F406526

General Info

Members Datasets Scaffolds Average Seq Length
322 206 644 159

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0251024|Ga0316574_0251024_441_1013
Length 190
Sequence VIQKSGVLKTGWLQFDILNIYFERRNTWHYRRIAFMAKLKINGELVNIDVDGSTPLLWVLREQLGLTGTKYSCGIGQCGSCTVLVDGESVRSCVIPVSSLTSSEEIVTIEGLSSDGSHPLQKAWAELDVPQCGYCQPGMIMSAAALLNSNPNPSDEDINARMTNICRCGTYNRVREGIHLAARLNKGGRS

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
115 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
116 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
137 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 2585428062 Methylibium sp. CF059 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 1.86
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 1.24
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0251024 3300035398 Bacteria 1130
2 MBSR1b_contig_6374870 2162886012 Bacteria 1009
3 JGI25151J46595_10080161 3300003187 Bacteria 949
4 JGI25153J46596_10001641 3300003215 Bacteria 13278
5 Ga0065715_10358402 3300005293 Bacteria 939
6 Ga0070676_10076901 3300005328 Bacteria 2016
7 Ga0070670_100058414 3300005331 Bacteria 3312
8 Ga0070680_100748115 3300005336 Bacteria 842
9 Ga0068868_100398556 3300005338 Bacteria 1187
10 Ga0070689_100618092 3300005340 Bacteria 940
11 Ga0070692_10003273 3300005345 Bacteria 6533
12 Ga0070668_100018372 3300005347 Bacteria 5249
13 Ga0070675_100078984 3300005354 Bacteria 2741
14 Ga0070675_100289966 3300005354 Bacteria 1440
15 Ga0070675_100856146 3300005354 Bacteria 832
16 Ga0070674_100003116 3300005356 Bacteria 9233
17 Ga0070673_100766299 3300005364 Bacteria 889
18 Ga0070667_100079591 3300005367 Bacteria 2802
19 Ga0070709_10065567 3300005434 Bacteria 2326
20 Ga0070713_100182628 3300005436 Bacteria 1886
21 Ga0070694_100000132 3300005444 Bacteria 37067
22 Ga0070663_100382211 3300005455 Bacteria 1147
23 Ga0068867_100570701 3300005459 Bacteria 983
24 Ga0070706_100365221 3300005467 Bacteria 1345
25 Ga0070707_100026700 3300005468 Bacteria 5485
26 Ga0070707_100238750 3300005468 Bacteria 1769
27 Ga0070699_100568152 3300005518 Bacteria 1033
28 Ga0070697_100000637 3300005536 Bacteria 26607
29 Ga0070672_100019423 3300005543 Bacteria 4932
30 Ga0070672_100444627 3300005543 Bacteria 1116
31 Ga0070696_100035215 3300005546 Bacteria 3446
32 Ga0070696_101113406 3300005546 Bacteria 664
33 Ga0070665_100166706 3300005548 Bacteria 2205
34 Ga0070704_100118239 3300005549 Bacteria 2030
35 Ga0070704_101606208 3300005549 Bacteria 599
36 Ga0068859_101367072 3300005617 Bacteria 781
37 Ga0068859_101437202 3300005617 Bacteria 761
38 Ga0068864_100664420 3300005618 Bacteria 1016
39 Ga0068863_101139973 3300005841 Bacteria 785
40 Ga0068863_101159457 3300005841 Bacteria 778
41 Ga0068858_100010923 3300005842 Bacteria 8581
42 Ga0068860_100292676 3300005843 Bacteria 1594
43 Ga0068862_100876796 3300005844 Bacteria 881
44 Ga0070717_10048294 3300006028 Bacteria 3490
45 Ga0075363_100465888 3300006048 Bacteria 748
46 Ga0075367_10079612 3300006178 Bacteria 1980
47 Ga0075366_10000833 3300006195 Bacteria 14815
48 Ga0097621_100574638 3300006237 Bacteria 1028
49 Ga0068871_100478918 3300006358 Bacteria 1119
50 Ga0075428_100162513 3300006844 Bacteria 2423
51 Ga0075431_100008476 3300006847 Bacteria 10295
52 Ga0075433_10962253 3300006852 Bacteria 744
53 Ga0075434_100109344 3300006871 Bacteria 2775
54 Ga0075434_100377455 3300006871 Bacteria 1438
55 Ga0075429_100695653 3300006880 Bacteria 890
56 Ga0097620_101366864 3300006931 Bacteria 781
57 Ga0097620_101437581 3300006931 Bacteria 761
58 Ga0075435_101357436 3300007076 Bacteria 623
59 Ga0105250_10384243 3300009092 Bacteria 620
60 Ga0105240_10004916 3300009093 Bacteria 20092
61 Ga0111539_10268301 3300009094 Bacteria 1987
62 Ga0111539_11208089 3300009094 Bacteria 878
63 Ga0105245_10338762 3300009098 Bacteria 1487
64 Ga0105245_11595905 3300009098 Bacteria 704
65 Ga0114129_10019547 3300009147 Bacteria 9645
66 Ga0105242_10829444 3300009176 Bacteria 918
67 Ga0105242_10986885 3300009176 Bacteria 849
68 Ga0105248_10964242 3300009177 Bacteria 963
69 Ga0105237_10013873 3300009545 Bacteria 8431
70 Ga0099796_10022544 3300010159 Bacteria 1954
71 Ga0099796_10090793 3300010159 Bacteria 1135
72 Ga0163162_10614737 3300013306 Bacteria 1212
73 Ga0157375_10500175 3300013308 Bacteria 1380
74 Ga0163163_11282639 3300014325 Bacteria 795
75 Ga0157380_10173940 3300014326 Bacteria 1884
76 Ga0157380_11376849 3300014326 Bacteria 755
77 Ga0157377_10307922 3300014745 Bacteria 1048
78 Ga0157379_10049724 3300014968 Bacteria 3743
79 Ga0157376_10842839 3300014969 Bacteria 932
80 Ga0163161_10176831 3300017792 Bacteria 1634
81 Ga0213872_10000330 3300021361 Bacteria 40103
82 Ga0213874_10008139 3300021377 Bacteria 2545
83 Ga0213875_10079863 3300021388 Bacteria 1526
84 Ga0209130_1042676 3300025284 Bacteria 867
85 Ga0209758_1000124 3300025297 Bacteria 189933
86 Ga0207645_10306370 3300025907 Bacteria 1058
87 Ga0207684_10087909 3300025910 Bacteria 2648
88 Ga0207695_10032651 3300025913 Bacteria 5694
89 Ga0207671_10286303 3300025914 Bacteria 1300
90 Ga0207660_11146175 3300025917 Bacteria 633
91 Ga0207646_10034184 3300025922 Bacteria 4595
92 Ga0207646_10134570 3300025922 Bacteria 2225
93 Ga0207646_11265108 3300025922 Bacteria 645
94 Ga0207659_10024810 3300025926 Bacteria 4023
95 Ga0207700_10022612 3300025928 Bacteria 4318
96 Ga0207670_10344464 3300025936 Bacteria 1179
97 Ga0207669_10017457 3300025937 Bacteria 3681
98 Ga0207669_10350348 3300025937 Bacteria 1140
99 Ga0207691_10058837 3300025940 Bacteria 3495
100 Ga0207691_10464782 3300025940 Bacteria 1076
101 Ga0207691_11739629 3300025940 Bacteria 504
102 Ga0207711_10508542 3300025941 Bacteria 1123
103 Ga0207651_11078718 3300025960 Bacteria 719
104 Ga0207668_10036745 3300025972 Bacteria 3272
105 Ga0207668_10237244 3300025972 Bacteria 1473
106 Ga0207677_10377548 3300026023 Bacteria 1195
107 Ga0207703_10041674 3300026035 Bacteria 3680
108 Ga0207639_10041677 3300026041 Bacteria 3437
109 Ga0207678_10263432 3300026067 Bacteria 1477
110 Ga0207702_10386130 3300026078 Bacteria 1347
111 Ga0207641_10516059 3300026088 Bacteria 1162
112 Ga0207641_11041227 3300026088 Bacteria 816
113 Ga0207648_10575193 3300026089 Bacteria 1037
114 Ga0209966_1000113 3300027695 Bacteria 35785
115 Ga0268266_10177979 3300028379 Bacteria 1935
116 Ga0268265_10786400 3300028380 Bacteria 926
117 Ga0268265_11062791 3300028380 Bacteria 802
118 Ga0268264_11263563 3300028381 Bacteria 748
119 Ga0307515_10000109 3300028794 Bacteria 195895
120 Ga0307515_10036757 3300028794 Bacteria 7907
121 Ga0307515_10090338 3300028794 Bacteria 3842
122 Ga0307515_10292886 3300028794 Bacteria 1321
123 Ga0265328_10030542 3300031239 Bacteria 2007
124 Ga0265331_10002520 3300031250 Bacteria 12346
125 Ga0265327_10000083 3300031251 Bacteria 204923
126 Ga0307513_10001393 3300031456 Bacteria 34808
127 Ga0307513_10018336 3300031456 Bacteria 8367
128 Ga0307513_10049369 3300031456 Bacteria 4559
129 Ga0307513_10988711 3300031456 Bacteria 551
130 Ga0307408_101059088 3300031548 Bacteria 750
131 Ga0307508_10000101 3300031616 Bacteria 100858
132 Ga0307514_10000780 3300031649 Bacteria 52828
133 Ga0307514_10070504 3300031649 Bacteria 2624
134 Ga0307514_10284427 3300031649 Bacteria 943
135 Ga0316575_10004668 3300031665 Bacteria 4828
136 Ga0316575_10015743 3300031665 Bacteria 2854
137 Ga0316575_10031227 3300031665 Bacteria 2085
138 Ga0316579_10016794 3300031691 Bacteria 3203
139 Ga0316579_10019499 3300031691 Bacteria 2998
140 Ga0316579_10029538 3300031691 Bacteria 2502
141 Ga0316579_10034472 3300031691 Bacteria 2329
142 Ga0316579_10287502 3300031691 Bacteria 795
143 Ga0316576_10000410 3300031727 Bacteria 19795
144 Ga0316576_10004331 3300031727 Bacteria 8491
145 Ga0316576_10011035 3300031727 Bacteria 5898
146 Ga0316576_10034186 3300031727 Bacteria 3622
147 Ga0316576_10106907 3300031727 Bacteria 2095
148 Ga0316576_10173447 3300031727 Bacteria 1627
149 Ga0316576_10222362 3300031727 Bacteria 1420
150 Ga0316576_10361547 3300031727 Bacteria 1079
151 Ga0316576_10485042 3300031727 Bacteria 910
152 Ga0316576_10498599 3300031727 Bacteria 896
153 Ga0316578_10002722 3300031728 Bacteria 7862
154 Ga0316578_10026480 3300031728 Bacteria 3271
155 Ga0316578_10050856 3300031728 Bacteria 2425
156 Ga0316578_10056687 3300031728 Bacteria 2301
157 Ga0316578_10149644 3300031728 Bacteria 1406
158 Ga0316578_10462122 3300031728 Bacteria 749
159 Ga0307516_10008523 3300031730 Bacteria 11583
160 Ga0307516_10045675 3300031730 Bacteria 4324
161 Ga0316577_10007400 3300031733 Bacteria 5857
162 Ga0316577_10010120 3300031733 Bacteria 5082
163 Ga0316577_10013474 3300031733 Bacteria 4471
164 Ga0316577_10126086 3300031733 Bacteria 1439
165 Ga0316577_10767336 3300031733 Unclassified 547
166 Ga0307413_10261334 3300031824 Bacteria 1291
167 Ga0307416_100295900 3300032002 Bacteria 1605
168 Ga0307414_10685665 3300032004 Bacteria 926
169 Ga0316583_10005758 3300032133 Bacteria 4455
170 Ga0316583_10102096 3300032133 Bacteria 1000
171 Ga0316583_10122817 3300032133 Bacteria 905
172 Ga0316583_10258126 3300032133 Bacteria 603
173 Ga0316585_10010161 3300032137 Bacteria 2758
174 Ga0316585_10035635 3300032137 Bacteria 1576
175 Ga0316585_10221522 3300032137 Bacteria 626
176 Ga0316580_10001737 3300032139 Bacteria 5812
177 Ga0316580_10022196 3300032139 Bacteria 1958
178 Ga0316580_10022604 3300032139 Bacteria 1940
179 Ga0316580_10026201 3300032139 Bacteria 1802
180 Ga0316580_10045049 3300032139 Bacteria 1360
181 Ga0316580_10054144 3300032139 Unclassified 1235
182 Ga0316593_10040326 3300032168 Bacteria 1551
183 Ga0316593_10190661 3300032168 Bacteria 755
184 Ga0316593_10319907 3300032168 Bacteria 590
185 Ga0307507_10074944 3300033179 Bacteria 3031
186 Ga0316592_1001004 3300033524 Bacteria 4353
187 Ga0316588_1035192 3300033528 Bacteria 1186
188 Ga0316587_1002760 3300033529 Bacteria 2386
189 Ga0373945_0128667 3300035116 Bacteria 1013
190 Ga0373943_0201662 3300035170 Bacteria 1101
191 Ga0373946_0005506 3300035171 Bacteria 4570
192 Ga0316574_0003449 3300035398 Bacteria 8150
193 Ga0316574_0016271 3300035398 Bacteria 4331
194 Ga0316574_0035381 3300035398 Bacteria 3052
195 Ga0316574_0061533 3300035398 Bacteria 2357
196 Ga0316574_0107980 3300035398 Bacteria 1783
197 Ga0316574_0587527 3300035398 Bacteria 689
198 Ga0373927_0015070 3300035695 Bacteria 5111
199 Ga0373927_0100208 3300035695 Bacteria 1884
200 Ga0373947_0030768 3300035725 Bacteria 3155
201 Ga0373937_0174961 3300036401 Bacteria 2015
202 Ga0373937_1089986 3300036401 Bacteria 747
203 Ga0316582_0002577 3300036647 Bacteria 8590
204 Ga0316582_0052707 3300036647 Bacteria 2586
205 Ga0316582_0072738 3300036647 Bacteria 2229
206 Ga0316582_0084844 3300036647 Bacteria 2074
207 Ga0316582_0189732 3300036647 Bacteria 1400
208 Ga0316582_0416204 3300036647 Bacteria 926
209 Ga0316582_0727402 3300036647 Bacteria 681
210 Ga0316584_0004763 3300036712 Bacteria 8996
211 Ga0316584_0008500 3300036712 Bacteria 7074
212 Ga0316584_0015582 3300036712 Bacteria 5438
213 Ga0316584_0031061 3300036712 Bacteria 3950
214 Ga0316584_0040304 3300036712 Bacteria 3479
215 Ga0316584_0042931 3300036712 Bacteria 3371
216 Ga0316584_0122601 3300036712 Bacteria 1942
217 Ga0316584_0144901 3300036712 Bacteria 1770
218 Ga0316584_0355017 3300036712 Bacteria 1052
219 Ga0373925_0000109 3300037068 Bacteria 88645
220 Ga0373925_0038453 3300037068 Bacteria 3538
221 Ga0373925_0746338 3300037068 Bacteria 807
222 Ga0395905_1074102 3300037471 Bacteria 708
223 Ga0316581_0013030 3300037588 Bacteria 2352
224 Ga0436364_1184545 3300037853 Bacteria 1357
225 Ga0436364_1273190 3300037853 Bacteria 5140
226 Ga0400489_15555 3300039093 Bacteria 3550
227 Ga0436365_0070412 3300039437 Bacteria 1064
228 Ga0436361_0182416 3300039447 Bacteria 55509
229 Ga0451787_551561 3300041441 Bacteria 1176
230 Ga0451789_0234456 3300041443 Bacteria 1388
231 Ga0451807_0359614 3300041486 Bacteria 1609
232 Ga0451807_2130344 3300041486 Bacteria 1512
233 Ga0439455_0028462 3300042012 Bacteria 1376
234 Ga0439458_0036372 3300042157 Bacteria 1185
235 Ga0439435_0009783 3300042436 Bacteria 2258
236 Ga0453684_0759598 3300044712 Bacteria 1049
237 Ga0495592_0100134 3300046454 Bacteria 2066
238 Ga0495603_0055060 3300046455 Bacteria 2357
239 Ga0495629_0000004 3300046459 Bacteria 433516
240 Ga0495629_0000013 3300046459 Bacteria 212317
241 Ga0495629_0387368 3300046459 Bacteria 951
242 Ga0495641_0072580 3300046461 Bacteria 1544
243 Ga0495580_0043734 3300046472 Bacteria 3187
244 Ga0495582_0001319 3300046473 Bacteria 13914
245 Ga0495639_0000927 3300046475 Bacteria 13254
246 Ga0495639_0006729 3300046475 Bacteria 4944
247 Ga0495584_0094745 3300046491 Bacteria 1507
248 Ga0495585_0000070 3300046492 Bacteria 106156
249 Ga0495594_0008860 3300046499 Bacteria 5189
250 Ga0495596_0002007 3300046500 Bacteria 11201
251 Ga0495583_0056220 3300046506 Bacteria 1776
252 Ga0495608_0397367 3300046511 Bacteria 843
253 Ga0495620_0033243 3300046515 Bacteria 2343
254 Ga0495631_0019284 3300046518 Bacteria 3199
255 Ga0495643_0002153 3300046522 Bacteria 16186
256 Ga0495643_0058503 3300046522 Bacteria 2051
257 Ga0495643_0080315 3300046522 Bacteria 1698
258 Ga0495644_0087289 3300046523 Bacteria 1176
259 Ga0495666_0000018 3300046526 Bacteria 65708
260 Ga0495642_0089290 3300046528 Bacteria 1304
261 Ga0495640_0040594 3300046533 Bacteria 3258
262 Ga0495640_0127686 3300046533 Bacteria 1648
263 Ga0495586_0002172 3300046535 Bacteria 10661
264 Ga0495609_0000803 3300046538 Bacteria 23487
265 Ga0495609_0009091 3300046538 Bacteria 4825
266 Ga0495622_0003684 3300046557 Bacteria 7179
267 Ga0495622_0262094 3300046557 Bacteria 758
268 Ga0495633_0123716 3300046558 Bacteria 1198
269 Ga0495633_0136450 3300046558 Bacteria 1135
270 Ga0495633_0261876 3300046558 Bacteria 788
271 Ga0495634_0004658 3300046642 Bacteria 10679
272 Ga0495611_0029328 3300046648 Bacteria 2412
273 Ga0495625_0020773 3300046660 Bacteria 5062
274 Ga0495635_0000689 3300046663 Bacteria 21757
275 Ga0495635_0002981 3300046663 Bacteria 11611
276 Ga0495658_0000018 3300046683 Bacteria 93319
277 Ga0495658_0019676 3300046683 Bacteria 3527
278 Ga0495658_0199123 3300046683 Bacteria 1248
279 Ga0495613_0001947 3300046689 Bacteria 15665
280 Ga0495613_0239168 3300046689 Bacteria 1270
281 Ga0495624_0094971 3300046690 Bacteria 1838
282 Ga0495670_0008534 3300046691 Bacteria 5044
283 Ga0495600_0003724 3300046809 Bacteria 9015
284 Ga0495660_0029782 3300046810 Bacteria 3078
285 Ga0495581_0000658 3300047315 Bacteria 18149
286 Ga0495581_0116506 3300047315 Bacteria 1553
287 Ga0495672_0018918 3300047320 Bacteria 4558
288 Ga0495676_0009505 3300047321 Bacteria 8855
289 Ga0495676_0200804 3300047321 Bacteria 1385
290 Ga0495680_0000214 3300047322 Bacteria 63113
291 Ga0495680_0001243 3300047322 Bacteria 27950
292 Ga0495687_005338 3300047443 Bacteria 8231
293 Ga0495677_0036912 3300047445 Bacteria 1785
294 Ga0495593_0036775 3300047673 Bacteria 2653
295 Ga0495593_0232517 3300047673 Bacteria 924
296 Ga0495614_0009553 3300048089 Bacteria 4288
297 Ga0495615_0166485 3300048090 Bacteria 665
298 Ga0501048_1199349 3300049582 Bacteria 546
299 Ga0501076_0586673 3300049592 Bacteria 919
300 Ga0501079_1266603 3300049741 Bacteria 581
301 Ga0501079_1277190 3300049741 Bacteria 578
302 Ga0501035_1464111 3300049822 Bacteria 522
303 nmdc:mga0k408_396_c1 3300050493 Bacteria 23854
304 nmdc:mga0k408_710343_c1 3300050493 Bacteria 589
305 nmdc:mga06z11_63443_c1 3300050494 Bacteria 1933
306 nmdc:mga05p37_503842_c1 3300050507 Bacteria 1389
307 nmdc:mga05p37_955890_c1 3300050507 Bacteria 916
308 nmdc:mga09592_186865_c1 3300050508 Bacteria 1793
309 nmdc:mga06r32_4479_c1 3300050510 Bacteria 10624
310 nmdc:mga08y16_1442957_c1 3300050511 Bacteria 650
311 nmdc:mga0rr50_1280268_c1 3300050513 Bacteria 622
312 nmdc:mga0a205_621913_c1 3300050515 Bacteria 932
313 Ga0495619_0146154 3300053085 Bacteria 1630
314 Ga0495619_0152078 3300053085 Bacteria 1596
315 Ga0500644_0024408 3300053088 Bacteria 1848
316 Ga0500658_0043182 3300053134 Bacteria 1815
317 Ga0500622_0003132 3300053156 Bacteria 11352
318 Ga0500587_000458 3300053739 Bacteria 4843
319 Ga0590071_021514 3300059421 Bacteria 1520
320 Ga0590074_006761 3300059423 Bacteria 1905
321 Ga0501082_1083668 3300060353 Bacteria 700
322 2587759902 2585428062 Bacteria 6842168
323 Ga0316574_0251024
324 MBSR1b_contig_6374870
325 JGI25151J46595_10080161
326 JGI25153J46596_10001641
327 Ga0065715_10358402
328 Ga0070676_10076901
329 Ga0070670_100058414
330 Ga0070680_100748115
331 Ga0068868_100398556
332 Ga0070689_100618092
333 Ga0070692_10003273
334 Ga0070668_100018372
335 Ga0070675_100078984
336 Ga0070675_100289966
337 Ga0070675_100856146
338 Ga0070674_100003116
339 Ga0070673_100766299
340 Ga0070667_100079591
341 Ga0070709_10065567
342 Ga0070713_100182628
343 Ga0070694_100000132
344 Ga0070663_100382211
345 Ga0068867_100570701
346 Ga0070706_100365221
347 Ga0070707_100026700
348 Ga0070707_100238750
349 Ga0070699_100568152
350 Ga0070697_100000637
351 Ga0070672_100019423
352 Ga0070672_100444627
353 Ga0070696_100035215
354 Ga0070696_101113406
355 Ga0070665_100166706
356 Ga0070704_100118239
357 Ga0070704_101606208
358 Ga0068859_101367072
359 Ga0068859_101437202
360 Ga0068864_100664420
361 Ga0068863_101139973
362 Ga0068863_101159457
363 Ga0068858_100010923
364 Ga0068860_100292676
365 Ga0068862_100876796
366 Ga0070717_10048294
367 Ga0075363_100465888
368 Ga0075367_10079612
369 Ga0075366_10000833
370 Ga0097621_100574638
371 Ga0068871_100478918
372 Ga0075428_100162513
373 Ga0075431_100008476
374 Ga0075433_10962253
375 Ga0075434_100109344
376 Ga0075434_100377455
377 Ga0075429_100695653
378 Ga0097620_101366864
379 Ga0097620_101437581
380 Ga0075435_101357436
381 Ga0105250_10384243
382 Ga0105240_10004916
383 Ga0111539_10268301
384 Ga0111539_11208089
385 Ga0105245_10338762
386 Ga0105245_11595905
387 Ga0114129_10019547
388 Ga0105242_10829444
389 Ga0105242_10986885
390 Ga0105248_10964242
391 Ga0105237_10013873
392 Ga0099796_10022544
393 Ga0099796_10090793
394 Ga0163162_10614737
395 Ga0157375_10500175
396 Ga0163163_11282639
397 Ga0157380_10173940
398 Ga0157380_11376849
399 Ga0157377_10307922
400 Ga0157379_10049724
401 Ga0157376_10842839
402 Ga0163161_10176831
403 Ga0213872_10000330
404 Ga0213874_10008139
405 Ga0213875_10079863
406 Ga0209130_1042676
407 Ga0209758_1000124
408 Ga0207645_10306370
409 Ga0207684_10087909
410 Ga0207695_10032651
411 Ga0207671_10286303
412 Ga0207660_11146175
413 Ga0207646_10034184
414 Ga0207646_10134570
415 Ga0207646_11265108
416 Ga0207659_10024810
417 Ga0207700_10022612
418 Ga0207670_10344464
419 Ga0207669_10017457
420 Ga0207669_10350348
421 Ga0207691_10058837
422 Ga0207691_10464782
423 Ga0207691_11739629
424 Ga0207711_10508542
425 Ga0207651_11078718
426 Ga0207668_10036745
427 Ga0207668_10237244
428 Ga0207677_10377548
429 Ga0207703_10041674
430 Ga0207639_10041677
431 Ga0207678_10263432
432 Ga0207702_10386130
433 Ga0207641_10516059
434 Ga0207641_11041227
435 Ga0207648_10575193
436 Ga0209966_1000113
437 Ga0268266_10177979
438 Ga0268265_10786400
439 Ga0268265_11062791
440 Ga0268264_11263563
441 Ga0307515_10000109
442 Ga0307515_10036757
443 Ga0307515_10090338
444 Ga0307515_10292886
445 Ga0265328_10030542
446 Ga0265331_10002520
447 Ga0265327_10000083
448 Ga0307513_10001393
449 Ga0307513_10018336
450 Ga0307513_10049369
451 Ga0307513_10988711
452 Ga0307408_101059088
453 Ga0307508_10000101
454 Ga0307514_10000780
455 Ga0307514_10070504
456 Ga0307514_10284427
457 Ga0316575_10004668
458 Ga0316575_10015743
459 Ga0316575_10031227
460 Ga0316579_10016794
461 Ga0316579_10019499
462 Ga0316579_10029538
463 Ga0316579_10034472
464 Ga0316579_10287502
465 Ga0316576_10000410
466 Ga0316576_10004331
467 Ga0316576_10011035
468 Ga0316576_10034186
469 Ga0316576_10106907
470 Ga0316576_10173447
471 Ga0316576_10222362
472 Ga0316576_10361547
473 Ga0316576_10485042
474 Ga0316576_10498599
475 Ga0316578_10002722
476 Ga0316578_10026480
477 Ga0316578_10050856
478 Ga0316578_10056687
479 Ga0316578_10149644
480 Ga0316578_10462122
481 Ga0307516_10008523
482 Ga0307516_10045675
483 Ga0316577_10007400
484 Ga0316577_10010120
485 Ga0316577_10013474
486 Ga0316577_10126086
487 Ga0316577_10767336
488 Ga0307413_10261334
489 Ga0307416_100295900
490 Ga0307414_10685665
491 Ga0316583_10005758
492 Ga0316583_10102096
493 Ga0316583_10122817
494 Ga0316583_10258126
495 Ga0316585_10010161
496 Ga0316585_10035635
497 Ga0316585_10221522
498 Ga0316580_10001737
499 Ga0316580_10022196
500 Ga0316580_10022604
501 Ga0316580_10026201
502 Ga0316580_10045049
503 Ga0316580_10054144
504 Ga0316593_10040326
505 Ga0316593_10190661
506 Ga0316593_10319907
507 Ga0307507_10074944
508 Ga0316592_1001004
509 Ga0316588_1035192
510 Ga0316587_1002760
511 Ga0373945_0128667
512 Ga0373943_0201662
513 Ga0373946_0005506
514 Ga0316574_0003449
515 Ga0316574_0016271
516 Ga0316574_0035381
517 Ga0316574_0061533
518 Ga0316574_0107980
519 Ga0316574_0587527
520 Ga0373927_0015070
521 Ga0373927_0100208
522 Ga0373947_0030768
523 Ga0373937_0174961
524 Ga0373937_1089986
525 Ga0316582_0002577
526 Ga0316582_0052707
527 Ga0316582_0072738
528 Ga0316582_0084844
529 Ga0316582_0189732
530 Ga0316582_0416204
531 Ga0316582_0727402
532 Ga0316584_0004763
533 Ga0316584_0008500
534 Ga0316584_0015582
535 Ga0316584_0031061
536 Ga0316584_0040304
537 Ga0316584_0042931
538 Ga0316584_0122601
539 Ga0316584_0144901
540 Ga0316584_0355017
541 Ga0373925_0000109
542 Ga0373925_0038453
543 Ga0373925_0746338
544 Ga0395905_1074102
545 Ga0316581_0013030
546 Ga0436364_1184545
547 Ga0436364_1273190
548 Ga0400489_15555
549 Ga0436365_0070412
550 Ga0436361_0182416
551 Ga0451787_551561
552 Ga0451789_0234456
553 Ga0451807_0359614
554 Ga0451807_2130344
555 Ga0439455_0028462
556 Ga0439458_0036372
557 Ga0439435_0009783
558 Ga0453684_0759598
559 Ga0495592_0100134
560 Ga0495603_0055060
561 Ga0495629_0000004
562 Ga0495629_0000013
563 Ga0495629_0387368
564 Ga0495641_0072580
565 Ga0495580_0043734
566 Ga0495582_0001319
567 Ga0495639_0000927
568 Ga0495639_0006729
569 Ga0495584_0094745
570 Ga0495585_0000070
571 Ga0495594_0008860
572 Ga0495596_0002007
573 Ga0495583_0056220
574 Ga0495608_0397367
575 Ga0495620_0033243
576 Ga0495631_0019284
577 Ga0495643_0002153
578 Ga0495643_0058503
579 Ga0495643_0080315
580 Ga0495644_0087289
581 Ga0495666_0000018
582 Ga0495642_0089290
583 Ga0495640_0040594
584 Ga0495640_0127686
585 Ga0495586_0002172
586 Ga0495609_0000803
587 Ga0495609_0009091
588 Ga0495622_0003684
589 Ga0495622_0262094
590 Ga0495633_0123716
591 Ga0495633_0136450
592 Ga0495633_0261876
593 Ga0495634_0004658
594 Ga0495611_0029328
595 Ga0495625_0020773
596 Ga0495635_0000689
597 Ga0495635_0002981
598 Ga0495658_0000018
599 Ga0495658_0019676
600 Ga0495658_0199123
601 Ga0495613_0001947
602 Ga0495613_0239168
603 Ga0495624_0094971
604 Ga0495670_0008534
605 Ga0495600_0003724
606 Ga0495660_0029782
607 Ga0495581_0000658
608 Ga0495581_0116506
609 Ga0495672_0018918
610 Ga0495676_0009505
611 Ga0495676_0200804
612 Ga0495680_0000214
613 Ga0495680_0001243
614 Ga0495687_005338
615 Ga0495677_0036912
616 Ga0495593_0036775
617 Ga0495593_0232517
618 Ga0495614_0009553
619 Ga0495615_0166485
620 Ga0501048_1199349
621 Ga0501076_0586673
622 Ga0501079_1266603
623 Ga0501079_1277190
624 Ga0501035_1464111
625 nmdc:mga0k408_396_c1
626 nmdc:mga0k408_710343_c1
627 nmdc:mga06z11_63443_c1
628 nmdc:mga05p37_503842_c1
629 nmdc:mga05p37_955890_c1
630 nmdc:mga09592_186865_c1
631 nmdc:mga06r32_4479_c1
632 nmdc:mga08y16_1442957_c1
633 nmdc:mga0rr50_1280268_c1
634 nmdc:mga0a205_621913_c1
635 Ga0495619_0146154
636 Ga0495619_0152078
637 Ga0500644_0024408
638 Ga0500658_0043182
639 Ga0500622_0003132
640 Ga0500587_000458
641 Ga0590071_021514
642 Ga0590074_006761
643 Ga0501082_1083668
644 2587759902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

108

179

0.93

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

39

108

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9706 2 145
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9417 2 145
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9397 1 145
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9354 1 145
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9222 2 145
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9602 80 145 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9564 80 145 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9539 2 70 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9523 1 72 3.10.20.30
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9512 80 145 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7W4YZC0-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9929 1 145 GO:0046872
GO:0047121
GO:0051537
AF-A0A4R6QH94-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit 0.9922 1 145 GO:0016491
GO:0046872
GO:0051537
AF-A0A536SFY5-F1-model_v4 (2Fe-2S)-binding protein 0.9903 1 137 GO:0016491
GO:0046872
GO:0051537
AF-A0A5E7AGH8-F1-model_v4 Uncharacterized protein 0.9897 1 145 GO:0016491
GO:0046872
GO:0051537
AF-A0A560RIE9-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit 0.9895 1 145 GO:0016491
GO:0046872
GO:0051537

Map