F406218

General Info

Members Datasets Scaffolds Average Seq Length
321 242 314 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221551|2643777808
Length 322
Sequence TDGDVAPVVHNEDILGESPFWDWRTGYLYWVDLRKPALHRLDPATGVVQSWGMPSFIGCVVGRRSGGVVVGLADGLYAFAPENGGLSRLLPLEADVADHRLNDAKCDAQGALWIGTMRDFGRAPTGRLYRIAPDLSVSVIRRDVSVPNAICFSPDGGTLYFTDSRLGTLESATLDAQRQGVAQWKTILSASRFPGSPDGATVDAEGLIWHARYGGGAIVRLASDGRIDRELKLPVSQPTSCAFGGPDLSTLYVTTARQGLSAAQLACEPLAGALFAVGLEVQGRREPLFGGGSVSADAGNEAASFPGLVGKAGIGSRRLQGA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
4 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
5 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
6 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
7 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
65 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
130 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.97
Nodule 0.93
Rhizoplane 4.98
Rhizosphere 73.52
Stem 0
Stem Tuber 0
Unclassified 10.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10021026 3300003316 Bacteria 3334
2 rootH2_10022456 3300003320 Bacteria 4171
3 rootL2_10005700 3300003322 Bacteria 43298
4 rootH1_10014124 3300003323 Bacteria 12978
5 rootH1_10070857 3300003323 Bacteria 5678
6 rootH1_10285299 3300003323 Bacteria 1397
7 Ga0055524_1000117 3300003775 Bacteria 93643
8 Ga0055524_1010141 3300003775 Bacteria 3772
9 Ga0055536_1006931 3300003781 Bacteria 5164
10 Ga0055531_10001270 3300003794 Bacteria 19088
11 Ga0055531_10010274 3300003794 Bacteria 4675
12 Ga0065714_10064734 3300005288 Bacteria 20744
13 Ga0065704_10217289 3300005289 Bacteria 1086
14 Ga0070683_100020539 3300005329 Bacteria 5876
15 Ga0070670_100010028 3300005331 Bacteria 8086
16 Ga0070670_100060395 3300005331 Bacteria 3255
17 Ga0070670_100200414 3300005331 Unclassified 1734
18 Ga0070680_100085421 3300005336 Bacteria 2607
19 Ga0070689_100075676 3300005340 Bacteria 2636
20 Ga0070669_100007229 3300005353 Bacteria 7969
21 Ga0070669_100367928 3300005353 Bacteria 1170
22 Ga0070671_100041815 3300005355 Bacteria 3809
23 Ga0070673_100183411 3300005364 Bacteria 1793
24 Ga0070659_100111860 3300005366 Bacteria 2205
25 Ga0070681_10033293 3300005458 Bacteria 5173
26 Ga0070685_10077290 3300005466 Bacteria 1987
27 Ga0070679_100297497 3300005530 Bacteria 1565
28 Ga0068853_100186935 3300005539 Bacteria 1881
29 Ga0070672_100211287 3300005543 Bacteria 1625
30 Ga0070686_100054466 3300005544 Unclassified 2559
31 Ga0070665_100000539 3300005548 Bacteria 53334
32 Ga0068855_100003278 3300005563 Bacteria 19819
33 Ga0068855_100238755 3300005563 Bacteria 2032
34 Ga0070664_100258405 3300005564 Bacteria 1567
35 Ga0068858_100162013 3300005842 Bacteria 2106
36 Ga0068860_100196784 3300005843 Bacteria 1952
37 Ga0068860_100824948 3300005843 Unclassified 941
38 Ga0068862_100021187 3300005844 Bacteria 5433
39 Ga0081455_10001461 3300005937 Bacteria 29251
40 Ga0081538_10031861 3300005981 Bacteria 3546
41 Ga0081540_1014921 3300005983 Bacteria 4942
42 Ga0075432_10028988 3300006058 Unclassified 1910
43 Ga0070712_100100776 3300006175 Unclassified 2135
44 Ga0075367_10099783 3300006178 Bacteria 1773
45 Ga0097621_100132008 3300006237 Unclassified 2127
46 Ga0075428_100296497 3300006844 Unclassified 1739
47 Ga0075430_100036529 3300006846 Bacteria 4165
48 Ga0075431_100050605 3300006847 Bacteria 4283
49 Ga0075433_10117334 3300006852 Bacteria 2361
50 Ga0075434_100011990 3300006871 Bacteria 8201
51 Ga0075434_100072973 3300006871 Bacteria 3424
52 Ga0075429_100061582 3300006880 Bacteria 3269
53 Ga0075429_100237364 3300006880 Bacteria 1597
54 Ga0099823_1024517 3300006944 Bacteria 5450
55 Ga0075435_100009852 3300007076 Bacteria 6954
56 Ga0099794_10016556 3300007265 Bacteria 3271
57 Ga0105240_10002317 3300009093 Bacteria 30815
58 Ga0105240_10050308 3300009093 Bacteria 5255
59 Ga0105240_10352140 3300009093 Bacteria 1670
60 Ga0111539_10009138 3300009094 Bacteria 12536
61 Ga0111539_10044798 3300009094 Bacteria 5298
62 Ga0111539_10244069 3300009094 Bacteria 2091
63 Ga0105245_10115612 3300009098 Bacteria 2500
64 Ga0105247_10004735 3300009101 Bacteria 8661
65 Ga0105247_10124797 3300009101 Bacteria 1672
66 Ga0114129_10147520 3300009147 Plasmid 3221
67 Ga0114129_10241966 3300009147 Bacteria 2425
68 Ga0105241_10440289 3300009174 Bacteria 1151
69 Ga0105242_10182406 3300009176 Bacteria 1853
70 Ga0105237_10013426 3300009545 Bacteria 8591
71 Ga0105237_10055629 3300009545 Bacteria 3963
72 Ga0105238_10055083 3300009551 Bacteria 3993
73 Ga0105238_10411238 3300009551 Bacteria 1347
74 Ga0105238_10568257 3300009551 Bacteria 1139
75 Ga0105239_10017076 3300010375 Bacteria 8023
76 Ga0105239_10074945 3300010375 Bacteria 3721
77 Ga0105239_10120452 3300010375 Bacteria 2914
78 Ga0105239_10172226 3300010375 Bacteria 2421
79 Ga0105246_10070332 3300011119 Bacteria 2461
80 Ga0157319_1000026 3300012497 Bacteria 63349
81 Ga0157338_1004654 3300012515 Unclassified 1197
82 Ga0157373_10000918 3300013100 Bacteria 22841
83 Ga0157373_10001440 3300013100 Bacteria 18161
84 Ga0157369_10051199 3300013105 Bacteria 4469
85 Ga0157374_10093468 3300013296 Bacteria 2871
86 Ga0157374_10538690 3300013296 Bacteria 1174
87 Ga0157378_10075125 3300013297 Bacteria 3042
88 Ga0163162_10008269 3300013306 Bacteria 10154
89 Ga0163162_10050630 3300013306 Bacteria 4165
90 Ga0163162_10422826 3300013306 Bacteria 1465
91 Ga0157375_10022515 3300013308 Bacteria 5799
92 Ga0163163_10009356 3300014325 Bacteria 8747
93 Ga0163163_10315847 3300014325 Unclassified 1616
94 Ga0157379_10016849 3300014968 Bacteria 6431
95 Ga0157379_10045242 3300014968 Bacteria 3930
96 Ga0157376_10018380 3300014969 Bacteria 5358
97 Ga0213872_10000936 3300021361 Bacteria 20522
98 Ga0209677_101668 3300025253 Bacteria 9325
99 Ga0209673_1005291 3300025273 Bacteria 6552
100 Ga0209673_1005680 3300025273 Bacteria 6228
101 Ga0209050_1005305 3300025298 Bacteria 8187
102 Ga0209256_1000075 3300025299 Bacteria 236149
103 Ga0209256_1001231 3300025299 Bacteria 28445
104 Ga0209256_1028057 3300025299 Bacteria 1595
105 Ga0209051_1002494 3300025303 Bacteria 13124
106 Ga0209257_1000244 3300025304 Bacteria 126098
107 Ga0209257_1000602 3300025304 Bacteria 59626
108 Ga0209257_1007874 3300025304 Bacteria 6274
109 Ga0207710_10006387 3300025900 Bacteria 5038
110 Ga0207710_10071308 3300025900 Bacteria 1593
111 Ga0207688_10027287 3300025901 Bacteria 3141
112 Ga0207707_10137314 3300025912 Bacteria 2138
113 Ga0207695_10026095 3300025913 Bacteria 6526
114 Ga0207695_10038544 3300025913 Bacteria 5143
115 Ga0207695_10066352 3300025913 Bacteria 3706
116 Ga0207671_10261140 3300025914 Bacteria 1363
117 Ga0207652_10128468 3300025921 Bacteria 2259
118 Ga0207681_10306101 3300025923 Bacteria 1259
119 Ga0207687_10130295 3300025927 Bacteria 1894
120 Ga0207644_10018498 3300025931 Bacteria 4715
121 Ga0207690_10058157 3300025932 Bacteria 2614
122 Ga0207661_10215814 3300025944 Unclassified 1693
123 Ga0207703_10129154 3300026035 Bacteria 2180
124 Ga0207639_10085471 3300026041 Bacteria 2509
125 Ga0207639_10113095 3300026041 Bacteria 2217
126 Ga0207678_10062590 3300026067 Bacteria 3198
127 Ga0209389_1028592 3300027296 Bacteria 4771
128 Ga0207428_10007072 3300027907 Bacteria 10273
129 Ga0268266_10001556 3300028379 Bacteria 26833
130 Ga0268265_10034284 3300028380 Bacteria 3698
131 Ga0268265_10331026 3300028380 Bacteria 1383
132 Ga0307517_10094403 3300028786 Bacteria 2416
133 Ga0265338_10025831 3300028800 Bacteria 5944
134 Ga0265331_10031165 3300031250 Bacteria 2651
135 Ga0307513_10186803 3300031456 Bacteria 1929
136 Ga0307513_10239804 3300031456 Bacteria 1619
137 Ga0307509_10337045 3300031507 Bacteria 1237
138 Ga0307408_100002967 3300031548 Bacteria 11753
139 Ga0307408_100009251 3300031548 Bacteria 6495
140 Ga0307414_10059209 3300032004 Bacteria 2703
141 Ga0373948_0011516 3300034817 Bacteria 1565
142 Ga0373928_0006678 3300035084 Unclassified 2220
143 Ga0373929_0007469 3300035085 Bacteria 1997
144 Ga0373944_0069450 3300035089 Unclassified 1145
145 Ga0373949_0002949 3300035090 Bacteria 4189
146 Ga0373932_0002387 3300035112 Bacteria 4767
147 Ga0373936_0052357 3300035113 Bacteria 1654
148 Ga0373953_0111058 3300035117 Bacteria 1159
149 Ga0373954_0015190 3300035118 Bacteria 3440
150 Ga0373960_0006269 3300035121 Plasmid 2785
151 Ga0373943_0001058 3300035170 Bacteria 12222
152 Ga0373955_0014257 3300035172 Bacteria 3862
153 Ga0373942_0003499 3300035207 Bacteria 3686
154 Ga0373924_0004864 3300035410 Bacteria 4720
155 Ga0373935_0004355 3300035692 Bacteria 8309
156 Ga0373927_0006423 3300035695 Bacteria 8012
157 Ga0373927_0038843 3300035695 Bacteria 3090
158 Ga0373947_0004550 3300035725 Bacteria 8130
159 Ga0373937_0009592 3300036401 Bacteria 8427
160 Ga0373925_0006313 3300037068 Bacteria 8733
161 Ga0373925_0033939 3300037068 Bacteria 3760
162 Ga0395900_0197126 3300037418 Bacteria 2039
163 Ga0395905_0010192 3300037471 Bacteria 9158
164 Ga0436361_0286247 3300039447 Bacteria 49551
165 Ga0439453_0000185 3300041408 Bacteria 5917
166 Ga0450890_000937 3300042127 Bacteria 4224
167 Ga0439435_0000673 3300042436 Bacteria 5661
168 Ga0439460_0006216 3300042461 Bacteria 2955
169 Ga0451577_0608245 3300042876 Bacteria 992
170 Ga0466969_0021232 3300044656 Bacteria 3358
171 Ga0466969_0036611 3300044656 Bacteria 2478
172 Ga0466969_0051305 3300044656 Bacteria 2031
173 Ga0466972_0109280 3300044658 Bacteria 1307
174 Ga0466959_0010109 3300045049 Bacteria 6730
175 Ga0466959_0086946 3300045049 Bacteria 2249
176 Ga0451576_0118680 3300045051 Bacteria 2754
177 Ga0495592_0008122 3300046454 Bacteria 7882
178 Ga0495603_0062775 3300046455 Bacteria 2193
179 Ga0495629_0003887 3300046459 Bacteria 11254
180 Ga0495629_0004030 3300046459 Bacteria 11041
181 Ga0495638_0012138 3300046460 Bacteria 5914
182 Ga0495638_0108848 3300046460 Bacteria 1648
183 Ga0495641_0004617 3300046461 Bacteria 9635
184 Ga0495641_0113729 3300046461 Unclassified 1207
185 Ga0495653_0032078 3300046463 Bacteria 4175
186 Ga0495582_0006718 3300046473 Bacteria 6395
187 Ga0495582_0007831 3300046473 Bacteria 5906
188 Ga0495639_0014297 3300046475 Bacteria 3436
189 Ga0495662_0002735 3300046476 Bacteria 8911
190 Ga0495664_0012368 3300046477 Bacteria 4833
191 Ga0495594_0002290 3300046499 Bacteria 9963
192 Ga0495594_0112232 3300046499 Unclassified 1537
193 Ga0495583_0000887 3300046506 Bacteria 35851
194 Ga0495618_0003522 3300046514 Bacteria 9725
195 Ga0495630_0006453 3300046517 Bacteria 8343
196 Ga0495666_0041994 3300046526 Bacteria 2212
197 Ga0495652_0012143 3300046529 Bacteria 7780
198 Ga0495665_0021483 3300046531 Bacteria 3467
199 Ga0495640_0009179 3300046533 Bacteria 7719
200 Ga0495668_0056518 3300046616 Bacteria 2166
201 Ga0495634_0002992 3300046642 Bacteria 13771
202 Ga0495635_0010799 3300046663 Bacteria 6399
203 Ga0495588_0077149 3300046674 Unclassified 1737
204 Ga0495646_0009567 3300046680 Bacteria 6152
205 Ga0495647_0000656 3300046681 Bacteria 10252
206 Ga0495658_0000152 3300046683 Bacteria 38860
207 Ga0495658_0001749 3300046683 Bacteria 11229
208 Ga0495613_0007572 3300046689 Bacteria 8079
209 Ga0495613_0120577 3300046689 Bacteria 1883
210 Ga0495670_0000008 3300046691 Bacteria 219555
211 Ga0495649_0003333 3300046694 Bacteria 10905
212 Ga0495589_0023558 3300046794 Bacteria 3136
213 Ga0495581_0005819 3300047315 Bacteria 7149
214 Ga0495581_0096042 3300047315 Bacteria 1721
215 Ga0495674_0004566 3300047319 Bacteria 13316
216 Ga0495676_0020017 3300047321 Bacteria 5878
217 Ga0495680_0022673 3300047322 Bacteria 5231
218 Ga0495683_0044106 3300047323 Bacteria 2243
219 Ga0495593_0017317 3300047673 Bacteria 4056
220 Ga0495593_0129326 3300047673 Bacteria 1282
221 Ga0496100_0028101 3300048903 Bacteria 3466
222 Ga0496101_0004984 3300048904 Bacteria 8430
223 Ga0496102_0027624 3300048905 Bacteria 5067
224 Ga0496103_0007884 3300048906 Bacteria 6332
225 Ga0496106_0001115 3300048909 Bacteria 19865
226 Ga0496106_0007286 3300048909 Bacteria 8173
227 Ga0496108_0017831 3300048911 Bacteria 5806
228 Ga0496110_0142493 3300048913 Bacteria 2167
229 Ga0496110_0310956 3300048913 Bacteria 1435
230 Ga0496111_0079303 3300048914 Bacteria 2395
231 Ga0496112_0018682 3300048915 Bacteria 6534
232 Ga0496113_0012829 3300048916 Bacteria 5649
233 Ga0496114_0036204 3300048917 Bacteria 4079
234 Ga0496114_0194320 3300048917 Bacteria 1776
235 Ga0496114_0326277 3300048917 Unclassified 1357
236 Ga0496115_0006474 3300048918 Bacteria 8586
237 Ga0496117_0046940 3300048920 Bacteria 3103
238 Ga0496118_0010406 3300048921 Bacteria 9219
239 Ga0496118_0029411 3300048921 Bacteria 4607
240 Ga0496118_0109831 3300048921 Bacteria 1834
241 Ga0496119_0042225 3300048922 Bacteria 2895
242 Ga0496121_0000685 3300048924 Bacteria 63117
243 Ga0496121_0021946 3300048924 Bacteria 6226
244 Ga0496122_0002851 3300048925 Bacteria 23666
245 Ga0496122_0045403 3300048925 Bacteria 3415
246 Ga0496123_0002369 3300048926 Bacteria 23640
247 Ga0496123_0018829 3300048926 Bacteria 5471
248 Ga0496124_0000974 3300048927 Bacteria 45559
249 Ga0496124_0003560 3300048927 Bacteria 18937
250 Ga0496124_0323993 3300048927 Unclassified 1102
251 Ga0496125_0015140 3300048928 Bacteria 7474
252 Ga0496125_0029081 3300048928 Bacteria 4974
253 Ga0496126_0001570 3300048929 Bacteria 35008
254 Ga0496126_0005334 3300048929 Bacteria 14722
255 Ga0496126_0160483 3300048929 Bacteria 1921
256 Ga0496126_0215355 3300048929 Bacteria 1616
257 Ga0501032_0104060 3300049569 Unclassified 1881
258 Ga0501033_0089343 3300049570 Bacteria 2254
259 Ga0501034_0078953 3300049571 Bacteria 3295
260 Ga0501036_0132422 3300049572 Bacteria 2104
261 Ga0501036_0176646 3300049572 Bacteria 1798
262 Ga0501037_0024519 3300049573 Bacteria 4461
263 Ga0501038_0014992 3300049574 Bacteria 7058
264 Ga0501038_0168224 3300049574 Bacteria 1777
265 Ga0501039_0085115 3300049575 Bacteria 2463
266 Ga0501039_0288859 3300049575 Bacteria 1289
267 Ga0501040_0065941 3300049576 Bacteria 2495
268 Ga0501042_0033013 3300049578 Unclassified 3668
269 Ga0501047_0239392 3300049581 Bacteria 1666
270 Ga0501047_0356459 3300049581 Bacteria 1299
271 Ga0501068_0149637 3300049584 Bacteria 1467
272 Ga0501069_0040287 3300049585 Bacteria 2582
273 Ga0501070_0110982 3300049586 Bacteria 2266
274 Ga0501070_0192718 3300049586 Bacteria 1675
275 Ga0501071_0085137 3300049587 Unclassified 2318
276 Ga0501072_0106290 3300049588 Bacteria 2232
277 Ga0501074_0274181 3300049590 Unclassified 1199
278 Ga0501075_0081393 3300049591 Unclassified 2451
279 Ga0501076_0151839 3300049592 Bacteria 1884
280 Ga0501079_0062443 3300049741 Unclassified 2874
281 Ga0501080_0155525 3300049742 Bacteria 2112
282 Ga0501035_0192171 3300049822 Bacteria 1755
283 Ga0501044_0185829 3300049823 Bacteria 2043
284 Ga0501045_0123321 3300049824 Unclassified 1924
285 nmdc:mga06z11_134581_c1 3300050494 Bacteria 1391
286 nmdc:mga05p37_76050_c1 3300050507 Plasmid 4134
287 nmdc:mga09592_25557_c1 3300050508 Bacteria 4890
288 nmdc:mga09592_258261_c1 3300050508 Bacteria 1510
289 nmdc:mga0qj67_100330_c1 3300050509 Bacteria 2334
290 nmdc:mga08y16_221699_c1 3300050511 Unclassified 1958
291 nmdc:mga08y16_488298_c1 3300050511 Unclassified 1253
292 nmdc:mga0n895_74850_c1 3300050512 Bacteria 3365
293 nmdc:mga0rr50_12128_c1 3300050513 Bacteria 5556
294 nmdc:mga0rr50_99476_c1 3300050513 Unclassified 2282
295 Ga0495601_0002022 3300053077 Bacteria 11384
296 Ga0500635_0051792 3300053080 Bacteria 1408
297 Ga0495619_0000226 3300053085 Bacteria 40937
298 Ga0495619_0002491 3300053085 Bacteria 12049
299 Ga0500651_0000747 3300053093 Bacteria 15854
300 Ga0500650_0078757 3300053098 Bacteria 1541
301 Ga0500555_006190 3300053103 Bacteria 3396
302 Ga0500556_0000073 3300053104 Bacteria 99145
303 Ga0500562_002527 3300053108 Bacteria 4563
304 Ga0500595_007167 3300053119 Bacteria 4652
305 Ga0500608_022426 3300053122 Bacteria 2927
306 Ga0500642_0007182 3300053130 Bacteria 3726
307 Ga0500652_023135 3300053131 Bacteria 2360
308 Ga0500636_0021375 3300053177 Bacteria 3829
309 Ga0500637_0034605 3300053178 Bacteria 2827
310 Ga0500645_005627 3300053730 Bacteria 4581
311 Ga0501084_0095100 3300054114 Bacteria 2502
312 Ga0500661_007991 3300055283 Bacteria 1949
313 Ga0501082_0345615 3300060353 Bacteria 1296
314 Ga0530510_0015172 3300061734 Bacteria 5440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0326277 Ga0496114_0326277_597_1334 219
2 3300049823 Ga0501044_0185829 Ga0501044_0185829_1201_2022 236
3 3300025304 Ga0209257_1007874 Ga0209257_10078744 241
4 3300037418 Ga0395900_0197126 Ga0395900_0197126_1097_1909 241
5 3300037471 Ga0395905_0010192 Ga0395905_0010192_8161_8973 241
6 3300044658 Ga0466972_0109280 Ga0466972_0109280_131_958 242
7 3300028800 Ga0265338_10025831 Ga0265338_100258315 243
8 3300053103 Ga0500555_006190 Ga0500555_006190_1843_2730 243
9 3300042876 Ga0451577_0608245 Ga0451577_0608245_107_922 244
10 3300045051 Ga0451576_0118680 Ga0451576_0118680_1584_2399 244
11 iso_pu_bacteria 2508501050 2508732932 245
12 3300005331 Ga0070670_100200414 Ga0070670_1002004142 246
13 3300005340 Ga0070689_100075676 Ga0070689_1000756763 246
14 3300005355 Ga0070671_100041815 Ga0070671_1000418152 246
15 3300005466 Ga0070685_10077290 Ga0070685_100772902 246
16 3300005843 Ga0068860_100196784 Ga0068860_1001967842 246
17 3300006237 Ga0097621_100132008 Ga0097621_1001320082 246
18 3300006871 Ga0075434_100011990 Ga0075434_1000119904 246
19 3300007076 Ga0075435_100009852 Ga0075435_1000098525 246
20 3300009094 Ga0111539_10244069 Ga0111539_102440692 246
21 3300009098 Ga0105245_10115612 Ga0105245_101156122 246
22 3300009101 Ga0105247_10004735 Ga0105247_100047355 246
23 3300010375 Ga0105239_10172226 Ga0105239_101722263 246
24 3300011119 Ga0105246_10070332 Ga0105246_100703322 246
25 3300012515 Ga0157338_1004654 Ga0157338_10046542 246
26 3300013296 Ga0157374_10093468 Ga0157374_100934682 246
27 3300013297 Ga0157378_10075125 Ga0157378_100751252 246
28 3300013306 Ga0163162_10008269 Ga0163162_100082695 246
29 3300013308 Ga0157375_10022515 Ga0157375_100225154 246
30 3300014325 Ga0163163_10009356 Ga0163163_100093564 246
31 3300014968 Ga0157379_10045242 Ga0157379_100452423 246
32 3300014969 Ga0157376_10018380 Ga0157376_100183802 246
33 3300025900 Ga0207710_10006387 Ga0207710_100063875 246
34 3300025927 Ga0207687_10130295 Ga0207687_101302952 246
35 3300025931 Ga0207644_10018498 Ga0207644_100184983 246
36 3300026067 Ga0207678_10062590 Ga0207678_100625903 246
37 3300034817 Ga0373948_0011516 Ga0373948_0011516_192_1061 246
38 3300035084 Ga0373928_0006678 Ga0373928_0006678_1209_2078 246
39 3300035085 Ga0373929_0007469 Ga0373929_0007469_856_1725 246
40 3300035089 Ga0373944_0069450 Ga0373944_0069450_90_959 246
41 3300035090 Ga0373949_0002949 Ga0373949_0002949_2085_2954 246
42 3300035112 Ga0373932_0002387 Ga0373932_0002387_1870_2739 246
43 3300035121 Ga0373960_0006269 Ga0373960_0006269_276_1145 246
44 3300035207 Ga0373942_0003499 Ga0373942_0003499_2707_3576 246
45 3300035695 Ga0373927_0038843 Ga0373927_0038843_1379_2248 246
46 3300037068 Ga0373925_0033939 Ga0373925_0033939_2733_3602 246
47 3300046459 Ga0495629_0003887 Ga0495629_0003887_8026_8895 246
48 3300046461 Ga0495641_0113729 Ga0495641_0113729_112_981 246
49 3300046473 Ga0495582_0006718 Ga0495582_0006718_2660_3529 246
50 3300046475 Ga0495639_0014297 Ga0495639_0014297_1948_2817 246
51 3300046499 Ga0495594_0112232 Ga0495594_0112232_162_1031 246
52 3300046674 Ga0495588_0077149 Ga0495588_0077149_301_1170 246
53 3300046683 Ga0495658_0000152 Ga0495658_0000152_34694_35563 246
54 3300046689 Ga0495613_0120577 Ga0495613_0120577_541_1410 246
55 3300047315 Ga0495581_0096042 Ga0495581_0096042_166_1035 246
56 3300047322 Ga0495680_0022673 Ga0495680_0022673_2224_3093 246
57 3300047673 Ga0495593_0129326 Ga0495593_0129326_12_881 246
58 3300048903 Ga0496100_0028101 Ga0496100_0028101_2524_3393 246
59 3300048904 Ga0496101_0004984 Ga0496101_0004984_4496_5365 246
60 3300048905 Ga0496102_0027624 Ga0496102_0027624_2845_3714 246
61 3300048906 Ga0496103_0007884 Ga0496103_0007884_316_1185 246
62 3300048909 Ga0496106_0007286 Ga0496106_0007286_6738_7607 246
63 3300048911 Ga0496108_0017831 Ga0496108_0017831_3017_3886 246
64 3300048913 Ga0496110_0310956 Ga0496110_0310956_450_1319 246
65 3300048915 Ga0496112_0018682 Ga0496112_0018682_4399_5268 246
66 3300048916 Ga0496113_0012829 Ga0496113_0012829_3098_3967 246
67 3300048917 Ga0496114_0036204 Ga0496114_0036204_1044_1913 246
68 3300048918 Ga0496115_0006474 Ga0496115_0006474_6128_6997 246
69 3300050512 nmdc:mga0n895_74850_c1 nmdc:mga0n895_74850_c1_1578_2447 246
70 3300050513 nmdc:mga0rr50_12128_c1 nmdc:mga0rr50_12128_c1_2035_2904 246
71 3300053085 Ga0495619_0000226 Ga0495619_0000226_11733_12602 246
72 3300009093 Ga0105240_10352140 Ga0105240_103521401 248
73 3300048929 Ga0496126_0160483 Ga0496126_0160483_844_1707 251
74 3300049570 Ga0501033_0089343 Ga0501033_0089343_411_1310 251
75 3300049571 Ga0501034_0078953 Ga0501034_0078953_2259_3158 251
76 3300049581 Ga0501047_0239392 Ga0501047_0239392_400_1299 251
77 3300013306 Ga0163162_10422826 Ga0163162_104228262 252
78 3300046663 Ga0495635_0010799 Ga0495635_0010799_3666_4514 252
79 3300050508 nmdc:mga09592_25557_c1 nmdc:mga09592_25557_c1_3421_4269 252
80 3300050509 nmdc:mga0qj67_100330_c1 nmdc:mga0qj67_100330_c1_489_1337 252
81 3300049572 Ga0501036_0132422 Ga0501036_0132422_752_1591 253
82 3300049574 Ga0501038_0168224 Ga0501038_0168224_218_1057 253
83 3300049575 Ga0501039_0085115 Ga0501039_0085115_776_1615 253
84 3300049576 Ga0501040_0065941 Ga0501040_0065941_849_1688 253
85 3300049578 Ga0501042_0033013 Ga0501042_0033013_935_1774 253
86 3300049586 Ga0501070_0192718 Ga0501070_0192718_783_1622 253
87 3300049587 Ga0501071_0085137 Ga0501071_0085137_1389_2228 253
88 3300049588 Ga0501072_0106290 Ga0501072_0106290_576_1415 253
89 3300049591 Ga0501075_0081393 Ga0501075_0081393_741_1580 253
90 3300049592 Ga0501076_0151839 Ga0501076_0151839_241_1080 253
91 3300049741 Ga0501079_0062443 Ga0501079_0062443_91_930 253
92 3300049824 Ga0501045_0123321 Ga0501045_0123321_1006_1845 253
93 3300054114 Ga0501084_0095100 Ga0501084_0095100_772_1611 253
94 3300060353 Ga0501082_0345615 Ga0501082_0345615_394_1233 253
95 3300061734 Ga0530510_0015172 Ga0530510_0015172_1054_1893 253
96 3300003323 rootH1_10285299 rootH1_102852992 254
97 3300005288 Ga0065714_10064734 Ga0065714_100647348 254
98 3300005329 Ga0070683_100020539 Ga0070683_1000205393 254
99 3300005331 Ga0070670_100010028 Ga0070670_1000100285 254
100 3300005336 Ga0070680_100085421 Ga0070680_1000854213 254
101 3300005458 Ga0070681_10033293 Ga0070681_100332934 254
102 3300005530 Ga0070679_100297497 Ga0070679_1002974972 254
103 3300005548 Ga0070665_100000539 Ga0070665_10000053943 254
104 3300005563 Ga0068855_100003278 Ga0068855_1000032784 254
105 3300005843 Ga0068860_100824948 Ga0068860_1008249481 254
106 3300009093 Ga0105240_10002317 Ga0105240_100023179 254
107 3300009093 Ga0105240_10050308 Ga0105240_100503083 254
108 3300009176 Ga0105242_10182406 Ga0105242_101824062 254
109 3300009545 Ga0105237_10013426 Ga0105237_100134262 254
110 3300009545 Ga0105237_10055629 Ga0105237_100556291 254
111 3300009551 Ga0105238_10055083 Ga0105238_100550833 254
112 3300009551 Ga0105238_10411238 Ga0105238_104112382 254
113 3300009551 Ga0105238_10568257 Ga0105238_105682572 254
114 3300010375 Ga0105239_10017076 Ga0105239_100170765 254
115 3300010375 Ga0105239_10120452 Ga0105239_101204523 254
116 3300013105 Ga0157369_10051199 Ga0157369_100511994 254
117 3300014968 Ga0157379_10016849 Ga0157379_100168492 254
118 3300025912 Ga0207707_10137314 Ga0207707_101373142 254
119 3300025913 Ga0207695_10026095 Ga0207695_100260956 254
120 3300025913 Ga0207695_10066352 Ga0207695_100663522 254
121 3300025914 Ga0207671_10261140 Ga0207671_102611402 254
122 3300025921 Ga0207652_10128468 Ga0207652_101284682 254
123 3300025944 Ga0207661_10215814 Ga0207661_102158141 254
124 3300028379 Ga0268266_10001556 Ga0268266_1000155615 254
125 3300028786 Ga0307517_10094403 Ga0307517_100944032 254
126 3300031250 Ga0265331_10031165 Ga0265331_100311653 254
127 3300031507 Ga0307509_10337045 Ga0307509_103370452 254
128 3300044656 Ga0466969_0021232 Ga0466969_0021232_1287_2153 254
129 3300044656 Ga0466969_0036611 Ga0466969_0036611_518_1384 254
130 3300045049 Ga0466959_0010109 Ga0466959_0010109_385_1251 254
131 3300046691 Ga0495670_0000008 Ga0495670_0000008_188229_189110 254
132 3300048925 Ga0496122_0045403 Ga0496122_0045403_817_1680 254
133 3300048926 Ga0496123_0018829 Ga0496123_0018829_3665_4528 254
134 3300048928 Ga0496125_0015140 Ga0496125_0015140_6315_7178 254
135 3300048929 Ga0496126_0001570 Ga0496126_0001570_24853_25722 254
136 3300048929 Ga0496126_0215355 Ga0496126_0215355_703_1569 254
137 3300053178 Ga0500637_0034605 Ga0500637_0034605_1730_2596 254
138 3300025913 Ga0207695_10038544 Ga0207695_100385446 255
139 3300044656 Ga0466969_0051305 Ga0466969_0051305_771_1706 255
140 3300045049 Ga0466959_0086946 Ga0466959_0086946_335_1237 255
141 3300048913 Ga0496110_0142493 Ga0496110_0142493_225_1076 255
142 3300048914 Ga0496111_0079303 Ga0496111_0079303_1442_2293 255
143 3300053108 Ga0500562_002527 Ga0500562_002527_2191_3060 255
144 3300005366 Ga0070659_100111860 Ga0070659_1001118603 256
145 3300005539 Ga0068853_100186935 Ga0068853_1001869351 256
146 3300005564 Ga0070664_100258405 Ga0070664_1002584051 256
147 3300013100 Ga0157373_10000918 Ga0157373_100009187 256
148 3300013100 Ga0157373_10001440 Ga0157373_100014408 256
149 3300025932 Ga0207690_10058157 Ga0207690_100581572 256
150 3300026041 Ga0207639_10085471 Ga0207639_100854712 256
151 3300026041 Ga0207639_10113095 Ga0207639_101130953 256
152 3300048917 Ga0496114_0194320 Ga0496114_0194320_881_1729 256
153 3300053104 Ga0500556_0000073 Ga0500556_0000073_75741_76616 256
154 3300005353 Ga0070669_100367928 Ga0070669_1003679282 257
155 3300025923 Ga0207681_10306101 Ga0207681_103061012 257
156 3300028380 Ga0268265_10331026 Ga0268265_103310261 257
157 iso_pu_bacteria 2511231026 2511384796 257
158 3300005289 Ga0065704_10217289 Ga0065704_102172892 258
159 3300005937 Ga0081455_10001461 Ga0081455_1000146110 258
160 3300005983 Ga0081540_1014921 Ga0081540_10149214 258
161 3300006175 Ga0070712_100100776 Ga0070712_1001007762 258
162 3300006846 Ga0075430_100036529 Ga0075430_1000365293 258
163 3300006847 Ga0075431_100050605 Ga0075431_1000506054 258
164 3300006852 Ga0075433_10117334 Ga0075433_101173342 258
165 3300006871 Ga0075434_100072973 Ga0075434_1000729733 258
166 3300006880 Ga0075429_100061582 Ga0075429_1000615823 258
167 3300009094 Ga0111539_10044798 Ga0111539_100447983 258
168 3300009147 Ga0114129_10147520 Ga0114129_101475203 258
169 3300009147 Ga0114129_10241966 Ga0114129_102419662 258
170 3300013296 Ga0157374_10538690 Ga0157374_105386902 258
171 3300021361 Ga0213872_10000936 Ga0213872_100009366 258
172 3300027907 Ga0207428_10007072 Ga0207428_100070727 258
173 3300031548 Ga0307408_100002967 Ga0307408_1000029675 258
174 3300032004 Ga0307414_10059209 Ga0307414_100592093 258
175 3300035113 Ga0373936_0052357 Ga0373936_0052357_591_1460 258
176 3300035117 Ga0373953_0111058 Ga0373953_0111058_186_1055 258
177 3300035118 Ga0373954_0015190 Ga0373954_0015190_444_1313 258
178 3300035170 Ga0373943_0001058 Ga0373943_0001058_7599_8468 258
179 3300035172 Ga0373955_0014257 Ga0373955_0014257_963_1832 258
180 3300035410 Ga0373924_0004864 Ga0373924_0004864_1110_1979 258
181 3300035692 Ga0373935_0004355 Ga0373935_0004355_3940_4809 258
182 3300035695 Ga0373927_0006423 Ga0373927_0006423_3752_4621 258
183 3300035725 Ga0373947_0004550 Ga0373947_0004550_3727_4596 258
184 3300036401 Ga0373937_0009592 Ga0373937_0009592_1052_1921 258
185 3300037068 Ga0373925_0006313 Ga0373925_0006313_3706_4575 258
186 3300039447 Ga0436361_0286247 Ga0436361_0286247_42306_43190 258
187 3300046454 Ga0495592_0008122 Ga0495592_0008122_3287_4156 258
188 3300046455 Ga0495603_0062775 Ga0495603_0062775_620_1489 258
189 3300046459 Ga0495629_0004030 Ga0495629_0004030_4614_5483 258
190 3300046461 Ga0495641_0004617 Ga0495641_0004617_3646_4515 258
191 3300046463 Ga0495653_0032078 Ga0495653_0032078_588_1457 258
192 3300046473 Ga0495582_0007831 Ga0495582_0007831_676_1545 258
193 3300046476 Ga0495662_0002735 Ga0495662_0002735_3832_4701 258
194 3300046477 Ga0495664_0012368 Ga0495664_0012368_2248_3117 258
195 3300046499 Ga0495594_0002290 Ga0495594_0002290_1620_2489 258
196 3300046514 Ga0495618_0003522 Ga0495618_0003522_5102_5971 258
197 3300046517 Ga0495630_0006453 Ga0495630_0006453_3720_4589 258
198 3300046526 Ga0495666_0041994 Ga0495666_0041994_110_979 258
199 3300046529 Ga0495652_0012143 Ga0495652_0012143_3265_4134 258
200 3300046531 Ga0495665_0021483 Ga0495665_0021483_1478_2347 258
201 3300046533 Ga0495640_0009179 Ga0495640_0009179_3420_4289 258
202 3300046642 Ga0495634_0002992 Ga0495634_0002992_3743_4612 258
203 3300046680 Ga0495646_0009567 Ga0495646_0009567_2729_3598 258
204 3300046681 Ga0495647_0000656 Ga0495647_0000656_3625_4494 258
205 3300046683 Ga0495658_0001749 Ga0495658_0001749_2418_3287 258
206 3300046689 Ga0495613_0007572 Ga0495613_0007572_2855_3724 258
207 3300047315 Ga0495581_0005819 Ga0495581_0005819_5113_5982 258
208 3300047319 Ga0495674_0004566 Ga0495674_0004566_3298_4167 258
209 3300047321 Ga0495676_0020017 Ga0495676_0020017_3727_4596 258
210 3300047673 Ga0495593_0017317 Ga0495593_0017317_1315_2184 258
211 3300050507 nmdc:mga05p37_76050_c1 nmdc:mga05p37_76050_c1_1496_2365 258
212 3300050511 nmdc:mga08y16_221699_c1 nmdc:mga08y16_221699_c1_468_1337 258
213 3300050513 nmdc:mga0rr50_99476_c1 nmdc:mga0rr50_99476_c1_865_1734 258
214 3300053077 Ga0495601_0002022 Ga0495601_0002022_5016_5885 258
215 3300053085 Ga0495619_0002491 Ga0495619_0002491_4053_4922 258
216 3300005981 Ga0081538_10031861 Ga0081538_100318612 259
217 3300031456 Ga0307513_10186803 Ga0307513_101868032 259
218 3300048921 Ga0496118_0109831 Ga0496118_0109831_870_1748 259
219 3300048924 Ga0496121_0021946 Ga0496121_0021946_4534_5412 259
220 3300053093 Ga0500651_0000747 Ga0500651_0000747_5151_6032 259
221 3300053098 Ga0500650_0078757 Ga0500650_0078757_386_1267 259
222 3300053119 Ga0500595_007167 Ga0500595_007167_3000_3878 259
223 3300053130 Ga0500642_0007182 Ga0500642_0007182_2720_3601 259
224 iso_pu_bacteria 2738541281 2738743144 259
225 iso_pu_bacteria 2738543032 2739352761 259
226 3300003781 Ga0055536_1006931 Ga0055536_10069315 260
227 3300005331 Ga0070670_100060395 Ga0070670_1000603952 260
228 3300005353 Ga0070669_100007229 Ga0070669_1000072293 260
229 3300005364 Ga0070673_100183411 Ga0070673_1001834112 260
230 3300005544 Ga0070686_100054466 Ga0070686_1000544662 260
231 3300005842 Ga0068858_100162013 Ga0068858_1001620132 260
232 3300005844 Ga0068862_100021187 Ga0068862_1000211873 260
233 3300006058 Ga0075432_10028988 Ga0075432_100289882 260
234 3300006178 Ga0075367_10099783 Ga0075367_100997832 260
235 3300006844 Ga0075428_100296497 Ga0075428_1002964972 260
236 3300006880 Ga0075429_100237364 Ga0075429_1002373642 260
237 3300009094 Ga0111539_10009138 Ga0111539_100091388 260
238 3300009101 Ga0105247_10124797 Ga0105247_101247972 260
239 3300009174 Ga0105241_10440289 Ga0105241_104402891 260
240 3300010375 Ga0105239_10074945 Ga0105239_100749452 260
241 3300013306 Ga0163162_10050630 Ga0163162_100506302 260
242 3300014325 Ga0163163_10315847 Ga0163163_103158472 260
243 3300025900 Ga0207710_10071308 Ga0207710_100713082 260
244 3300025901 Ga0207688_10027287 Ga0207688_100272872 260
245 3300026035 Ga0207703_10129154 Ga0207703_101291542 260
246 3300028380 Ga0268265_10034284 Ga0268265_100342842 260
247 3300041408 Ga0439453_0000185 Ga0439453_0000185_2211_3104 260
248 3300042436 Ga0439435_0000673 Ga0439435_0000673_766_1659 260
249 3300042461 Ga0439460_0006216 Ga0439460_0006216_760_1653 260
250 3300048909 Ga0496106_0001115 Ga0496106_0001115_7584_8519 260
251 3300048920 Ga0496117_0046940 Ga0496117_0046940_1093_2028 260
252 3300048921 Ga0496118_0010406 Ga0496118_0010406_658_1593 260
253 3300048922 Ga0496119_0042225 Ga0496119_0042225_1904_2839 260
254 3300048924 Ga0496121_0000685 Ga0496121_0000685_20634_21569 260
255 3300048925 Ga0496122_0002851 Ga0496122_0002851_7466_8353 260
256 3300048926 Ga0496123_0002369 Ga0496123_0002369_15291_16178 260
257 3300048927 Ga0496124_0000974 Ga0496124_0000974_15324_16259 260
258 3300048928 Ga0496125_0029081 Ga0496125_0029081_394_1329 260
259 3300048929 Ga0496126_0005334 Ga0496126_0005334_3835_4770 260
260 3300050494 nmdc:mga06z11_134581_c1 nmdc:mga06z11_134581_c1_415_1350 260
261 3300050508 nmdc:mga09592_258261_c1 nmdc:mga09592_258261_c1_41_934 260
262 3300050511 nmdc:mga08y16_488298_c1 nmdc:mga08y16_488298_c1_186_1079 260
263 3300053131 Ga0500652_023135 Ga0500652_023135_742_1629 260
264 3300053730 Ga0500645_005627 Ga0500645_005627_318_1205 260
265 iso_pu_bacteria 2643221551 2643777808 260
266 iso_pu_bacteria 2643221555 2643796256 260
267 iso_pu_bacteria 2840878972 2840880440 260
268 3300007265 Ga0099794_10016556 Ga0099794_100165564 261
269 3300031456 Ga0307513_10239804 Ga0307513_102398042 261
270 3300046460 Ga0495638_0012138 Ga0495638_0012138_3382_4290 261
271 3300046460 Ga0495638_0108848 Ga0495638_0108848_551_1459 261
272 3300048921 Ga0496118_0029411 Ga0496118_0029411_3590_4498 261
273 3300048927 Ga0496124_0323993 Ga0496124_0323993_89_997 261
274 3300049569 Ga0501032_0104060 Ga0501032_0104060_516_1418 262
275 3300049572 Ga0501036_0176646 Ga0501036_0176646_99_1001 262
276 3300049573 Ga0501037_0024519 Ga0501037_0024519_2964_3866 262
277 3300049574 Ga0501038_0014992 Ga0501038_0014992_3920_4822 262
278 3300049575 Ga0501039_0288859 Ga0501039_0288859_176_1078 262
279 3300049581 Ga0501047_0356459 Ga0501047_0356459_253_1155 262
280 3300049584 Ga0501068_0149637 Ga0501068_0149637_187_1089 262
281 3300049585 Ga0501069_0040287 Ga0501069_0040287_279_1181 262
282 3300049586 Ga0501070_0110982 Ga0501070_0110982_690_1592 262
283 3300049590 Ga0501074_0274181 Ga0501074_0274181_233_1135 262
284 3300049742 Ga0501080_0155525 Ga0501080_0155525_1109_2011 262
285 3300049822 Ga0501035_0192171 Ga0501035_0192171_277_1179 262
286 3300005543 Ga0070672_100211287 Ga0070672_1002112872 264
287 3300005563 Ga0068855_100238755 Ga0068855_1002387552 264
288 3300025253 Ga0209677_101668 Ga0209677_1016687 264
289 3300046506 Ga0495583_0000887 Ga0495583_0000887_28275_29180 264
290 3300046616 Ga0495668_0056518 Ga0495668_0056518_371_1276 264
291 3300046694 Ga0495649_0003333 Ga0495649_0003333_5734_6639 264
292 3300046794 Ga0495589_0023558 Ga0495589_0023558_2161_3066 264
293 3300047323 Ga0495683_0044106 Ga0495683_0044106_334_1239 264
294 3300053080 Ga0500635_0051792 Ga0500635_0051792_136_1041 264
295 3300053122 Ga0500608_022426 Ga0500608_022426_1933_2838 264
296 3300053177 Ga0500636_0021375 Ga0500636_0021375_2095_3000 264
297 3300055283 Ga0500661_007991 Ga0500661_007991_723_1628 264
298 3300025273 Ga0209673_1005291 Ga0209673_10052916 266
299 3300025299 Ga0209256_1028057 Ga0209256_10280572 266
300 3300003323 rootH1_10014124 rootH1_100141246 275
301 3300048927 Ga0496124_0003560 Ga0496124_0003560_6558_7478 276
302 3300003775 Ga0055524_1000117 Ga0055524_100011769 277
303 3300025299 Ga0209256_1000075 Ga0209256_1000075105 277
304 3300003775 Ga0055524_1010141 Ga0055524_10101412 279
305 3300003794 Ga0055531_10010274 Ga0055531_100102743 279
306 3300006944 Ga0099823_1024517 Ga0099823_10245174 279
307 3300025273 Ga0209673_1005680 Ga0209673_10056803 279
308 3300025298 Ga0209050_1005305 Ga0209050_10053053 279
309 3300025299 Ga0209256_1001231 Ga0209256_100123117 279
310 3300025303 Ga0209051_1002494 Ga0209051_100249413 279
311 3300025304 Ga0209257_1000602 Ga0209257_100060227 279
312 3300027296 Ga0209389_1028592 Ga0209389_10285922 279
313 3300003794 Ga0055531_10001270 Ga0055531_1000127013 290
314 3300012497 Ga0157319_1000026 Ga0157319_100002619 290
315 3300025304 Ga0209257_1000244 Ga0209257_100024496 290
316 3300003316 rootH1_10021026 rootH1_100210263 291
317 3300003320 rootH2_10022456 rootH2_100224566 291
318 3300003322 rootL2_10005700 rootL2_100057004 291
319 3300003323 rootH1_10070857 rootH1_100708574 291
320 3300031548 Ga0307408_100009251 Ga0307408_1000092512 291
321 3300042127 Ga0450890_000937 Ga0450890_000937_1064_2038 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

15

257

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.8784 18 291
2ghs-assembly1.cif.gz_A crystal structure of a calcium-binding protein, regucalcin (agr_c_1268) from agrobacterium tumefaciens str. c58 at 1.55 a resolution 0.8755 18 288
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.8718 18 289
3g4e-assembly1.cif.gz_A crystal structure of human senescence marker protein-30(smp30)(calcium bound) 0.8684 18 289
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.8397 18 291
ID Description Score Start End Superfamily
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8847 18 289 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8736 19 289 2.120.10.30
af_P56553_7_336_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8582 23 288 2.120.10.30
2ghsA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.852 18 288 2.120.10.30
af_H8F4T3_2_306_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8395 18 289 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A6I3FSB6-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.968 145 286 GO:0004341
GO:0005509
GO:0019853
AF-A0A2N3DXP1-F1-model_v4 Gluconolactonase 0.9675 151 288 GO:0004341
GO:0005509
GO:0019853
AF-W1VEE7-F1-model_v4 SMP-30/Gluconolaconase/LRE protein 0.9643 148 289 GO:0004341
GO:0005509
GO:0019853
AF-A0A7G3D714-F1-model_v4 deleted 0.9639 169 289
AF-A0A2A5D1M4-F1-model_v4 Gluconolaconase 0.9638 133 257 GO:0004341
GO:0005509
GO:0019853

Feature Viewer

pLDDT pTM Quality
86.99 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map