F405464

General Info

Members Datasets Scaffolds Average Seq Length
320 229 320 87

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10447178|Ga0081455_104471782
Length 95
Sequence MLGHHDFMANIHSQKKRILRSERERLENRRYTSTIKTYFRRLEAAVAAGDADAIETEHKSLVKTIDKAVKVGALHRNNGARKKSRAARVRKSASA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 7.5
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1020212 3300000546 Bacteria 710
2 Ga0070658_10048412 3300005327 Bacteria 3442
3 Ga0070658_10137167 3300005327 Bacteria 2042
4 Ga0068869_101082336 3300005334 Bacteria 701
5 Ga0070680_100253469 3300005336 Bacteria 1488
6 Ga0070660_100005220 3300005339 Bacteria 8983
7 Ga0070668_100686586 3300005347 Bacteria 902
8 Ga0070674_101290520 3300005356 Bacteria 651
9 Ga0070709_10254657 3300005434 Bacteria 1266
10 Ga0070714_100064495 3300005435 Bacteria 3153
11 Ga0070714_100127128 3300005435 Bacteria 2274
12 Ga0070713_100471068 3300005436 Bacteria 1182
13 Ga0070681_10806534 3300005458 Bacteria 856
14 Ga0070685_10112529 3300005466 Bacteria 1679
15 Ga0070679_100450794 3300005530 Bacteria 1231
16 Ga0070684_102073669 3300005535 Bacteria 537
17 Ga0068853_100793088 3300005539 Bacteria 907
18 Ga0070686_100341602 3300005544 Bacteria 1122
19 Ga0070665_101083819 3300005548 Bacteria 813
20 Ga0068855_101405952 3300005563 Bacteria 719
21 Ga0068855_102453004 3300005563 Bacteria 520
22 Ga0068854_100733093 3300005578 Bacteria 856
23 Ga0068852_100077831 3300005616 Bacteria 2933
24 Ga0068866_10841340 3300005718 Bacteria 641
25 Ga0068863_100966193 3300005841 Bacteria 854
26 Ga0081455_10447178 3300005937 Bacteria 884
27 Ga0081540_1000943 3300005983 Bacteria 26189
28 Ga0081539_10025307 3300005985 Bacteria 3827
29 Ga0070717_10014139 3300006028 Bacteria 6135
30 Ga0070716_100558181 3300006173 Bacteria 855
31 Ga0070716_100648746 3300006173 Bacteria 800
32 Ga0070712_100157847 3300006175 Bacteria 1749
33 Ga0075428_100045126 3300006844 Bacteria 4843
34 Ga0075430_100017433 3300006846 Bacteria 6116
35 Ga0075430_100025040 3300006846 Bacteria 5077
36 Ga0075431_100056791 3300006847 Bacteria 4037
37 Ga0075434_100926415 3300006871 Bacteria 886
38 Ga0075429_100028775 3300006880 Bacteria 4825
39 Ga0111539_13276077 3300009094 Unclassified 521
40 Ga0105245_12040401 3300009098 Bacteria 627
41 Ga0105245_12409108 3300009098 Bacteria 580
42 Ga0114129_10054986 3300009147 Bacteria 5579
43 Ga0105243_10824299 3300009148 Bacteria 916
44 Ga0105243_12837059 3300009148 Bacteria 525
45 Ga0105241_12400755 3300009174 Bacteria 526
46 Ga0105248_10066199 3300009177 Bacteria 4057
47 Ga0105237_10257842 3300009545 Bacteria 1746
48 Ga0105238_10585896 3300009551 Bacteria 1122
49 Ga0105238_12501181 3300009551 Bacteria 552
50 Ga0105249_11402128 3300009553 Bacteria 771
51 Ga0105249_11531019 3300009553 Bacteria 739
52 Ga0105239_10631138 3300010375 Bacteria 1223
53 Ga0105239_12241018 3300010375 Bacteria 635
54 Ga0157343_1036992 3300012488 Bacteria 516
55 Ga0157369_10723351 3300013105 Bacteria 1025
56 Ga0157369_10795035 3300013105 Bacteria 972
57 Ga0157378_10106276 3300013297 Bacteria 2567
58 Ga0163162_13339030 3300013306 Bacteria 513
59 Ga0157375_13292124 3300013308 Bacteria 539
60 Ga0163163_10031616 3300014325 Bacteria 5109
61 Ga0163163_11065475 3300014325 Bacteria 871
62 Ga0163163_12926616 3300014325 Bacteria 533
63 Ga0157380_10387813 3300014326 Bacteria 1321
64 Ga0182008_10269820 3300014497 Bacteria 882
65 Ga0157377_10303952 3300014745 Bacteria 1054
66 Ga0157377_10676344 3300014745 Bacteria 746
67 Ga0157379_10005552 3300014968 Bacteria 10837
68 Ga0157379_11625548 3300014968 Bacteria 631
69 Ga0157376_12275517 3300014969 Bacteria 581
70 Ga0206356_11308711 3300020070 Bacteria 783
71 Ga0206354_10758490 3300020081 Bacteria 963
72 Ga0213875_10346907 3300021388 Bacteria 705
73 Ga0207692_10330011 3300025898 Bacteria 936
74 Ga0207688_10038769 3300025901 Bacteria 2645
75 Ga0207699_10150435 3300025906 Bacteria 1540
76 Ga0207684_10278406 3300025910 Bacteria 1443
77 Ga0207707_10451076 3300025912 Bacteria 1101
78 Ga0207693_10106531 3300025915 Bacteria 2199
79 Ga0207693_10153604 3300025915 Bacteria 1811
80 Ga0207663_10542820 3300025916 Bacteria 908
81 Ga0207657_10019505 3300025919 Bacteria 6437
82 Ga0207652_10520586 3300025921 Bacteria 1070
83 Ga0207687_10241839 3300025927 Bacteria 1431
84 Ga0207700_10116785 3300025928 Bacteria 2156
85 Ga0207700_10509129 3300025928 Bacteria 1066
86 Ga0207664_10035087 3300025929 Bacteria 3868
87 Ga0207664_10741216 3300025929 Bacteria 883
88 Ga0207670_11249216 3300025936 Bacteria 629
89 Ga0207669_10316941 3300025937 Bacteria 1192
90 Ga0207669_10378926 3300025937 Bacteria 1102
91 Ga0207665_10157974 3300025939 Bacteria 1629
92 Ga0207711_10480471 3300025941 Bacteria 1157
93 Ga0207667_10263888 3300025949 Bacteria 1761
94 Ga0207640_10759029 3300025981 Bacteria 837
95 Ga0207658_11142163 3300025986 Bacteria 712
96 Ga0207708_10838366 3300026075 Bacteria 793
97 Ga0207702_11313786 3300026078 Bacteria 717
98 Ga0207641_10232310 3300026088 Bacteria 1715
99 Ga0207675_101018067 3300026118 Bacteria 847
100 Ga0207683_11908631 3300026121 Bacteria 543
101 Ga0207698_11824174 3300026142 Bacteria 623
102 Ga0268266_11103000 3300028379 Bacteria 768
103 Ga0268264_12142576 3300028381 Bacteria 567
104 Ga0265326_10101672 3300028558 Bacteria 815
105 Ga0265318_10138778 3300028577 Bacteria 893
106 Ga0265336_10038890 3300028666 Unclassified 1459
107 Ga0307408_102504577 3300031548 Unclassified 502
108 Ga0265314_10537447 3300031711 Bacteria 610
109 Ga0307416_102702573 3300032002 Bacteria 593
110 Ga0307411_12211386 3300032005 Bacteria 516
111 Ga0307415_100129005 3300032126 Bacteria 1911
112 Ga0373926_0072364 3300035083 Bacteria 1268
113 Ga0373946_0054343 3300035171 Bacteria 1685
114 Ga0373961_0034759 3300035241 Bacteria 1427
115 Ga0373947_0397383 3300035725 Bacteria 929
116 Ga0373925_0053229 3300037068 Bacteria 3025
117 Ga0395899_0799970 3300037312 Bacteria 583
118 Ga0395900_0162403 3300037418 Bacteria 2278
119 Ga0395900_0366613 3300037418 Bacteria 1411
120 Ga0395898_0445032 3300037466 Bacteria 1234
121 Ga0395898_1105664 3300037466 Bacteria 726
122 Ga0395898_1710907 3300037466 Bacteria 551
123 Ga0436364_0031422 3300037853 Bacteria 655
124 Ga0436364_0270185 3300037853 Unclassified 1307
125 Ga0436364_1275190 3300037853 Bacteria 2216
126 Ga0436364_1350284 3300037853 Bacteria 2277
127 Ga0395901_0569220 3300038443 Bacteria 1146
128 Ga0436365_0646664 3300039437 Bacteria 1678
129 Ga0436365_0937654 3300039437 Bacteria 1684
130 Ga0436365_1174215 3300039437 Bacteria 775
131 Ga0436360_1059120 3300039438 Bacteria 603
132 Ga0436361_0746249 3300039447 Bacteria 582
133 Ga0436363_0454885 3300039450 Bacteria 4044
134 Ga0436363_1579135 3300039450 Bacteria 593
135 Ga0436363_1691501 3300039450 Bacteria 649
136 Ga0436362_0695449 3300039453 Bacteria 1260
137 Ga0451791_1536932 3300041451 Bacteria 1484
138 Ga0439459_0159429 3300042438 Bacteria 595
139 Ga0466969_0013311 3300044656 Bacteria 4332
140 Ga0466972_0464916 3300044658 Bacteria 595
141 Ga0466965_0067276 3300044683 Bacteria 1798
142 Ga0466965_0611814 3300044683 Bacteria 620
143 Ga0466966_0070490 3300044684 Unclassified 2192
144 Ga0466966_0270373 3300044684 Bacteria 1023
145 Ga0466966_0628262 3300044684 Bacteria 647
146 Ga0466961_0070681 3300044693 Bacteria 2216
147 Ga0466961_0117779 3300044693 Bacteria 1669
148 Ga0466961_0161869 3300044693 Bacteria 1395
149 Ga0466963_0009848 3300044694 Bacteria 5768
150 Ga0466963_0019538 3300044694 Bacteria 4251
151 Ga0466963_0050479 3300044694 Bacteria 2753
152 Ga0466963_0060432 3300044694 Bacteria 2531
153 Ga0466963_0682334 3300044694 Bacteria 725
154 Ga0466964_0178941 3300044706 Bacteria 1004
155 Ga0466964_0279705 3300044706 Bacteria 834
156 Ga0466971_0021204 3300044719 Bacteria 2891
157 Ga0466971_0045364 3300044719 Bacteria 1974
158 Ga0466971_0153690 3300044719 Bacteria 1075
159 Ga0466968_0135485 3300044735 Bacteria 1123
160 Ga0466970_0034073 3300044765 Bacteria 2694
161 Ga0466970_0077793 3300044765 Bacteria 1789
162 Ga0466970_0381096 3300044765 Bacteria 803
163 Ga0466957_0026230 3300044842 Bacteria 3456
164 Ga0466957_0064255 3300044842 Bacteria 2258
165 Ga0466957_0117371 3300044842 Bacteria 1694
166 Ga0466957_0168695 3300044842 Bacteria 1425
167 Ga0466957_0768999 3300044842 Bacteria 683
168 Ga0466960_0039360 3300044901 Bacteria 2229
169 Ga0466960_0366792 3300044901 Bacteria 824
170 Ga0466959_0009590 3300045049 Bacteria 6887
171 Ga0466959_0072106 3300045049 Bacteria 2500
172 Ga0466959_0592760 3300045049 Bacteria 746
173 Ga0466959_1165721 3300045049 Bacteria 512
174 Ga0466958_0008477 3300045836 Bacteria 5707
175 Ga0466958_0012554 3300045836 Bacteria 4802
176 Ga0466958_0017205 3300045836 Bacteria 4175
177 Ga0466958_0164675 3300045836 Bacteria 1402
178 Ga0466958_0532571 3300045836 Bacteria 763
179 Ga0466967_0003137 3300045976 Bacteria 10641
180 Ga0466967_0020811 3300045976 Bacteria 5313
181 Ga0466967_0355712 3300045976 Bacteria 1418
182 Ga0466967_1044506 3300045976 Bacteria 814
183 Ga0466967_1737957 3300045976 Unclassified 621
184 Ga0466967_1765197 3300045976 Bacteria 616
185 Ga0466967_1846852 3300045976 Bacteria 601
186 Ga0495617_085065 3300046452 Bacteria 1035
187 Ga0495592_0763189 3300046454 Bacteria 577
188 Ga0495603_0019969 3300046455 Bacteria 4059
189 Ga0495590_0276198 3300046457 Bacteria 629
190 Ga0495629_0448018 3300046459 Bacteria 874
191 Ga0495641_0595728 3300046461 Bacteria 505
192 Ga0495650_0085951 3300046471 Unclassified 1205
193 Ga0495664_0250047 3300046477 Bacteria 1072
194 Ga0495664_0569484 3300046477 Bacteria 674
195 Ga0495584_0012376 3300046491 Bacteria 4355
196 Ga0495596_0093008 3300046500 Bacteria 1171
197 Ga0495616_0276857 3300046513 Unclassified 714
198 Ga0495620_0050670 3300046515 Bacteria 1770
199 Ga0495620_0187358 3300046515 Bacteria 799
200 Ga0495631_0123881 3300046518 Unclassified 1111
201 Ga0495631_0224813 3300046518 Bacteria 801
202 Ga0495637_0214024 3300046520 Bacteria 704
203 Ga0495644_0022674 3300046523 Bacteria 2392
204 Ga0495652_0151441 3300046529 Bacteria 1812
205 Ga0495640_0790899 3300046533 Bacteria 566
206 Ga0495587_0400356 3300046536 Bacteria 763
207 Ga0495609_0063655 3300046538 Bacteria 1628
208 Ga0495645_0768232 3300046543 Bacteria 580
209 Ga0495667_0838585 3300046559 Bacteria 566
210 Ga0495656_0114649 3300046615 Bacteria 1265
211 Ga0495656_0129569 3300046615 Bacteria 1199
212 Ga0495635_0917439 3300046663 Bacteria 560
213 Ga0495657_0027173 3300046675 Bacteria 4043
214 Ga0495599_0786526 3300046678 Bacteria 544
215 Ga0495647_0303624 3300046681 Bacteria 720
216 Ga0495624_0100825 3300046690 Bacteria 1778
217 Ga0495649_0617965 3300046694 Unclassified 534
218 Ga0495589_0209041 3300046794 Unclassified 919
219 Ga0495581_0058957 3300047315 Bacteria 2217
220 Ga0495604_0238698 3300047317 Bacteria 1244
221 Ga0495604_0666443 3300047317 Bacteria 663
222 Ga0495674_0118282 3300047319 Bacteria 2241
223 Ga0495672_0054610 3300047320 Bacteria 2334
224 Ga0495680_1047609 3300047322 Bacteria 518
225 Ga0495673_0014458 3300047469 Bacteria 4103
226 Ga0495681_0179179 3300047470 Unclassified 872
227 Ga0495686_0022183 3300047472 Bacteria 4203
228 Ga0495602_0204088 3300048088 Bacteria 1506
229 Ga0495626_0353048 3300048091 Bacteria 574
230 Ga0496100_1691871 3300048903 Bacteria 500
231 Ga0496101_0464007 3300048904 Bacteria 999
232 Ga0496101_0482818 3300048904 Bacteria 979
233 Ga0496102_0243752 3300048905 Bacteria 1695
234 Ga0496103_0183063 3300048906 Bacteria 1347
235 Ga0496104_0247283 3300048907 Bacteria 1696
236 Ga0496104_0797097 3300048907 Bacteria 851
237 Ga0496105_0851218 3300048908 Bacteria 690
238 Ga0496106_0194324 3300048909 Bacteria 1614
239 Ga0496107_0058682 3300048910 Bacteria 2783
240 Ga0496108_0116051 3300048911 Bacteria 2293
241 Ga0496108_0944358 3300048911 Bacteria 739
242 Ga0496109_0143475 3300048912 Bacteria 2233
243 Ga0496109_1631867 3300048912 Bacteria 579
244 Ga0496110_0007529 3300048913 Bacteria 8699
245 Ga0496111_0035089 3300048914 Bacteria 3583
246 Ga0496112_0014206 3300048915 Bacteria 7379
247 Ga0496112_0022791 3300048915 Bacteria 5975
248 Ga0496112_0121702 3300048915 Bacteria 2580
249 Ga0496113_0191684 3300048916 Bacteria 1622
250 Ga0496113_1601619 3300048916 Bacteria 501
251 Ga0496115_0355742 3300048918 Bacteria 1194
252 Ga0496115_0845201 3300048918 Bacteria 709
253 Ga0496121_0002372 3300048924 Bacteria 28962
254 Ga0496123_0279901 3300048926 Bacteria 807
255 Ga0501031_0035870 3300049568 Bacteria 3235
256 Ga0501032_0246322 3300049569 Bacteria 1160
257 Ga0501033_0009099 3300049570 Bacteria 7662
258 Ga0501034_0035813 3300049571 Bacteria 5031
259 Ga0501036_0096857 3300049572 Bacteria 2494
260 Ga0501037_0147964 3300049573 Bacteria 1679
261 Ga0501038_0113300 3300049574 Bacteria 2244
262 Ga0501039_0020123 3300049575 Bacteria 5117
263 Ga0501039_0103354 3300049575 Bacteria 2224
264 Ga0501040_1360912 3300049576 Unclassified 515
265 Ga0501042_0138325 3300049578 Bacteria 1755
266 Ga0501042_0235040 3300049578 Bacteria 1322
267 Ga0501043_0204478 3300049579 Bacteria 1531
268 Ga0501046_0007352 3300049580 Bacteria 9686
269 Ga0501046_0639013 3300049580 Bacteria 753
270 Ga0501048_0004693 3300049582 Bacteria 10402
271 Ga0501067_0031620 3300049583 Bacteria 2936
272 Ga0501067_0522829 3300049583 Bacteria 664
273 Ga0501068_0030433 3300049584 Bacteria 3202
274 Ga0501069_0011827 3300049585 Bacteria 4627
275 Ga0501070_0074176 3300049586 Bacteria 2816
276 Ga0501070_1057916 3300049586 Bacteria 627
277 Ga0501071_1214308 3300049587 Bacteria 583
278 Ga0501072_0126584 3300049588 Bacteria 2036
279 Ga0501073_0018323 3300049589 Bacteria 5059
280 Ga0501074_0110791 3300049590 Bacteria 1964
281 Ga0501076_0605537 3300049592 Bacteria 904
282 Ga0501076_0913839 3300049592 Bacteria 724
283 Ga0501077_0192801 3300049593 Bacteria 1295
284 Ga0501079_0454054 3300049741 Bacteria 1006
285 Ga0501079_0473191 3300049741 Bacteria 984
286 Ga0501081_0184014 3300049743 Bacteria 1512
287 Ga0501081_0228580 3300049743 Bacteria 1354
288 Ga0501083_0010710 3300049744 Bacteria 6451
289 Ga0501035_0264062 3300049822 Bacteria 1458
290 Ga0501035_1358032 3300049822 Bacteria 546
291 Ga0501044_0242737 3300049823 Bacteria 1744
292 Ga0501045_0242957 3300049824 Bacteria 1340
293 nmdc:mga05p37_43788_c1 3300050507 Bacteria 5507
294 nmdc:mga09592_32278_c1 3300050508 Bacteria 4366
295 nmdc:mga0qj67_10891_c1 3300050509 Bacteria 6803
296 nmdc:mga0qj67_95679_c1 3300050509 Bacteria 2391
297 nmdc:mga06r32_432575_c1 3300050510 Bacteria 1297
298 nmdc:mga08y16_826445_c1 3300050511 Unclassified 917
299 nmdc:mga0n895_624164_c1 3300050512 Bacteria 1078
300 nmdc:mga0rr50_945858_c1 3300050513 Bacteria 734
301 Ga0495601_0845241 3300053077 Bacteria 580
302 Ga0495601_0965599 3300053077 Bacteria 537
303 Ga0495655_0038429 3300053083 Bacteria 1208
304 Ga0495619_0854279 3300053085 Bacteria 614
305 Ga0500556_0004238 3300053104 Bacteria 4098
306 Ga0500572_122814 3300053111 Bacteria 841
307 Ga0500614_102828 3300053123 Bacteria 825
308 Ga0500628_024397 3300053129 Bacteria 1256
309 Ga0500616_0008865 3300053153 Bacteria 6181
310 Ga0500616_0017896 3300053153 Bacteria 4013
311 Ga0500599_007198 3300053736 Bacteria 1429
312 Ga0501084_0176502 3300054114 Bacteria 1803
313 Ga0501084_0575079 3300054114 Bacteria 952
314 Ga0501082_0053552 3300060353 Bacteria 3478
315 Ga0501082_0235082 3300060353 Bacteria 1595
316 Ga0466962_0056909 3300061719 Bacteria 1867
317 Ga0466962_0122874 3300061719 Bacteria 1253
318 Ga0466962_0210792 3300061719 Bacteria 950
319 Ga0530510_0118915 3300061734 Bacteria 1939
320 Ga0530510_1215035 3300061734 Bacteria 578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_12837059 Ga0105243_128370591 75
2 3300025937 Ga0207669_10316941 Ga0207669_103169412 75
3 3300009545 Ga0105237_10257842 Ga0105237_102578422 76
4 3300005578 Ga0068854_100733093 Ga0068854_1007330931 77
5 3300009553 Ga0105249_11402128 Ga0105249_114021282 77
6 3300010375 Ga0105239_12241018 Ga0105239_122410181 77
7 3300025981 Ga0207640_10759029 Ga0207640_107590291 77
8 3300025986 Ga0207658_11142163 Ga0207658_111421632 77
9 3300026075 Ga0207708_10838366 Ga0207708_108383661 77
10 3300006844 Ga0075428_100045126 Ga0075428_1000451263 80
11 3300006846 Ga0075430_100025040 Ga0075430_1000250403 80
12 3300006847 Ga0075431_100056791 Ga0075431_1000567912 80
13 3300006880 Ga0075429_100028775 Ga0075429_1000287755 80
14 3300009147 Ga0114129_10054986 Ga0114129_100549863 80
15 3300050507 nmdc:mga05p37_43788_c1 nmdc:mga05p37_43788_c1_3035_3301 80
16 3300050508 nmdc:mga09592_32278_c1 nmdc:mga09592_32278_c1_1262_1528 80
17 3300050509 nmdc:mga0qj67_95679_c1 nmdc:mga0qj67_95679_c1_1800_2066 80
18 3300050510 nmdc:mga06r32_432575_c1 nmdc:mga06r32_432575_c1_326_592 80
19 3300042438 Ga0439459_0159429 Ga0439459_0159429_26_295 81
20 3300005436 Ga0070713_100471068 Ga0070713_1004710682 85
21 3300025928 Ga0207700_10509129 Ga0207700_105091292 85
22 3300028381 Ga0268264_12142576 Ga0268264_121425762 85
23 3300031548 Ga0307408_102504577 Ga0307408_1025045771 85
24 3300037853 Ga0436364_0031422 Ga0436364_0031422_318_575 85
25 3300037853 Ga0436364_1350284 Ga0436364_1350284_463_720 85
26 3300039437 Ga0436365_1174215 Ga0436365_1174215_21_278 85
27 3300039438 Ga0436360_1059120 Ga0436360_1059120_93_350 85
28 3300039450 Ga0436363_0454885 Ga0436363_0454885_35_292 85
29 3300039453 Ga0436362_0695449 Ga0436362_0695449_858_1115 85
30 3300044694 Ga0466963_0009848 Ga0466963_0009848_1365_1622 85
31 3300044842 Ga0466957_0168695 Ga0466957_0168695_268_525 85
32 3300045049 Ga0466959_0592760 Ga0466959_0592760_262_519 85
33 3300045836 Ga0466958_0532571 Ga0466958_0532571_84_341 85
34 3300045976 Ga0466967_0355712 Ga0466967_0355712_777_1034 85
35 3300005435 Ga0070714_100064495 Ga0070714_1000644952 86
36 3300005435 Ga0070714_100127128 Ga0070714_1001271282 86
37 3300006028 Ga0070717_10014139 Ga0070717_100141397 86
38 3300009148 Ga0105243_10824299 Ga0105243_108242991 86
39 3300025898 Ga0207692_10330011 Ga0207692_103300112 86
40 3300025906 Ga0207699_10150435 Ga0207699_101504352 86
41 3300025912 Ga0207707_10451076 Ga0207707_104510762 86
42 3300025928 Ga0207700_10116785 Ga0207700_101167852 86
43 3300025929 Ga0207664_10035087 Ga0207664_100350873 86
44 3300025929 Ga0207664_10741216 Ga0207664_107412162 86
45 3300044656 Ga0466969_0013311 Ga0466969_0013311_2087_2347 86
46 3300044683 Ga0466965_0611814 Ga0466965_0611814_219_479 86
47 3300044693 Ga0466961_0070681 Ga0466961_0070681_997_1257 86
48 3300044694 Ga0466963_0050479 Ga0466963_0050479_1669_1929 86
49 3300044694 Ga0466963_0060432 Ga0466963_0060432_860_1120 86
50 3300044706 Ga0466964_0178941 Ga0466964_0178941_195_455 86
51 3300044719 Ga0466971_0021204 Ga0466971_0021204_2313_2573 86
52 3300044719 Ga0466971_0153690 Ga0466971_0153690_600_860 86
53 3300044765 Ga0466970_0034073 Ga0466970_0034073_211_471 86
54 3300044765 Ga0466970_0381096 Ga0466970_0381096_10_270 86
55 3300044842 Ga0466957_0064255 Ga0466957_0064255_903_1163 86
56 3300044842 Ga0466957_0117371 Ga0466957_0117371_1016_1276 86
57 3300045049 Ga0466959_0009590 Ga0466959_0009590_5630_5890 86
58 3300045049 Ga0466959_0072106 Ga0466959_0072106_1243_1503 86
59 3300045836 Ga0466958_0008477 Ga0466958_0008477_4754_5014 86
60 3300045836 Ga0466958_0164675 Ga0466958_0164675_835_1095 86
61 3300045976 Ga0466967_0003137 Ga0466967_0003137_5310_5570 86
62 3300045976 Ga0466967_1044506 Ga0466967_1044506_422_682 86
63 3300046454 Ga0495592_0763189 Ga0495592_0763189_204_464 86
64 3300046459 Ga0495629_0448018 Ga0495629_0448018_461_721 86
65 3300046477 Ga0495664_0250047 Ga0495664_0250047_500_760 86
66 3300046477 Ga0495664_0569484 Ga0495664_0569484_102_362 86
67 3300046529 Ga0495652_0151441 Ga0495652_0151441_550_810 86
68 3300046536 Ga0495587_0400356 Ga0495587_0400356_157_417 86
69 3300046543 Ga0495645_0768232 Ga0495645_0768232_173_433 86
70 3300046663 Ga0495635_0917439 Ga0495635_0917439_187_447 86
71 3300046678 Ga0495599_0786526 Ga0495599_0786526_89_349 86
72 3300047317 Ga0495604_0238698 Ga0495604_0238698_635_895 86
73 3300047319 Ga0495674_0118282 Ga0495674_0118282_971_1231 86
74 3300048088 Ga0495602_0204088 Ga0495602_0204088_406_666 86
75 3300049575 Ga0501039_0103354 Ga0501039_0103354_1492_1752 86
76 3300049578 Ga0501042_0235040 Ga0501042_0235040_375_635 86
77 3300049586 Ga0501070_1057916 Ga0501070_1057916_27_287 86
78 3300049588 Ga0501072_0126584 Ga0501072_0126584_924_1184 86
79 3300049592 Ga0501076_0605537 Ga0501076_0605537_321_581 86
80 3300049593 Ga0501077_0192801 Ga0501077_0192801_796_1056 86
81 3300049741 Ga0501079_0454054 Ga0501079_0454054_330_590 86
82 3300049743 Ga0501081_0184014 Ga0501081_0184014_372_632 86
83 3300053077 Ga0495601_0845241 Ga0495601_0845241_221_481 86
84 3300060353 Ga0501082_0235082 Ga0501082_0235082_636_896 86
85 3300061719 Ga0466962_0056909 Ga0466962_0056909_1427_1687 86
86 3300061734 Ga0530510_0118915 Ga0530510_0118915_994_1254 86
87 3300006173 Ga0070716_100648746 Ga0070716_1006487461 87
88 3300039437 Ga0436365_0937654 Ga0436365_0937654_1397_1660 87
89 3300039447 Ga0436361_0746249 Ga0436361_0746249_127_390 87
90 3300044694 Ga0466963_0682334 Ga0466963_0682334_34_297 87
91 3300044901 Ga0466960_0039360 Ga0466960_0039360_541_804 87
92 3300045976 Ga0466967_1765197 Ga0466967_1765197_171_434 87
93 3300005327 Ga0070658_10048412 Ga0070658_100484122 88
94 3300005334 Ga0068869_101082336 Ga0068869_1010823362 88
95 3300005336 Ga0070680_100253469 Ga0070680_1002534692 88
96 3300005339 Ga0070660_100005220 Ga0070660_1000052204 88
97 3300005356 Ga0070674_101290520 Ga0070674_1012905202 88
98 3300005466 Ga0070685_10112529 Ga0070685_101125293 88
99 3300005535 Ga0070684_102073669 Ga0070684_1020736692 88
100 3300005539 Ga0068853_100793088 Ga0068853_1007930881 88
101 3300005544 Ga0070686_100341602 Ga0070686_1003416022 88
102 3300005548 Ga0070665_101083819 Ga0070665_1010838192 88
103 3300005563 Ga0068855_102453004 Ga0068855_1024530042 88
104 3300005616 Ga0068852_100077831 Ga0068852_1000778312 88
105 3300005718 Ga0068866_10841340 Ga0068866_108413402 88
106 3300005841 Ga0068863_100966193 Ga0068863_1009661931 88
107 3300005937 Ga0081455_10447178 Ga0081455_104471782 88
108 3300006871 Ga0075434_100926415 Ga0075434_1009264151 88
109 3300009098 Ga0105245_12040401 Ga0105245_120404011 88
110 3300009177 Ga0105248_10066199 Ga0105248_100661993 88
111 3300009551 Ga0105238_12501181 Ga0105238_125011811 88
112 3300010375 Ga0105239_10631138 Ga0105239_106311382 88
113 3300013105 Ga0157369_10723351 Ga0157369_107233512 88
114 3300013105 Ga0157369_10795035 Ga0157369_107950352 88
115 3300013308 Ga0157375_13292124 Ga0157375_132921242 88
116 3300014325 Ga0163163_10031616 Ga0163163_100316162 88
117 3300014325 Ga0163163_11065475 Ga0163163_110654752 88
118 3300014326 Ga0157380_10387813 Ga0157380_103878132 88
119 3300014745 Ga0157377_10676344 Ga0157377_106763441 88
120 3300014968 Ga0157379_11625548 Ga0157379_116255482 88
121 3300020070 Ga0206356_11308711 Ga0206356_113087112 88
122 3300020081 Ga0206354_10758490 Ga0206354_107584901 88
123 3300021388 Ga0213875_10346907 Ga0213875_103469072 88
124 3300025901 Ga0207688_10038769 Ga0207688_100387693 88
125 3300025919 Ga0207657_10019505 Ga0207657_100195053 88
126 3300025921 Ga0207652_10520586 Ga0207652_105205862 88
127 3300025927 Ga0207687_10241839 Ga0207687_102418392 88
128 3300025936 Ga0207670_11249216 Ga0207670_112492162 88
129 3300025937 Ga0207669_10378926 Ga0207669_103789262 88
130 3300025941 Ga0207711_10480471 Ga0207711_104804712 88
131 3300026078 Ga0207702_11313786 Ga0207702_113137862 88
132 3300026088 Ga0207641_10232310 Ga0207641_102323102 88
133 3300026121 Ga0207683_11908631 Ga0207683_119086312 88
134 3300026142 Ga0207698_11824174 Ga0207698_118241742 88
135 3300028379 Ga0268266_11103000 Ga0268266_111030002 88
136 3300037312 Ga0395899_0799970 Ga0395899_0799970_209_475 88
137 3300037418 Ga0395900_0366613 Ga0395900_0366613_730_996 88
138 3300037853 Ga0436364_1275190 Ga0436364_1275190_908_1174 88
139 3300038443 Ga0395901_0569220 Ga0395901_0569220_277_543 88
140 3300039450 Ga0436363_1691501 Ga0436363_1691501_35_301 88
141 3300044684 Ga0466966_0270373 Ga0466966_0270373_687_953 88
142 3300044693 Ga0466961_0117779 Ga0466961_0117779_1262_1528 88
143 3300044706 Ga0466964_0279705 Ga0466964_0279705_347_613 88
144 3300044842 Ga0466957_0768999 Ga0466957_0768999_131_397 88
145 3300044901 Ga0466960_0366792 Ga0466960_0366792_295_561 88
146 3300045836 Ga0466958_0017205 Ga0466958_0017205_456_722 88
147 3300046471 Ga0495650_0085951 Ga0495650_0085951_286_552 88
148 3300046513 Ga0495616_0276857 Ga0495616_0276857_40_306 88
149 3300046515 Ga0495620_0050670 Ga0495620_0050670_448_714 88
150 3300046518 Ga0495631_0123881 Ga0495631_0123881_436_702 88
151 3300046523 Ga0495644_0022674 Ga0495644_0022674_1143_1409 88
152 3300046559 Ga0495667_0838585 Ga0495667_0838585_287_553 88
153 3300046615 Ga0495656_0129569 Ga0495656_0129569_730_996 88
154 3300046675 Ga0495657_0027173 Ga0495657_0027173_3001_3267 88
155 3300046694 Ga0495649_0617965 Ga0495649_0617965_168_434 88
156 3300046794 Ga0495589_0209041 Ga0495589_0209041_471_737 88
157 3300047469 Ga0495673_0014458 Ga0495673_0014458_3642_3908 88
158 3300047470 Ga0495681_0179179 Ga0495681_0179179_425_691 88
159 3300047472 Ga0495686_0022183 Ga0495686_0022183_1646_1912 88
160 3300048904 Ga0496101_0464007 Ga0496101_0464007_312_578 88
161 3300048905 Ga0496102_0243752 Ga0496102_0243752_931_1197 88
162 3300048906 Ga0496103_0183063 Ga0496103_0183063_921_1187 88
163 3300048907 Ga0496104_0247283 Ga0496104_0247283_886_1152 88
164 3300048907 Ga0496104_0797097 Ga0496104_0797097_433_699 88
165 3300048909 Ga0496106_0194324 Ga0496106_0194324_31_297 88
166 3300048910 Ga0496107_0058682 Ga0496107_0058682_2243_2509 88
167 3300048911 Ga0496108_0116051 Ga0496108_0116051_1374_1640 88
168 3300048912 Ga0496109_0143475 Ga0496109_0143475_537_803 88
169 3300048912 Ga0496109_1631867 Ga0496109_1631867_232_498 88
170 3300048914 Ga0496111_0035089 Ga0496111_0035089_687_953 88
171 3300048915 Ga0496112_0014206 Ga0496112_0014206_546_812 88
172 3300048915 Ga0496112_0022791 Ga0496112_0022791_3162_3428 88
173 3300048916 Ga0496113_0191684 Ga0496113_0191684_440_706 88
174 3300048916 Ga0496113_1601619 Ga0496113_1601619_84_350 88
175 3300048918 Ga0496115_0355742 Ga0496115_0355742_905_1171 88
176 3300048918 Ga0496115_0845201 Ga0496115_0845201_97_363 88
177 3300048924 Ga0496121_0002372 Ga0496121_0002372_24153_24419 88
178 3300049568 Ga0501031_0035870 Ga0501031_0035870_945_1211 88
179 3300049569 Ga0501032_0246322 Ga0501032_0246322_467_733 88
180 3300049570 Ga0501033_0009099 Ga0501033_0009099_6242_6508 88
181 3300049571 Ga0501034_0035813 Ga0501034_0035813_4399_4665 88
182 3300049572 Ga0501036_0096857 Ga0501036_0096857_1512_1778 88
183 3300049573 Ga0501037_0147964 Ga0501037_0147964_1079_1345 88
184 3300049574 Ga0501038_0113300 Ga0501038_0113300_1841_2107 88
185 3300049575 Ga0501039_0020123 Ga0501039_0020123_3031_3297 88
186 3300049576 Ga0501040_1360912 Ga0501040_1360912_24_290 88
187 3300049578 Ga0501042_0138325 Ga0501042_0138325_335_601 88
188 3300049579 Ga0501043_0204478 Ga0501043_0204478_320_586 88
189 3300049580 Ga0501046_0007352 Ga0501046_0007352_494_760 88
190 3300049582 Ga0501048_0004693 Ga0501048_0004693_10090_10356 88
191 3300049583 Ga0501067_0031620 Ga0501067_0031620_2130_2396 88
192 3300049584 Ga0501068_0030433 Ga0501068_0030433_335_601 88
193 3300049585 Ga0501069_0011827 Ga0501069_0011827_2350_2616 88
194 3300049586 Ga0501070_0074176 Ga0501070_0074176_367_633 88
195 3300049589 Ga0501073_0018323 Ga0501073_0018323_1167_1433 88
196 3300049590 Ga0501074_0110791 Ga0501074_0110791_1321_1587 88
197 3300049741 Ga0501079_0473191 Ga0501079_0473191_514_780 88
198 3300049743 Ga0501081_0228580 Ga0501081_0228580_1037_1303 88
199 3300049744 Ga0501083_0010710 Ga0501083_0010710_2296_2562 88
200 3300049822 Ga0501035_0264062 Ga0501035_0264062_189_455 88
201 3300049822 Ga0501035_1358032 Ga0501035_1358032_238_504 88
202 3300049823 Ga0501044_0242737 Ga0501044_0242737_574_840 88
203 3300049824 Ga0501045_0242957 Ga0501045_0242957_22_288 88
204 3300050513 nmdc:mga0rr50_945858_c1 nmdc:mga0rr50_945858_c1_319_585 88
205 3300053077 Ga0495601_0965599 Ga0495601_0965599_209_475 88
206 3300053083 Ga0495655_0038429 Ga0495655_0038429_476_742 88
207 3300053123 Ga0500614_102828 Ga0500614_102828_296_562 88
208 3300053129 Ga0500628_024397 Ga0500628_024397_117_383 88
209 3300054114 Ga0501084_0176502 Ga0501084_0176502_1335_1601 88
210 3300054114 Ga0501084_0575079 Ga0501084_0575079_126_392 88
211 3300060353 Ga0501082_0053552 Ga0501082_0053552_2602_2868 88
212 3300061719 Ga0466962_0122874 Ga0466962_0122874_50_316 88
213 3300061734 Ga0530510_1215035 Ga0530510_1215035_39_305 88
214 3300000546 LJNas_1020212 LJNas_10202122 89
215 3300005327 Ga0070658_10137167 Ga0070658_101371673 89
216 3300005347 Ga0070668_100686586 Ga0070668_1006865861 89
217 3300005434 Ga0070709_10254657 Ga0070709_102546572 89
218 3300005458 Ga0070681_10806534 Ga0070681_108065342 89
219 3300005530 Ga0070679_100450794 Ga0070679_1004507942 89
220 3300005563 Ga0068855_101405952 Ga0068855_1014059522 89
221 3300005983 Ga0081540_1000943 Ga0081540_10009436 89
222 3300005985 Ga0081539_10025307 Ga0081539_100253072 89
223 3300006173 Ga0070716_100558181 Ga0070716_1005581812 89
224 3300006175 Ga0070712_100157847 Ga0070712_1001578473 89
225 3300006846 Ga0075430_100017433 Ga0075430_1000174336 89
226 3300009094 Ga0111539_13276077 Ga0111539_132760771 89
227 3300009098 Ga0105245_12409108 Ga0105245_124091081 89
228 3300009174 Ga0105241_12400755 Ga0105241_124007551 89
229 3300009551 Ga0105238_10585896 Ga0105238_105858962 89
230 3300009553 Ga0105249_11531019 Ga0105249_115310191 89
231 3300012488 Ga0157343_1036992 Ga0157343_10369921 89
232 3300013297 Ga0157378_10106276 Ga0157378_101062761 89
233 3300013306 Ga0163162_13339030 Ga0163162_133390301 89
234 3300014325 Ga0163163_12926616 Ga0163163_129266161 89
235 3300014497 Ga0182008_10269820 Ga0182008_102698201 89
236 3300014745 Ga0157377_10303952 Ga0157377_103039521 89
237 3300014968 Ga0157379_10005552 Ga0157379_100055527 89
238 3300014969 Ga0157376_12275517 Ga0157376_122755171 89
239 3300025910 Ga0207684_10278406 Ga0207684_102784062 89
240 3300025915 Ga0207693_10106531 Ga0207693_101065312 89
241 3300025915 Ga0207693_10153604 Ga0207693_101536042 89
242 3300025916 Ga0207663_10542820 Ga0207663_105428202 89
243 3300025939 Ga0207665_10157974 Ga0207665_101579742 89
244 3300025949 Ga0207667_10263888 Ga0207667_102638882 89
245 3300026118 Ga0207675_101018067 Ga0207675_1010180672 89
246 3300028558 Ga0265326_10101672 Ga0265326_101016722 89
247 3300028577 Ga0265318_10138778 Ga0265318_101387782 89
248 3300028666 Ga0265336_10038890 Ga0265336_100388902 89
249 3300031711 Ga0265314_10537447 Ga0265314_105374472 89
250 3300032002 Ga0307416_102702573 Ga0307416_1027025732 89
251 3300032005 Ga0307411_12211386 Ga0307411_122113861 89
252 3300032126 Ga0307415_100129005 Ga0307415_1001290052 89
253 3300035083 Ga0373926_0072364 Ga0373926_0072364_549_818 89
254 3300035171 Ga0373946_0054343 Ga0373946_0054343_1159_1428 89
255 3300035241 Ga0373961_0034759 Ga0373961_0034759_1099_1368 89
256 3300035725 Ga0373947_0397383 Ga0373947_0397383_79_348 89
257 3300037068 Ga0373925_0053229 Ga0373925_0053229_899_1168 89
258 3300037418 Ga0395900_0162403 Ga0395900_0162403_1771_2040 89
259 3300037466 Ga0395898_0445032 Ga0395898_0445032_172_441 89
260 3300037466 Ga0395898_1105664 Ga0395898_1105664_373_642 89
261 3300037466 Ga0395898_1710907 Ga0395898_1710907_245_514 89
262 3300037853 Ga0436364_0270185 Ga0436364_0270185_381_650 89
263 3300039437 Ga0436365_0646664 Ga0436365_0646664_487_756 89
264 3300039450 Ga0436363_1579135 Ga0436363_1579135_299_568 89
265 3300041451 Ga0451791_1536932 Ga0451791_1536932_686_955 89
266 3300044658 Ga0466972_0464916 Ga0466972_0464916_90_359 89
267 3300044683 Ga0466965_0067276 Ga0466965_0067276_970_1239 89
268 3300044684 Ga0466966_0070490 Ga0466966_0070490_167_436 89
269 3300044684 Ga0466966_0628262 Ga0466966_0628262_238_507 89
270 3300044693 Ga0466961_0161869 Ga0466961_0161869_130_399 89
271 3300044694 Ga0466963_0019538 Ga0466963_0019538_1337_1606 89
272 3300044719 Ga0466971_0045364 Ga0466971_0045364_1191_1460 89
273 3300044735 Ga0466968_0135485 Ga0466968_0135485_622_891 89
274 3300044765 Ga0466970_0077793 Ga0466970_0077793_936_1205 89
275 3300044842 Ga0466957_0026230 Ga0466957_0026230_2898_3167 89
276 3300045049 Ga0466959_1165721 Ga0466959_1165721_32_301 89
277 3300045836 Ga0466958_0012554 Ga0466958_0012554_2760_3029 89
278 3300045976 Ga0466967_0020811 Ga0466967_0020811_2336_2605 89
279 3300045976 Ga0466967_1737957 Ga0466967_1737957_53_322 89
280 3300045976 Ga0466967_1846852 Ga0466967_1846852_193_462 89
281 3300046452 Ga0495617_085065 Ga0495617_085065_558_827 89
282 3300046455 Ga0495603_0019969 Ga0495603_0019969_754_1023 89
283 3300046457 Ga0495590_0276198 Ga0495590_0276198_322_591 89
284 3300046461 Ga0495641_0595728 Ga0495641_0595728_132_401 89
285 3300046491 Ga0495584_0012376 Ga0495584_0012376_198_467 89
286 3300046500 Ga0495596_0093008 Ga0495596_0093008_770_1039 89
287 3300046515 Ga0495620_0187358 Ga0495620_0187358_55_324 89
288 3300046518 Ga0495631_0224813 Ga0495631_0224813_370_639 89
289 3300046520 Ga0495637_0214024 Ga0495637_0214024_390_659 89
290 3300046533 Ga0495640_0790899 Ga0495640_0790899_172_441 89
291 3300046538 Ga0495609_0063655 Ga0495609_0063655_1031_1300 89
292 3300046615 Ga0495656_0114649 Ga0495656_0114649_671_940 89
293 3300046681 Ga0495647_0303624 Ga0495647_0303624_366_635 89
294 3300046690 Ga0495624_0100825 Ga0495624_0100825_1162_1431 89
295 3300047315 Ga0495581_0058957 Ga0495581_0058957_605_874 89
296 3300047317 Ga0495604_0666443 Ga0495604_0666443_197_466 89
297 3300047320 Ga0495672_0054610 Ga0495672_0054610_195_467 89
298 3300047322 Ga0495680_1047609 Ga0495680_1047609_225_494 89
299 3300048091 Ga0495626_0353048 Ga0495626_0353048_193_462 89
300 3300048903 Ga0496100_1691871 Ga0496100_1691871_119_394 89
301 3300048904 Ga0496101_0482818 Ga0496101_0482818_62_331 89
302 3300048908 Ga0496105_0851218 Ga0496105_0851218_187_465 89
303 3300048911 Ga0496108_0944358 Ga0496108_0944358_397_702 89
304 3300048913 Ga0496110_0007529 Ga0496110_0007529_7132_7401 89
305 3300048915 Ga0496112_0121702 Ga0496112_0121702_842_1111 89
306 3300048926 Ga0496123_0279901 Ga0496123_0279901_137_406 89
307 3300049580 Ga0501046_0639013 Ga0501046_0639013_265_534 89
308 3300049583 Ga0501067_0522829 Ga0501067_0522829_304_573 89
309 3300049587 Ga0501071_1214308 Ga0501071_1214308_301_570 89
310 3300049592 Ga0501076_0913839 Ga0501076_0913839_306_575 89
311 3300050509 nmdc:mga0qj67_10891_c1 nmdc:mga0qj67_10891_c1_5168_5437 89
312 3300050511 nmdc:mga08y16_826445_c1 nmdc:mga08y16_826445_c1_147_416 89
313 3300050512 nmdc:mga0n895_624164_c1 nmdc:mga0n895_624164_c1_724_993 89
314 3300053085 Ga0495619_0854279 Ga0495619_0854279_208_477 89
315 3300053104 Ga0500556_0004238 Ga0500556_0004238_1714_1986 89
316 3300053111 Ga0500572_122814 Ga0500572_122814_338_607 89
317 3300053153 Ga0500616_0008865 Ga0500616_0008865_5855_6124 89
318 3300053153 Ga0500616_0017896 Ga0500616_0017896_1698_1970 89
319 3300053736 Ga0500599_007198 Ga0500599_007198_80_352 89
320 3300061719 Ga0466962_0210792 Ga0466962_0210792_546_815 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

9

91

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aoi-assembly1.cif.gz_XF trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.9825 17 58
4v47-assembly1.cif.gz_BT real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.9599 6 85
4v8g-assembly1.cif.gz_AT crystal structure of rmf bound to the 70s ribosome. 0.9498 9 85
7p8k-assembly1.cif.gz_A crystal structure of in planta processed avrrps4 in complex with the wrky domain of rrs1 0.9492 15 63
5lmq-assembly1.cif.gz_T structure of bacterial 30s-if1-if3-mrna-trna translation pre-initiation complex, open form (state-2a) 0.9491 9 85
ID Description Score Start End Superfamily
5o74A00 Mainly Alpha;Up-down Bundle;Ferritin; 0.9676 23 60 1.20.1260.70
af_Q9BPX3_363_558_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9592 12 63 1.25.10.10
4qjtt00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9466 9 85 1.20.58.110
3v26T00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9444 9 85 1.20.58.110
2y14T00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9424 9 85 1.20.58.110
ID Description Score Start End GO Terms
AF-A0A7W0LMQ1-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 1.005 24 83 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A560AFZ8-F1-model_v4 Uncharacterized protein 0.9736 13 79
AF-A0A2H0W0G2-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9661 9 83 GO:0003735
GO:0006412
GO:0015935
GO:0070181
AF-A0A419FMU6-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.944 19 85 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A7V9HDX5-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.943 1 81 GO:0003735
GO:0006412
GO:0015935
GO:0070181

Feature Viewer

pLDDT pTM Quality
93.61 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map