F405295

General Info

Members Datasets Scaffolds Average Seq Length
319 239 304 101

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0259622|Ga0501044_0259622_1135_1488
Length 117
Sequence MHHYGIFHWMAWTTPVAVFFICIVLMLIGMTVWEIKSPTVARRGFLPMATTRGDRLFIGLLAAAYVNLAFAAVSEKMIDWFSLEQEPSIWISWSCARADTFSGGQAAGRHFPAGVPI

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221570 Acidovorax sp. Root568 Isolate Unclassified
5 2643221596 Acidovorax sp. Root70 Isolate Unclassified
6 2643221652 Acidovorax sp. Root402 Isolate Unclassified
7 2738543012 Acidovorax sp. CF301 Isolate Unclassified
8 2816332133 Acidovorax radicis 2721A Isolate Unclassified
9 2831864461 Roseateles noduli HZ7 Isolate Nodule
10 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
11 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
12 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
13 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
14 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
15 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
16 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
122 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
123 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
124 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
125 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
211 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
212 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
228 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
229 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
237 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.3
Metatranscriptomes 0
Isolates 4.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.84
Nodule 1.57
Rhizoplane 5.33
Rhizosphere 51.41
Stem 0
Stem Tuber 0
Unclassified 12.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000085 3300002705 Bacteria 69953
2 JGI25154J39366_1000112 3300002738 Bacteria 69961
3 JGI25157J39369_1000109 3300002741 Bacteria 69961
4 JGI25152J39213_1005194 3300002773 Bacteria 3882
5 JGI25150J39212_1003044 3300002774 Bacteria 4020
6 JGI25159J45721_1009814 3300002987 Bacteria 2494
7 JGI25151J46595_10120520 3300003187 Bacteria 669
8 JGI25153J46596_10012958 3300003215 Bacteria 3558
9 JGI25160J50197_1002743 3300003354 Bacteria 8080
10 JGI25161J50226_1000036 3300003374 Bacteria 133407
11 Ga0055526_1007257 3300003771 Bacteria 5809
12 Ga0055526_1008436 3300003771 Bacteria 5142
13 Ga0055526_1019348 3300003771 Bacteria 2485
14 Ga0055537_1005989 3300003773 Bacteria 3156
15 Ga0055524_1036119 3300003775 Bacteria 1334
16 Ga0055534_1012542 3300003784 Bacteria 1669
17 Ga0055530_10019278 3300003791 Bacteria 2070
18 Ga0055530_10089859 3300003791 Bacteria 632
19 Ga0055531_10024961 3300003794 Bacteria 2187
20 Ga0055543_1000157 3300004625 Bacteria 57172
21 Ga0065165_1015276 3300005262 Bacteria 2935
22 Ga0070658_10109001 3300005327 Bacteria 2292
23 Ga0070658_10511848 3300005327 Bacteria 1037
24 Ga0070668_101177647 3300005347 Bacteria 694
25 Ga0070673_101882636 3300005364 Bacteria 567
26 Ga0070659_100540564 3300005366 Bacteria 997
27 Ga0070678_100751911 3300005456 Bacteria 882
28 Ga0070706_101096877 3300005467 Bacteria 733
29 Ga0070707_100548127 3300005468 Bacteria 1119
30 Ga0070672_100548550 3300005543 Bacteria 1003
31 Ga0068855_100464131 3300005563 Bacteria 1380
32 Ga0068855_101509727 3300005563 Bacteria 690
33 Ga0068857_100504565 3300005577 Bacteria 1136
34 Ga0068854_100019010 3300005578 Bacteria 4622
35 Ga0068856_100110263 3300005614 Bacteria 2749
36 Ga0068856_100328914 3300005614 Bacteria 1546
37 Ga0068852_100029773 3300005616 Bacteria 4488
38 Ga0068859_101035624 3300005617 Bacteria 902
39 Ga0081539_10000155 3300005985 Bacteria 159271
40 Ga0075364_10568743 3300006051 Bacteria 775
41 Ga0070715_10111018 3300006163 Bacteria 1293
42 Ga0075362_10148304 3300006177 Bacteria 1124
43 Ga0075362_10356489 3300006177 Bacteria 733
44 Ga0075366_10053408 3300006195 Bacteria 2400
45 Ga0075366_10067381 3300006195 Bacteria 2130
46 Ga0075366_10122985 3300006195 Bacteria 1564
47 Ga0075366_10308019 3300006195 Bacteria 969
48 Ga0075370_10089082 3300006353 Bacteria 1779
49 Ga0075370_10116782 3300006353 Bacteria 1551
50 Ga0097620_101035709 3300006931 Bacteria 902
51 Ga0099823_1000016 3300006944 Bacteria 87614
52 Ga0099826_10135605 3300006948 Bacteria 1429
53 Ga0105240_10002549 3300009093 Bacteria 29203
54 Ga0105240_10067504 3300009093 Bacteria 4432
55 Ga0105243_10039890 3300009148 Bacteria 3664
56 Ga0105243_10550449 3300009148 Bacteria 1102
57 Ga0105241_11075417 3300009174 Bacteria 756
58 Ga0105242_10886514 3300009176 Bacteria 891
59 Ga0105237_10600650 3300009545 Bacteria 1107
60 Ga0105237_10959601 3300009545 Bacteria 862
61 Ga0105238_10000152 3300009551 Bacteria 75994
62 Ga0105238_10121884 3300009551 Bacteria 2587
63 Ga0105239_10126894 3300010375 Bacteria 2836
64 Ga0105239_11160134 3300010375 Bacteria 890
65 Ga0105239_11896820 3300010375 Bacteria 691
66 Ga0105246_10338360 3300011119 Bacteria 1229
67 Ga0157326_1000664 3300012513 Bacteria 4040
68 Ga0157370_11039583 3300013104 Bacteria 741
69 Ga0157378_11214868 3300013297 Bacteria 793
70 Ga0157372_12142200 3300013307 Bacteria 642
71 Ga0182008_10000141 3300014497 Bacteria 55405
72 Ga0157377_10000010 3300014745 Bacteria 380929
73 Ga0182006_1000002 3300015261 Bacteria 887990
74 Ga0182006_1092888 3300015261 Bacteria 1083
75 Ga0182006_1206775 3300015261 Bacteria 649
76 Ga0182007_10000085 3300015262 Bacteria 70105
77 Ga0182005_1000002 3300015265 Bacteria 908499
78 Ga0163161_10008917 3300017792 Bacteria 6933
79 Ga0163161_10326950 3300017792 Bacteria 1213
80 Ga0209435_100002 3300025206 Bacteria 794178
81 Ga0209436_108696 3300025208 Bacteria 1997
82 Ga0207425_1000789 3300025245 Bacteria 16158
83 Ga0207425_1008495 3300025245 Bacteria 2622
84 Ga0209646_1000001 3300025246 Bacteria 3092932
85 Ga0209026_1000121 3300025250 Bacteria 126801
86 Ga0209677_109741 3300025253 Bacteria 1683
87 Ga0209759_1000001 3300025256 Bacteria 2799452
88 Ga0209759_1022942 3300025256 Bacteria 1385
89 Ga0209129_1000212 3300025258 Bacteria 67061
90 Ga0209129_1031631 3300025258 Bacteria 880
91 Ga0209565_1001447 3300025263 Bacteria 10465
92 Ga0209565_1044037 3300025263 Bacteria 822
93 Ga0209673_1004612 3300025273 Bacteria 7300
94 Ga0209673_1015609 3300025273 Bacteria 2875
95 Ga0209673_1040068 3300025273 Bacteria 1344
96 Ga0209130_1000109 3300025284 Bacteria 133520
97 Ga0209675_1005908 3300025291 Bacteria 5021
98 Ga0209025_1032311 3300025294 Bacteria 2450
99 Ga0209025_1058172 3300025294 Bacteria 1471
100 Ga0209025_1076592 3300025294 Bacteria 1158
101 Ga0209564_1000024 3300025295 Bacteria 535041
102 Ga0209564_1000229 3300025295 Bacteria 125047
103 Ga0209564_1003205 3300025295 Bacteria 11491
104 Ga0209758_1000558 3300025297 Bacteria 58712
105 Ga0209758_1018077 3300025297 Bacteria 3474
106 Ga0209050_1001700 3300025298 Bacteria 21999
107 Ga0209256_1000493 3300025299 Bacteria 58089
108 Ga0209256_1030595 3300025299 Bacteria 1484
109 Ga0209256_1033526 3300025299 Bacteria 1380
110 Ga0207426_1001071 3300025302 Bacteria 25720
111 Ga0209051_1000934 3300025303 Bacteria 28827
112 Ga0209257_1000401 3300025304 Bacteria 84658
113 Ga0209257_1002710 3300025304 Bacteria 16875
114 Ga0209257_1026796 3300025304 Bacteria 1933
115 Ga0207685_10405290 3300025905 Bacteria 700
116 Ga0207705_10113624 3300025909 Bacteria 2003
117 Ga0207684_10128937 3300025910 Bacteria 2171
118 Ga0207695_10000587 3300025913 Bacteria 73386
119 Ga0207671_10044917 3300025914 Bacteria 3266
120 Ga0207657_10231473 3300025919 Bacteria 1478
121 Ga0207646_10976465 3300025922 Bacteria 749
122 Ga0207694_10000536 3300025924 Bacteria 34468
123 Ga0207694_11382735 3300025924 Bacteria 595
124 Ga0207690_10749028 3300025932 Bacteria 805
125 Ga0207686_11169958 3300025934 Bacteria 629
126 Ga0207709_10001617 3300025935 Bacteria 15323
127 Ga0207691_10771048 3300025940 Bacteria 809
128 Ga0207667_10046374 3300025949 Bacteria 4601
129 Ga0207667_10259526 3300025949 Bacteria 1777
130 Ga0207667_10422287 3300025949 Bacteria 1357
131 Ga0207640_10012187 3300025981 Bacteria 4891
132 Ga0207702_10330538 3300026078 Bacteria 1454
133 Ga0207648_10000002 3300026089 Bacteria 307909
134 Ga0207674_10386328 3300026116 Bacteria 1353
135 Ga0207674_11627249 3300026116 Bacteria 614
136 Ga0207675_102671574 3300026118 Bacteria 508
137 Ga0207683_10503173 3300026121 Bacteria 1119
138 Ga0209389_1014014 3300027296 Bacteria 7284
139 Ga0209371_1012817 3300027312 Bacteria 2399
140 Ga0209282_1198313 3300027666 Bacteria 927
141 Ga0209974_10005809 3300027876 Bacteria 4327
142 Ga0209974_10290685 3300027876 Bacteria 623
143 Ga0307515_10000013 3300028794 Bacteria 568456
144 Ga0307515_10000037 3300028794 Bacteria 331970
145 Ga0307515_10160704 3300028794 Bacteria 2293
146 Ga0268256_1014022 3300030500 Bacteria 2399
147 Ga0307511_10007232 3300030521 Bacteria 11186
148 Ga0316177_1059326 3300030731 Bacteria 1876
149 Ga0314311_1148786 3300030733 Bacteria 1247
150 Ga0316179_1017977 3300030734 Bacteria 2727
151 Ga0316178_1100324 3300030735 Bacteria 2141
152 Ga0316180_1156383 3300030736 Bacteria 1871
153 Ga0316183_1065527 3300030742 Bacteria 5155
154 Ga0316181_1183277 3300030744 Bacteria 1679
155 Ga0316182_1158223 3300030745 Bacteria 876
156 Ga0307513_10000028 3300031456 Bacteria 193264
157 Ga0307513_10027231 3300031456 Bacteria 6568
158 Ga0307513_10243285 3300031456 Bacteria 1602
159 Ga0307408_101215372 3300031548 Bacteria 703
160 Ga0307408_101288196 3300031548 Bacteria 684
161 Ga0307408_101370273 3300031548 Bacteria 665
162 Ga0307408_101786047 3300031548 Bacteria 587
163 Ga0307508_10367740 3300031616 Bacteria 1029
164 Ga0307516_10300824 3300031730 Bacteria 1280
165 Ga0307405_10354035 3300031731 Bacteria 1133
166 Ga0307413_10495620 3300031824 Bacteria 980
167 Ga0307406_10279751 3300031901 Bacteria 1272
168 Ga0307406_10791857 3300031901 Bacteria 799
169 Ga0307406_12057140 3300031901 Bacteria 511
170 Ga0307407_11337604 3300031903 Bacteria 563
171 Ga0307412_10026597 3300031911 Bacteria 3598
172 Ga0307409_100375493 3300031995 Bacteria 1350
173 Ga0307409_100568251 3300031995 Bacteria 1116
174 Ga0307416_100389281 3300032002 Bacteria 1427
175 Ga0307416_101961239 3300032002 Bacteria 688
176 Ga0307414_10847759 3300032004 Bacteria 835
177 Ga0307414_10974150 3300032004 Bacteria 780
178 Ga0307411_10411295 3300032005 Bacteria 1121
179 Ga0307411_10944537 3300032005 Bacteria 769
180 Ga0307411_11854671 3300032005 Bacteria 560
181 Ga0307415_101159500 3300032126 Bacteria 726
182 Ga0373934_0132181 3300035086 Bacteria 1018
183 Ga0373954_0622766 3300035118 Bacteria 535
184 Ga0373931_0005862 3300035691 Bacteria 5716
185 Ga0436361_0738209 3300039447 Bacteria 13310
186 Ga0439465_0372234 3300041413 Bacteria 541
187 Ga0451789_0598525 3300041443 Bacteria 800
188 Ga0451789_0635489 3300041443 Bacteria 1416
189 Ga0451793_0508277 3300041452 Bacteria 1593
190 Ga0451797_0967027 3300041453 Bacteria 658
191 Ga0451795_0009169 3300041456 Bacteria 2183
192 Ga0451795_1618904 3300041456 Bacteria 988
193 Ga0451798_0555899 3300041458 Bacteria 1435
194 Ga0451802_1200834 3300041460 Bacteria 1405
195 Ga0451804_0388358 3300041463 Bacteria 1478
196 Ga0451807_2640304 3300041486 Bacteria 1752
197 Ga0451839_0182555 3300041496 Bacteria 773
198 Ga0451841_0820360 3300041498 Bacteria 530
199 Ga0451851_0001646 3300041507 Bacteria 556
200 Ga0451851_0579054 3300041507 Bacteria 1182
201 Ga0439441_086256 3300042001 Bacteria 689
202 Ga0439445_0181275 3300042004 Bacteria 619
203 Ga0439457_047620 3300042014 Bacteria 960
204 Ga0450898_028953 3300042134 Bacteria 1008
205 Ga0450898_083254 3300042134 Bacteria 653
206 Ga0439459_0010886 3300042438 Bacteria 1594
207 Ga0451577_0000191 3300042876 Bacteria 128991
208 Ga0451577_1395173 3300042876 Bacteria 621
209 Ga0453683_0003423 3300044673 Bacteria 11701
210 Ga0453684_0000590 3300044712 Bacteria 134718
211 Ga0453684_0788087 3300044712 Bacteria 1026
212 Ga0453684_1721587 3300044712 Bacteria 640
213 Ga0451576_0004219 3300045051 Bacteria 18885
214 Ga0451576_1102665 3300045051 Bacteria 830
215 Ga0466967_1134076 3300045976 Bacteria 779
216 Ga0495638_0545312 3300046460 Bacteria 577
217 Ga0495605_0256090 3300046474 Bacteria 748
218 Ga0495585_0039740 3300046492 Bacteria 2644
219 Ga0495583_0379819 3300046506 Bacteria 556
220 Ga0495606_0054659 3300046507 Bacteria 2585
221 Ga0495606_0469030 3300046507 Bacteria 641
222 Ga0495620_0172265 3300046515 Bacteria 839
223 Ga0495631_0082045 3300046518 Bacteria 1390
224 Ga0495632_0196367 3300046519 Bacteria 920
225 Ga0495663_0147656 3300046525 Bacteria 801
226 Ga0495642_0133480 3300046528 Bacteria 1069
227 Ga0495633_0004906 3300046558 Bacteria 8354
228 Ga0495633_0107408 3300046558 Bacteria 1294
229 Ga0495668_0325980 3300046616 Bacteria 842
230 Ga0495611_0087722 3300046648 Bacteria 1436
231 Ga0495611_0136595 3300046648 Bacteria 1145
232 Ga0495661_0230405 3300046665 Bacteria 955
233 Ga0495670_0039592 3300046691 Bacteria 2351
234 Ga0495683_0246925 3300047323 Bacteria 785
235 Ga0495681_0088598 3300047470 Bacteria 1370
236 Ga0495686_0000682 3300047472 Bacteria 45923
237 Ga0496104_0586223 3300048907 Bacteria 1025
238 Ga0496105_0171403 3300048908 Bacteria 1779
239 Ga0496108_0854692 3300048911 Bacteria 783
240 Ga0496111_0256871 3300048914 Bacteria 1296
241 Ga0496114_0501708 3300048917 Bacteria 1073
242 Ga0496115_0125353 3300048918 Bacteria 2115
243 Ga0496116_0052596 3300048919 Bacteria 2697
244 Ga0496117_0000001 3300048920 Bacteria 2526244
245 Ga0496118_0000002 3300048921 Bacteria 1690764
246 Ga0496121_0000684 3300048924 Bacteria 63147
247 Ga0496121_0006287 3300048924 Bacteria 14847
248 Ga0496122_0006637 3300048925 Bacteria 13197
249 Ga0496123_0001631 3300048926 Bacteria 30231
250 Ga0496123_0283996 3300048926 Bacteria 798
251 Ga0496124_0023248 3300048927 Bacteria 5663
252 Ga0496124_0213956 3300048927 Bacteria 1456
253 Ga0496124_0520824 3300048927 Bacteria 792
254 Ga0496125_0071390 3300048928 Bacteria 2712
255 Ga0496125_0184900 3300048928 Bacteria 1383
256 Ga0495682_0069231 3300049460 Bacteria 1270
257 Ga0501036_1507137 3300049572 Bacteria 544
258 Ga0501037_0784712 3300049573 Bacteria 630
259 Ga0501042_0847825 3300049578 Bacteria 665
260 Ga0501043_0000101 3300049579 Bacteria 78983
261 Ga0501046_0000135 3300049580 Bacteria 79084
262 Ga0501047_0000173 3300049581 Bacteria 79071
263 Ga0501249_020266 3300049679 Bacteria 1446
264 Ga0501225_0059144 3300049705 Bacteria 1076
265 Ga0501241_053907 3300049758 Bacteria 798
266 Ga0501262_000189 3300049759 Bacteria 7646
267 Ga0501280_118896 3300049776 Bacteria 522
268 Ga0501044_0259622 3300049823 Bacteria 1676
269 Ga0501045_0197406 3300049824 Bacteria 1499
270 nmdc:mga03683_82031_c1 3300050489 Bacteria 1394
271 nmdc:mga0yw44_126698_c1 3300050492 Bacteria 1649
272 nmdc:mga0k408_174666_c1 3300050493 Bacteria 1281
273 nmdc:mga0k408_294054_c1 3300050493 Bacteria 969
274 nmdc:mga0k408_52231_c1 3300050493 Bacteria 2369
275 nmdc:mga0k408_76755_c1 3300050493 Bacteria 1953
276 nmdc:mga07m45_161328_c1 3300050496 Bacteria 1301
277 nmdc:mga07m45_235706_c1 3300050496 Bacteria 1065
278 nmdc:mga07m45_403215_c1 3300050496 Bacteria 794
279 Ga0500578_0000064 3300053086 Bacteria 117170
280 Ga0500644_0316367 3300053088 Bacteria 670
281 Ga0500646_0156250 3300053090 Bacteria 758
282 Ga0500583_0260326 3300053092 Bacteria 855
283 Ga0500583_0433707 3300053092 Bacteria 626
284 Ga0500651_0018524 3300053093 Bacteria 4310
285 Ga0500651_0087017 3300053093 Bacteria 1929
286 Ga0500641_0423231 3300053096 Bacteria 519
287 Ga0500650_0120658 3300053098 Bacteria 1222
288 Ga0500562_187841 3300053108 Bacteria 561
289 Ga0500569_099566 3300053109 Bacteria 951
290 Ga0500594_0235861 3300053118 Bacteria 607
291 Ga0500623_236751 3300053127 Bacteria 627
292 Ga0500642_0081211 3300053130 Bacteria 1489
293 Ga0500652_006484 3300053131 Bacteria 3770
294 Ga0500655_052871 3300053133 Bacteria 811
295 Ga0500658_0235950 3300053134 Bacteria 840
296 Ga0500561_0176949 3300053137 Bacteria 671
297 Ga0500568_0097426 3300053139 Bacteria 1105
298 Ga0500568_0296941 3300053139 Bacteria 586
299 Ga0500588_0129956 3300053146 Bacteria 896
300 Ga0500588_0331943 3300053146 Bacteria 577
301 Ga0500604_0128329 3300053151 Bacteria 851
302 Ga0500604_0194838 3300053151 Bacteria 696
303 Ga0500622_0001348 3300053156 Bacteria 19872
304 Ga0500637_0460801 3300053178 Bacteria 642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_101882636 Ga0070673_1018826362 91
2 3300005563 Ga0068855_101509727 Ga0068855_1015097272 91
3 3300005577 Ga0068857_100504565 Ga0068857_1005045652 91
4 3300005578 Ga0068854_100019010 Ga0068854_1000190104 91
5 3300005614 Ga0068856_100110263 Ga0068856_1001102633 91
6 3300005614 Ga0068856_100328914 Ga0068856_1003289142 91
7 3300005616 Ga0068852_100029773 Ga0068852_1000297735 91
8 3300005617 Ga0068859_101035624 Ga0068859_1010356242 91
9 3300005985 Ga0081539_10000155 Ga0081539_1000015583 91
10 3300006931 Ga0097620_101035709 Ga0097620_1010357092 91
11 3300009093 Ga0105240_10002549 Ga0105240_1000254915 91
12 3300009093 Ga0105240_10067504 Ga0105240_100675043 91
13 3300009545 Ga0105237_10600650 Ga0105237_106006502 91
14 3300009545 Ga0105237_10959601 Ga0105237_109596012 91
15 3300009551 Ga0105238_10000152 Ga0105238_1000015253 91
16 3300009551 Ga0105238_10121884 Ga0105238_101218842 91
17 3300010375 Ga0105239_10126894 Ga0105239_101268943 91
18 3300014497 Ga0182008_10000141 Ga0182008_100001414 91
19 3300015261 Ga0182006_1000002 Ga0182006_1000002684 91
20 3300015261 Ga0182006_1092888 Ga0182006_10928882 91
21 3300015262 Ga0182007_10000085 Ga0182007_1000008556 91
22 3300015265 Ga0182005_1000002 Ga0182005_1000002412 91
23 3300017792 Ga0163161_10008917 Ga0163161_100089177 91
24 3300017792 Ga0163161_10326950 Ga0163161_103269502 91
25 3300025913 Ga0207695_10000587 Ga0207695_1000058732 91
26 3300025914 Ga0207671_10044917 Ga0207671_100449174 91
27 3300025924 Ga0207694_10000536 Ga0207694_100005366 91
28 3300025949 Ga0207667_10259526 Ga0207667_102595262 91
29 3300025981 Ga0207640_10012187 Ga0207640_100121873 91
30 3300026078 Ga0207702_10330538 Ga0207702_103305382 91
31 3300026116 Ga0207674_10386328 Ga0207674_103863282 91
32 3300032004 Ga0307414_10847759 Ga0307414_108477591 91
33 3300032004 Ga0307414_10974150 Ga0307414_109741502 91
34 3300046474 Ga0495605_0256090 Ga0495605_0256090_408_692 91
35 3300046492 Ga0495585_0039740 Ga0495585_0039740_356_640 91
36 3300046506 Ga0495583_0379819 Ga0495583_0379819_238_522 91
37 3300046507 Ga0495606_0054659 Ga0495606_0054659_2175_2459 91
38 3300046507 Ga0495606_0469030 Ga0495606_0469030_245_529 91
39 3300046518 Ga0495631_0082045 Ga0495631_0082045_408_692 91
40 3300046525 Ga0495663_0147656 Ga0495663_0147656_408_692 91
41 3300046528 Ga0495642_0133480 Ga0495642_0133480_138_422 91
42 3300046558 Ga0495633_0004906 Ga0495633_0004906_7307_7609 91
43 3300046558 Ga0495633_0107408 Ga0495633_0107408_360_644 91
44 3300046616 Ga0495668_0325980 Ga0495668_0325980_408_692 91
45 3300046648 Ga0495611_0087722 Ga0495611_0087722_858_1142 91
46 3300046665 Ga0495661_0230405 Ga0495661_0230405_582_866 91
47 3300046691 Ga0495670_0039592 Ga0495670_0039592_1564_1848 91
48 3300047323 Ga0495683_0246925 Ga0495683_0246925_223_507 91
49 3300047470 Ga0495681_0088598 Ga0495681_0088598_523_807 91
50 3300047472 Ga0495686_0000682 Ga0495686_0000682_41575_41868 91
51 3300048914 Ga0496111_0256871 Ga0496111_0256871_326_631 91
52 3300048918 Ga0496115_0125353 Ga0496115_0125353_1769_2053 91
53 3300048919 Ga0496116_0052596 Ga0496116_0052596_2201_2503 91
54 3300048920 Ga0496117_0000001 Ga0496117_0000001_1321378_1321683 91
55 3300048921 Ga0496118_0000002 Ga0496118_0000002_1321378_1321683 91
56 3300048924 Ga0496121_0000684 Ga0496121_0000684_471_773 91
57 3300048924 Ga0496121_0006287 Ga0496121_0006287_9717_10022 91
58 3300048925 Ga0496122_0006637 Ga0496122_0006637_397_702 91
59 3300048926 Ga0496123_0001631 Ga0496123_0001631_29793_30098 91
60 3300048927 Ga0496124_0023248 Ga0496124_0023248_4523_4807 91
61 3300048927 Ga0496124_0213956 Ga0496124_0213956_450_755 91
62 3300048928 Ga0496125_0071390 Ga0496125_0071390_1154_1459 91
63 3300049460 Ga0495682_0069231 Ga0495682_0069231_335_637 91
64 3300049776 Ga0501280_118896 Ga0501280_118896_205_489 91
65 iso_pu_bacteria 2600255292 2601667771 91
66 iso_pu_bacteria 2857547612 2857550200 91
67 iso_pu_bacteria 2885080285 2885082570 91
68 3300053139 Ga0500568_0296941 Ga0500568_0296941_10_294 94
69 3300035086 Ga0373934_0132181 Ga0373934_0132181_288_596 97
70 3300010375 Ga0105239_11160134 Ga0105239_111601342 98
71 3300042438 Ga0439459_0010886 Ga0439459_0010886_544_840 98
72 3300048926 Ga0496123_0283996 Ga0496123_0283996_22_318 98
73 3300048927 Ga0496124_0520824 Ga0496124_0520824_402_698 98
74 3300048928 Ga0496125_0184900 Ga0496125_0184900_793_1089 98
75 iso_pu_bacteria 2511231002 2511245071 98
76 iso_pu_bacteria 2585428058 2587735835 98
77 iso_pu_bacteria 2643221570 2643868373 98
78 iso_pu_bacteria 2643221596 2643994484 98
79 iso_pu_bacteria 2643221652 2644295309 98
80 iso_pu_bacteria 2738543012 2739243199 98
81 iso_pu_bacteria 2816332133 2816473774 98
82 iso_pu_bacteria 2831864461 2831868741 98
83 iso_pu_bacteria 2886848708 2886853042 98
84 iso_pu_bacteria 2919462493 2919464078 98
85 iso_pu_bacteria 2919704043 2919708827 98
86 iso_pu_bacteria 2990710928 2990715400 98
87 3300049823 Ga0501044_0259622 Ga0501044_0259622_1135_1488 99
88 3300002705 JGI25156J39149_1000085 JGI25156J39149_10000854 102
89 3300002738 JGI25154J39366_1000112 JGI25154J39366_10001124 102
90 3300002741 JGI25157J39369_1000109 JGI25157J39369_100010966 102
91 3300002773 JGI25152J39213_1005194 JGI25152J39213_10051944 102
92 3300002774 JGI25150J39212_1003044 JGI25150J39212_10030442 102
93 3300002987 JGI25159J45721_1009814 JGI25159J45721_10098144 102
94 3300003187 JGI25151J46595_10120520 JGI25151J46595_101205202 102
95 3300003215 JGI25153J46596_10012958 JGI25153J46596_100129584 102
96 3300003354 JGI25160J50197_1002743 JGI25160J50197_10027436 102
97 3300003374 JGI25161J50226_1000036 JGI25161J50226_100003671 102
98 3300003771 Ga0055526_1007257 Ga0055526_10072576 102
99 3300003771 Ga0055526_1008436 Ga0055526_10084362 102
100 3300003771 Ga0055526_1019348 Ga0055526_10193484 102
101 3300003773 Ga0055537_1005989 Ga0055537_10059892 102
102 3300003775 Ga0055524_1036119 Ga0055524_10361192 102
103 3300003784 Ga0055534_1012542 Ga0055534_10125422 102
104 3300003791 Ga0055530_10019278 Ga0055530_100192782 102
105 3300003791 Ga0055530_10089859 Ga0055530_100898591 102
106 3300003794 Ga0055531_10024961 Ga0055531_100249612 102
107 3300004625 Ga0055543_1000157 Ga0055543_100015719 102
108 3300005262 Ga0065165_1015276 Ga0065165_10152761 102
109 3300005327 Ga0070658_10109001 Ga0070658_101090013 102
110 3300005327 Ga0070658_10511848 Ga0070658_105118482 102
111 3300005347 Ga0070668_101177647 Ga0070668_1011776471 102
112 3300005366 Ga0070659_100540564 Ga0070659_1005405642 102
113 3300005456 Ga0070678_100751911 Ga0070678_1007519112 102
114 3300005467 Ga0070706_101096877 Ga0070706_1010968772 102
115 3300005468 Ga0070707_100548127 Ga0070707_1005481272 102
116 3300005543 Ga0070672_100548550 Ga0070672_1005485502 102
117 3300005563 Ga0068855_100464131 Ga0068855_1004641312 102
118 3300006051 Ga0075364_10568743 Ga0075364_105687432 102
119 3300006163 Ga0070715_10111018 Ga0070715_101110182 102
120 3300006177 Ga0075362_10148304 Ga0075362_101483042 102
121 3300006177 Ga0075362_10356489 Ga0075362_103564892 102
122 3300006195 Ga0075366_10053408 Ga0075366_100534082 102
123 3300006195 Ga0075366_10067381 Ga0075366_100673812 102
124 3300006195 Ga0075366_10122985 Ga0075366_101229852 102
125 3300006195 Ga0075366_10308019 Ga0075366_103080192 102
126 3300006353 Ga0075370_10089082 Ga0075370_100890823 102
127 3300006353 Ga0075370_10116782 Ga0075370_101167823 102
128 3300006944 Ga0099823_1000016 Ga0099823_100001610 102
129 3300006948 Ga0099826_10135605 Ga0099826_101356052 102
130 3300009148 Ga0105243_10039890 Ga0105243_100398905 102
131 3300009148 Ga0105243_10550449 Ga0105243_105504492 102
132 3300009174 Ga0105241_11075417 Ga0105241_110754171 102
133 3300009176 Ga0105242_10886514 Ga0105242_108865142 102
134 3300010375 Ga0105239_11896820 Ga0105239_118968202 102
135 3300011119 Ga0105246_10338360 Ga0105246_103383602 102
136 3300012513 Ga0157326_1000664 Ga0157326_10006643 102
137 3300013104 Ga0157370_11039583 Ga0157370_110395832 102
138 3300013297 Ga0157378_11214868 Ga0157378_112148682 102
139 3300013307 Ga0157372_12142200 Ga0157372_121422001 102
140 3300014745 Ga0157377_10000010 Ga0157377_10000010330 102
141 3300015261 Ga0182006_1206775 Ga0182006_12067752 102
142 3300025206 Ga0209435_100002 Ga0209435_100002698 102
143 3300025208 Ga0209436_108696 Ga0209436_1086962 102
144 3300025245 Ga0207425_1000789 Ga0207425_100078914 102
145 3300025245 Ga0207425_1008495 Ga0207425_10084952 102
146 3300025246 Ga0209646_1000001 Ga0209646_10000012841 102
147 3300025250 Ga0209026_1000121 Ga0209026_100012167 102
148 3300025253 Ga0209677_109741 Ga0209677_1097412 102
149 3300025256 Ga0209759_1000001 Ga0209759_10000012472 102
150 3300025256 Ga0209759_1022942 Ga0209759_10229422 102
151 3300025258 Ga0209129_1000212 Ga0209129_100021229 102
152 3300025258 Ga0209129_1031631 Ga0209129_10316312 102
153 3300025263 Ga0209565_1001447 Ga0209565_10014474 102
154 3300025263 Ga0209565_1044037 Ga0209565_10440372 102
155 3300025273 Ga0209673_1004612 Ga0209673_10046126 102
156 3300025273 Ga0209673_1015609 Ga0209673_10156093 102
157 3300025273 Ga0209673_1040068 Ga0209673_10400682 102
158 3300025284 Ga0209130_1000109 Ga0209130_100010956 102
159 3300025291 Ga0209675_1005908 Ga0209675_10059084 102
160 3300025294 Ga0209025_1032311 Ga0209025_10323112 102
161 3300025294 Ga0209025_1058172 Ga0209025_10581723 102
162 3300025294 Ga0209025_1076592 Ga0209025_10765921 102
163 3300025295 Ga0209564_1000024 Ga0209564_1000024167 102
164 3300025295 Ga0209564_1000229 Ga0209564_10002292 102
165 3300025295 Ga0209564_1003205 Ga0209564_10032051 102
166 3300025297 Ga0209758_1000558 Ga0209758_100055861 102
167 3300025297 Ga0209758_1018077 Ga0209758_10180773 102
168 3300025298 Ga0209050_1001700 Ga0209050_100170020 102
169 3300025299 Ga0209256_1000493 Ga0209256_100049337 102
170 3300025299 Ga0209256_1030595 Ga0209256_10305952 102
171 3300025299 Ga0209256_1033526 Ga0209256_10335263 102
172 3300025302 Ga0207426_1001071 Ga0207426_100107121 102
173 3300025303 Ga0209051_1000934 Ga0209051_100093412 102
174 3300025304 Ga0209257_1000401 Ga0209257_100040133 102
175 3300025304 Ga0209257_1002710 Ga0209257_100271010 102
176 3300025304 Ga0209257_1026796 Ga0209257_10267963 102
177 3300025905 Ga0207685_10405290 Ga0207685_104052901 102
178 3300025909 Ga0207705_10113624 Ga0207705_101136243 102
179 3300025910 Ga0207684_10128937 Ga0207684_101289372 102
180 3300025919 Ga0207657_10231473 Ga0207657_102314732 102
181 3300025922 Ga0207646_10976465 Ga0207646_109764652 102
182 3300025924 Ga0207694_11382735 Ga0207694_113827351 102
183 3300025932 Ga0207690_10749028 Ga0207690_107490282 102
184 3300025934 Ga0207686_11169958 Ga0207686_111699581 102
185 3300025935 Ga0207709_10001617 Ga0207709_100016178 102
186 3300025940 Ga0207691_10771048 Ga0207691_107710482 102
187 3300025949 Ga0207667_10046374 Ga0207667_100463746 102
188 3300025949 Ga0207667_10422287 Ga0207667_104222872 102
189 3300026089 Ga0207648_10000002 Ga0207648_10000002267 102
190 3300026116 Ga0207674_11627249 Ga0207674_116272492 102
191 3300026118 Ga0207675_102671574 Ga0207675_1026715742 102
192 3300026121 Ga0207683_10503173 Ga0207683_105031732 102
193 3300027296 Ga0209389_1014014 Ga0209389_10140143 102
194 3300027312 Ga0209371_1012817 Ga0209371_10128173 102
195 3300027666 Ga0209282_1198313 Ga0209282_11983132 102
196 3300027876 Ga0209974_10005809 Ga0209974_100058093 102
197 3300027876 Ga0209974_10290685 Ga0209974_102906852 102
198 3300028794 Ga0307515_10000013 Ga0307515_10000013187 102
199 3300028794 Ga0307515_10000037 Ga0307515_10000037132 102
200 3300028794 Ga0307515_10160704 Ga0307515_101607043 102
201 3300030500 Ga0268256_1014022 Ga0268256_10140222 102
202 3300030521 Ga0307511_10007232 Ga0307511_100072325 102
203 3300030731 Ga0316177_1059326 Ga0316177_10593262 102
204 3300030733 Ga0314311_1148786 Ga0314311_11487862 102
205 3300030734 Ga0316179_1017977 Ga0316179_10179773 102
206 3300030735 Ga0316178_1100324 Ga0316178_11003242 102
207 3300030736 Ga0316180_1156383 Ga0316180_11563833 102
208 3300030742 Ga0316183_1065527 Ga0316183_10655276 102
209 3300030744 Ga0316181_1183277 Ga0316181_11832772 102
210 3300030745 Ga0316182_1158223 Ga0316182_11582232 102
211 3300031456 Ga0307513_10000028 Ga0307513_10000028187 102
212 3300031456 Ga0307513_10027231 Ga0307513_100272312 102
213 3300031456 Ga0307513_10243285 Ga0307513_102432851 102
214 3300031548 Ga0307408_101215372 Ga0307408_1012153722 102
215 3300031548 Ga0307408_101288196 Ga0307408_1012881962 102
216 3300031548 Ga0307408_101370273 Ga0307408_1013702731 102
217 3300031548 Ga0307408_101786047 Ga0307408_1017860472 102
218 3300031616 Ga0307508_10367740 Ga0307508_103677402 102
219 3300031730 Ga0307516_10300824 Ga0307516_103008242 102
220 3300031731 Ga0307405_10354035 Ga0307405_103540352 102
221 3300031824 Ga0307413_10495620 Ga0307413_104956202 102
222 3300031901 Ga0307406_10279751 Ga0307406_102797513 102
223 3300031901 Ga0307406_10791857 Ga0307406_107918572 102
224 3300031901 Ga0307406_12057140 Ga0307406_120571401 102
225 3300031903 Ga0307407_11337604 Ga0307407_113376041 102
226 3300031911 Ga0307412_10026597 Ga0307412_100265974 102
227 3300031995 Ga0307409_100375493 Ga0307409_1003754932 102
228 3300031995 Ga0307409_100568251 Ga0307409_1005682512 102
229 3300032002 Ga0307416_100389281 Ga0307416_1003892812 102
230 3300032002 Ga0307416_101961239 Ga0307416_1019612391 102
231 3300032005 Ga0307411_10411295 Ga0307411_104112952 102
232 3300032005 Ga0307411_10944537 Ga0307411_109445372 102
233 3300032005 Ga0307411_11854671 Ga0307411_118546712 102
234 3300032126 Ga0307415_101159500 Ga0307415_1011595002 102
235 3300035118 Ga0373954_0622766 Ga0373954_0622766_118_426 102
236 3300035691 Ga0373931_0005862 Ga0373931_0005862_715_1023 102
237 3300039447 Ga0436361_0738209 Ga0436361_0738209_11985_12293 102
238 3300041413 Ga0439465_0372234 Ga0439465_0372234_160_468 102
239 3300041443 Ga0451789_0598525 Ga0451789_0598525_237_545 102
240 3300041443 Ga0451789_0635489 Ga0451789_0635489_348_656 102
241 3300041452 Ga0451793_0508277 Ga0451793_0508277_1193_1501 102
242 3300041453 Ga0451797_0967027 Ga0451797_0967027_114_422 102
243 3300041456 Ga0451795_0009169 Ga0451795_0009169_1624_1932 102
244 3300041456 Ga0451795_1618904 Ga0451795_1618904_320_628 102
245 3300041458 Ga0451798_0555899 Ga0451798_0555899_253_561 102
246 3300041460 Ga0451802_1200834 Ga0451802_1200834_522_830 102
247 3300041463 Ga0451804_0388358 Ga0451804_0388358_539_847 102
248 3300041486 Ga0451807_2640304 Ga0451807_2640304_514_822 102
249 3300041496 Ga0451839_0182555 Ga0451839_0182555_37_345 102
250 3300041498 Ga0451841_0820360 Ga0451841_0820360_157_465 102
251 3300041507 Ga0451851_0001646 Ga0451851_0001646_201_509 102
252 3300041507 Ga0451851_0579054 Ga0451851_0579054_188_496 102
253 3300042001 Ga0439441_086256 Ga0439441_086256_246_554 102
254 3300042004 Ga0439445_0181275 Ga0439445_0181275_226_534 102
255 3300042014 Ga0439457_047620 Ga0439457_047620_266_574 102
256 3300042134 Ga0450898_028953 Ga0450898_028953_431_739 102
257 3300042134 Ga0450898_083254 Ga0450898_083254_172_480 102
258 3300042876 Ga0451577_0000191 Ga0451577_0000191_36982_37290 102
259 3300042876 Ga0451577_1395173 Ga0451577_1395173_14_322 102
260 3300044673 Ga0453683_0003423 Ga0453683_0003423_5013_5321 102
261 3300044712 Ga0453684_0000590 Ga0453684_0000590_42709_43017 102
262 3300044712 Ga0453684_0788087 Ga0453684_0788087_436_744 102
263 3300044712 Ga0453684_1721587 Ga0453684_1721587_284_592 102
264 3300045051 Ga0451576_0004219 Ga0451576_0004219_1704_2012 102
265 3300045051 Ga0451576_1102665 Ga0451576_1102665_222_530 102
266 3300045976 Ga0466967_1134076 Ga0466967_1134076_260_568 102
267 3300046460 Ga0495638_0545312 Ga0495638_0545312_130_438 102
268 3300046515 Ga0495620_0172265 Ga0495620_0172265_115_423 102
269 3300046519 Ga0495632_0196367 Ga0495632_0196367_261_569 102
270 3300046648 Ga0495611_0136595 Ga0495611_0136595_739_1047 102
271 3300048907 Ga0496104_0586223 Ga0496104_0586223_273_581 102
272 3300048908 Ga0496105_0171403 Ga0496105_0171403_1076_1384 102
273 3300048911 Ga0496108_0854692 Ga0496108_0854692_231_539 102
274 3300048917 Ga0496114_0501708 Ga0496114_0501708_326_634 102
275 3300049572 Ga0501036_1507137 Ga0501036_1507137_61_384 102
276 3300049573 Ga0501037_0784712 Ga0501037_0784712_258_566 102
277 3300049578 Ga0501042_0847825 Ga0501042_0847825_236_559 102
278 3300049579 Ga0501043_0000101 Ga0501043_0000101_15028_15351 102
279 3300049580 Ga0501046_0000135 Ga0501046_0000135_63613_63936 102
280 3300049581 Ga0501047_0000173 Ga0501047_0000173_15135_15458 102
281 3300049679 Ga0501249_020266 Ga0501249_020266_365_673 102
282 3300049705 Ga0501225_0059144 Ga0501225_0059144_109_417 102
283 3300049758 Ga0501241_053907 Ga0501241_053907_274_582 102
284 3300049759 Ga0501262_000189 Ga0501262_000189_752_1060 102
285 3300049824 Ga0501045_0197406 Ga0501045_0197406_321_644 102
286 3300050489 nmdc:mga03683_82031_c1 nmdc:mga03683_82031_c1_296_604 102
287 3300050492 nmdc:mga0yw44_126698_c1 nmdc:mga0yw44_126698_c1_475_783 102
288 3300050493 nmdc:mga0k408_174666_c1 nmdc:mga0k408_174666_c1_185_493 102
289 3300050493 nmdc:mga0k408_294054_c1 nmdc:mga0k408_294054_c1_254_562 102
290 3300050493 nmdc:mga0k408_52231_c1 nmdc:mga0k408_52231_c1_1219_1527 102
291 3300050493 nmdc:mga0k408_76755_c1 nmdc:mga0k408_76755_c1_808_1116 102
292 3300050496 nmdc:mga07m45_161328_c1 nmdc:mga07m45_161328_c1_159_467 102
293 3300050496 nmdc:mga07m45_235706_c1 nmdc:mga07m45_235706_c1_150_458 102
294 3300050496 nmdc:mga07m45_403215_c1 nmdc:mga07m45_403215_c1_358_666 102
295 3300053086 Ga0500578_0000064 Ga0500578_0000064_87334_87642 102
296 3300053088 Ga0500644_0316367 Ga0500644_0316367_82_390 102
297 3300053090 Ga0500646_0156250 Ga0500646_0156250_401_709 102
298 3300053092 Ga0500583_0260326 Ga0500583_0260326_393_701 102
299 3300053092 Ga0500583_0433707 Ga0500583_0433707_128_436 102
300 3300053093 Ga0500651_0018524 Ga0500651_0018524_2815_3123 102
301 3300053093 Ga0500651_0087017 Ga0500651_0087017_1535_1843 102
302 3300053096 Ga0500641_0423231 Ga0500641_0423231_116_424 102
303 3300053098 Ga0500650_0120658 Ga0500650_0120658_803_1111 102
304 3300053108 Ga0500562_187841 Ga0500562_187841_141_449 102
305 3300053109 Ga0500569_099566 Ga0500569_099566_416_724 102
306 3300053118 Ga0500594_0235861 Ga0500594_0235861_141_449 102
307 3300053127 Ga0500623_236751 Ga0500623_236751_40_348 102
308 3300053130 Ga0500642_0081211 Ga0500642_0081211_157_465 102
309 3300053131 Ga0500652_006484 Ga0500652_006484_1185_1493 102
310 3300053133 Ga0500655_052871 Ga0500655_052871_133_441 102
311 3300053134 Ga0500658_0235950 Ga0500658_0235950_280_588 102
312 3300053137 Ga0500561_0176949 Ga0500561_0176949_346_654 102
313 3300053139 Ga0500568_0097426 Ga0500568_0097426_672_980 102
314 3300053146 Ga0500588_0129956 Ga0500588_0129956_205_513 102
315 3300053146 Ga0500588_0331943 Ga0500588_0331943_112_420 102
316 3300053151 Ga0500604_0128329 Ga0500604_0128329_315_623 102
317 3300053151 Ga0500604_0194838 Ga0500604_0194838_257_565 102
318 3300053156 Ga0500622_0001348 Ga0500622_0001348_18668_18976 102
319 3300053178 Ga0500637_0460801 Ga0500637_0460801_59_367 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09928

DUF2160

Predicted small integral membrane protein (DUF2160)

9

101

0.9

Feature Viewer

pLDDT pTM Quality
69.99 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map