nmdc:mga0qj67_95145_c1_2048_2377 107
312 3300050510 nmdc:mga06r32_1073917_c1 nmdc:mga06r32_1073917_c1_135_464 107
313 3300050510 nmdc:mga06r32_13245_c1 nmdc:mga06r32_13245_c1_6109_6438 107
314 3300050510 nmdc:mga06r32_275291_c1 nmdc:mga06r32_275291_c1_658_987 107
315 3300050511 nmdc:mga08y16_389860_c1 nmdc:mga08y16_389860_c1_544_873 107
316 3300050511 nmdc:mga08y16_81596_c1 nmdc:mga08y16_81596_c1_777_1106 107
317 3300050512 nmdc:mga0n895_414735_c1 nmdc:mga0n895_414735_c1_213_542 107
318 3300050513 nmdc:mga0rr50_1009036_c1 nmdc:mga0rr50_1009036_c1_215_544 107
319 3300050513 nmdc:mga0rr50_453418_c1 nmdc:mga0rr50_453418_c1_34_363 107
320 3300050515 nmdc:mga0a205_313548_c1 nmdc:mga0a205_313548_c1_206_535 107
321 3300050515 nmdc:mga0a205_620710_c1 nmdc:mga0a205_620710_c1_86_415 107
322 3300053079 Ga0500610_0000360 Ga0500610_0000360_12922_13251 107
323 3300053158 Ga0500627_0141911 Ga0500627_0141911_207_536 107

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i45-assembly5.cif.gz_J crystal structure of protein nmb1881 from neisseria meningitidis 0.8716 28 107
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.8668 28 107
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8585 26 106
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8558 26 106
4b29-assembly1.cif.gz_A crystal structures of dmsp lyases rddddp and rndddqii 0.855 26 106
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8597 28 106 2.60.120.10
af_O94603_133_414_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.856 38 105 2.60.120.650
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.855 26 106 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8538 26 106 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8496 26 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A8B6KSK9-F1-model_v4 deleted 0.997 42 107
AF-A0A0R0MLI8-F1-model_v4 DHCW motif cupin fold protein 0.9893 1 107
AF-F4MYE7-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9871 14 107
AF-A0A081CRH5-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9865 1 107
AF-A0A1I1EC65-F1-model_v4 DHCW motif cupin fold protein 0.985 1 107

Feature Viewer

pLDDT pTM Quality
95.61 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map