F405120

General Info

Members Datasets Scaffolds Average Seq Length
319 249 296 126

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10432056|Ga0207670_104320562
Length 138
Sequence MASLDHIGLSVSDFAAAKAFYGAALTPLGIALQMEVTKKETGGAYEGAGFGTAGKPFFWVGSGGGKVTPGVHVAFAAGNRADVDAFYQAAIAAGGKDNGPPGLRTHYHPTYYGAFVLDADGNNIEACCHEPPAQAEKK

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
3 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
4 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
5 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
6 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
7 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
8 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
9 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
10 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
11 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
12 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
13 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
14 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
15 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
16 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
17 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
18 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
19 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
20 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
21 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
22 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
23 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 6.58
Rhizoplane 3.76
Rhizosphere 84.01
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000136 3300002741 Bacteria 61418
2 Ga0070690_100335897 3300005330 Bacteria 1093
3 Ga0070670_100636574 3300005331 Bacteria 956
4 Ga0068869_100041656 3300005334 Bacteria 3289
5 Ga0068869_100551857 3300005334 Bacteria 968
6 Ga0070666_11363915 3300005335 Bacteria 529
7 Ga0070680_100005298 3300005336 Bacteria 9757
8 Ga0068868_100275704 3300005338 Bacteria 1422
9 Ga0070689_100135765 3300005340 Bacteria 1975
10 Ga0070691_10089487 3300005341 Bacteria 1516
11 Ga0070675_100070841 3300005354 Bacteria 2891
12 Ga0070674_100194250 3300005356 Bacteria 1563
13 Ga0070673_100395315 3300005364 Bacteria 1235
14 Ga0070673_100612470 3300005364 Bacteria 994
15 Ga0070703_10006177 3300005406 Bacteria 3352
16 Ga0070701_10330236 3300005438 Bacteria 946
17 Ga0070705_100000171 3300005440 Bacteria 37880
18 Ga0070705_100834692 3300005440 Bacteria 736
19 Ga0070700_100039219 3300005441 Bacteria 2892
20 Ga0070694_100001844 3300005444 Bacteria 12550
21 Ga0070694_100210375 3300005444 Bacteria 1454
22 Ga0070708_100038930 3300005445 Bacteria 4158
23 Ga0070708_100996411 3300005445 Bacteria 786
24 Ga0070663_100010498 3300005455 Bacteria 5772
25 Ga0070663_100519877 3300005455 Bacteria 991
26 Ga0070681_10020366 3300005458 Bacteria 6648
27 Ga0068867_100115166 3300005459 Bacteria 2070
28 Ga0070698_100123177 3300005471 Bacteria 2551
29 Ga0070698_100307609 3300005471 Bacteria 1516
30 Ga0070699_100000167 3300005518 Bacteria 63239
31 Ga0070697_100007449 3300005536 Bacteria 8520
32 Ga0070695_100002688 3300005545 Bacteria 10292
33 Ga0070696_100000417 3300005546 Bacteria 26590
34 Ga0070693_100035904 3300005547 Bacteria 2752
35 Ga0070665_100287186 3300005548 Bacteria 1647
36 Ga0070704_100010186 3300005549 Bacteria 5717
37 Ga0070704_100203673 3300005549 Bacteria 1599
38 Ga0070704_100278058 3300005549 Bacteria 1386
39 Ga0068857_100134392 3300005577 Bacteria 2233
40 Ga0070702_100383528 3300005615 Bacteria 1000
41 Ga0068859_100028533 3300005617 Bacteria 5596
42 Ga0068859_100816938 3300005617 Bacteria 1019
43 Ga0068864_100291062 3300005618 Bacteria 1527
44 Ga0068864_101213873 3300005618 Bacteria 753
45 Ga0068861_100090570 3300005719 Bacteria 2413
46 Ga0068861_100225832 3300005719 Bacteria 1585
47 Ga0068861_100638954 3300005719 Bacteria 982
48 Ga0068870_10663221 3300005840 Bacteria 716
49 Ga0068863_100104171 3300005841 Bacteria 2699
50 Ga0068863_101447320 3300005841 Bacteria 695
51 Ga0068858_100038228 3300005842 Bacteria 4451
52 Ga0068858_101460241 3300005842 Bacteria 674
53 Ga0068860_100018242 3300005843 Bacteria 6829
54 Ga0068862_100015426 3300005844 Bacteria 6346
55 Ga0081538_10147177 3300005981 Bacteria 1074
56 Ga0075365_10161438 3300006038 Bacteria 1561
57 Ga0097621_100056077 3300006237 Bacteria 3218
58 Ga0097621_100080936 3300006237 Bacteria 2702
59 Ga0097621_100191909 3300006237 Bacteria 1769
60 Ga0068871_100020067 3300006358 Bacteria 5115
61 Ga0068871_100031142 3300006358 Bacteria 4204
62 Ga0068871_100046091 3300006358 Bacteria 3510
63 Ga0075430_100007945 3300006846 Bacteria 8966
64 Ga0075431_100001530 3300006847 Bacteria 21428
65 Ga0075436_100017731 3300006914 Bacteria 4873
66 Ga0097620_100028534 3300006931 Bacteria 5596
67 Ga0097620_100817130 3300006931 Bacteria 1019
68 Ga0075435_100984939 3300007076 Bacteria 736
69 Ga0105250_10124974 3300009092 Bacteria 1059
70 Ga0105240_10237128 3300009093 Bacteria 2116
71 Ga0105245_10282574 3300009098 Bacteria 1623
72 Ga0105247_10040484 3300009101 Bacteria 2848
73 Ga0114129_10113060 3300009147 Bacteria 3744
74 Ga0114129_10374794 3300009147 Bacteria 1880
75 Ga0114129_10401557 3300009147 Bacteria 1806
76 Ga0105241_10342042 3300009174 Bacteria 1296
77 Ga0105242_11097493 3300009176 Bacteria 809
78 Ga0105248_10014635 3300009177 Bacteria 8631
79 Ga0105238_10008604 3300009551 Bacteria 10210
80 Ga0105238_11912706 3300009551 Bacteria 626
81 Ga0105249_10004920 3300009553 Bacteria 11524
82 Ga0105249_10951599 3300009553 Bacteria 927
83 Ga0105239_11798436 3300010375 Bacteria 710
84 Ga0105246_10363081 3300011119 Bacteria 1190
85 Ga0105246_10485710 3300011119 Bacteria 1046
86 Ga0157374_10993546 3300013296 Bacteria 858
87 Ga0157378_10000378 3300013297 Bacteria 44017
88 Ga0157378_10908186 3300013297 Bacteria 912
89 Ga0163162_10022972 3300013306 Bacteria 6151
90 Ga0157375_10051111 3300013308 Bacteria 4057
91 Ga0157380_12047459 3300014326 Bacteria 635
92 Ga0157379_10171487 3300014968 Bacteria 1959
93 Ga0157376_10100405 3300014969 Bacteria 2527
94 Ga0213872_10016238 3300021361 Bacteria 3457
95 Ga0213874_10031399 3300021377 Bacteria 1537
96 Ga0213875_10628176 3300021388 Bacteria 520
97 Ga0209646_1027601 3300025246 Bacteria 781
98 Ga0209026_1000002 3300025250 Bacteria 1136158
99 Ga0209759_1000238 3300025256 Bacteria 81844
100 Ga0209676_1001997 3300025292 Bacteria 16139
101 Ga0207682_10121082 3300025893 Bacteria 1161
102 Ga0207710_10147866 3300025900 Bacteria 1138
103 Ga0207643_10485428 3300025908 Bacteria 789
104 Ga0207654_10561145 3300025911 Bacteria 812
105 Ga0207707_10023867 3300025912 Bacteria 5348
106 Ga0207695_10182620 3300025913 Bacteria 2018
107 Ga0207671_11463037 3300025914 Bacteria 528
108 Ga0207660_10081559 3300025917 Bacteria 2378
109 Ga0207662_11168404 3300025918 Bacteria 547
110 Ga0207694_10846092 3300025924 Bacteria 773
111 Ga0207687_10126861 3300025927 Bacteria 1917
112 Ga0207686_10702378 3300025934 Bacteria 804
113 Ga0207670_10432056 3300025936 Bacteria 1059
114 Ga0207669_10122812 3300025937 Bacteria 1767
115 Ga0207669_11505160 3300025937 Bacteria 574
116 Ga0207704_10699331 3300025938 Bacteria 839
117 Ga0207711_10005309 3300025941 Bacteria 10925
118 Ga0207689_10028715 3300025942 Bacteria 4651
119 Ga0207689_10549573 3300025942 Bacteria 970
120 Ga0207651_10316650 3300025960 Bacteria 1303
121 Ga0207712_10005088 3300025961 Bacteria 8313
122 Ga0207677_10244897 3300026023 Bacteria 1452
123 Ga0207703_10047940 3300026035 Bacteria 3446
124 Ga0207678_10023515 3300026067 Bacteria 5389
125 Ga0207678_10436127 3300026067 Bacteria 1137
126 Ga0207708_10038921 3300026075 Bacteria 3623
127 Ga0207641_10105079 3300026088 Bacteria 2494
128 Ga0207641_10229015 3300026088 Bacteria 1726
129 Ga0207641_11144608 3300026088 Bacteria 777
130 Ga0207648_10034437 3300026089 Bacteria 4464
131 Ga0207648_10174489 3300026089 Bacteria 1901
132 Ga0207648_11180206 3300026089 Bacteria 719
133 Ga0207676_10056928 3300026095 Bacteria 3077
134 Ga0207676_10264915 3300026095 Bacteria 1553
135 Ga0207676_11431333 3300026095 Bacteria 687
136 Ga0207674_10003809 3300026116 Bacteria 18392
137 Ga0207675_100060826 3300026118 Bacteria 3526
138 Ga0207675_100125943 3300026118 Bacteria 2426
139 Ga0207675_100705991 3300026118 Bacteria 1018
140 Ga0207675_100940446 3300026118 Bacteria 881
141 Ga0207683_10043532 3300026121 Bacteria 3924
142 Ga0209371_1073605 3300027312 Bacteria 602
143 Ga0209974_10283348 3300027876 Bacteria 630
144 Ga0268266_11050506 3300028379 Bacteria 788
145 Ga0268265_10003039 3300028380 Bacteria 12231
146 Ga0268264_10002938 3300028381 Bacteria 14800
147 Ga0268264_10145395 3300028381 Bacteria 2119
148 Ga0268256_1081949 3300030500 Bacteria 602
149 Ga0307508_10150461 3300031616 Bacteria 1932
150 Ga0307508_10278868 3300031616 Bacteria 1265
151 Ga0307405_10335659 3300031731 Bacteria 1160
152 Ga0307413_11077441 3300031824 Bacteria 693
153 Ga0307406_11580726 3300031901 Bacteria 579
154 Ga0307407_11008031 3300031903 Bacteria 644
155 Ga0307412_10400029 3300031911 Bacteria 1118
156 Ga0307409_102308921 3300031995 Bacteria 567
157 Ga0307411_10653110 3300032005 Bacteria 911
158 Ga0373945_0147653 3300035116 Bacteria 951
159 Ga0373954_0080365 3300035118 Bacteria 1557
160 Ga0373960_0086294 3300035121 Bacteria 997
161 Ga0373943_0002848 3300035170 Bacteria 7859
162 Ga0373943_0340763 3300035170 Bacteria 858
163 Ga0373946_0343104 3300035171 Bacteria 745
164 Ga0373955_0016124 3300035172 Bacteria 3673
165 Ga0373924_0118210 3300035410 Bacteria 1149
166 Ga0373935_0000046 3300035692 Bacteria 48734
167 Ga0373927_0000209 3300035695 Bacteria 46820
168 Ga0373947_0000571 3300035725 Bacteria 21526
169 Ga0373937_0002640 3300036401 Bacteria 14941
170 Ga0373937_0069661 3300036401 Bacteria 3243
171 Ga0373937_1052794 3300036401 Bacteria 762
172 Ga0373925_0000882 3300037068 Bacteria 27403
173 Ga0373925_0312554 3300037068 Bacteria 1270
174 Ga0395905_1024121 3300037471 Bacteria 729
175 Ga0436364_0638111 3300037853 Bacteria 663
176 Ga0242420_043439 3300038996 Bacteria 864
177 Ga0436365_0259964 3300039437 Bacteria 998
178 Ga0436360_1336034 3300039438 Bacteria 625
179 Ga0436361_1149125 3300039447 Bacteria 4109
180 Ga0436363_0445502 3300039450 Bacteria 5594
181 Ga0451853_0578048 3300041512 Bacteria 643
182 Ga0439441_047646 3300042001 Bacteria 875
183 Ga0450923_050384 3300042125 Bacteria 893
184 Ga0466965_0195112 3300044683 Bacteria 1072
185 Ga0466968_0047609 3300044735 Bacteria 1824
186 Ga0451576_1061131 3300045051 Bacteria 848
187 Ga0466967_0465254 3300045976 Bacteria 1237
188 Ga0495592_0050398 3300046454 Bacteria 3093
189 Ga0495592_0131829 3300046454 Bacteria 1747
190 Ga0495603_0000259 3300046455 Bacteria 27881
191 Ga0495629_0002432 3300046459 Bacteria 14294
192 Ga0495641_0002618 3300046461 Bacteria 14079
193 Ga0495651_0383222 3300046462 Unclassified 922
194 Ga0495580_0003494 3300046472 Bacteria 13369
195 Ga0495582_0002146 3300046473 Bacteria 11027
196 Ga0495639_0000244 3300046475 Bacteria 26932
197 Ga0495662_0001127 3300046476 Bacteria 13162
198 Ga0495664_0003791 3300046477 Bacteria 8246
199 Ga0495664_0225614 3300046477 Bacteria 1134
200 Ga0495594_0011483 3300046499 Bacteria 4604
201 Ga0495608_0036809 3300046511 Bacteria 3292
202 Ga0495608_0173847 3300046511 Bacteria 1365
203 Ga0495618_0085592 3300046514 Bacteria 2015
204 Ga0495628_0095731 3300046516 Bacteria 2294
205 Ga0495628_0413284 3300046516 Bacteria 984
206 Ga0495630_0075438 3300046517 Eukaryota 2541
207 Ga0495630_0087822 3300046517 Bacteria 2348
208 Ga0495643_0277457 3300046522 Bacteria 772
209 Ga0495652_0038385 3300046529 Bacteria 4150
210 Ga0495652_0414730 3300046529 Bacteria 950
211 Ga0495665_0000311 3300046531 Bacteria 24696
212 Ga0495640_0002913 3300046533 Eukaryota 13770
213 Ga0495640_0012008 3300046533 Bacteria 6638
214 Ga0495586_0194407 3300046535 Bacteria 1149
215 Ga0495587_0025244 3300046536 Bacteria 3632
216 Ga0495598_0092480 3300046537 Bacteria 989
217 Ga0495645_0026803 3300046543 Bacteria 4185
218 Ga0495645_0651830 3300046543 Bacteria 643
219 Ga0495622_0159015 3300046557 Bacteria 1019
220 Ga0495667_0020613 3300046559 Bacteria 4447
221 Ga0495667_0066478 3300046559 Bacteria 2357
222 Ga0495634_0002680 3300046642 Bacteria 14632
223 Ga0495635_0002191 3300046663 Bacteria 13290
224 Ga0495635_0213337 3300046663 Bacteria 1307
225 Ga0495661_0155089 3300046665 Bacteria 1234
226 Ga0495588_0028347 3300046674 Bacteria 2802
227 Ga0495657_0017374 3300046675 Bacteria 5225
228 Ga0495657_0117447 3300046675 Bacteria 1679
229 Ga0495599_0014046 3300046678 Bacteria 4958
230 Ga0495623_0023984 3300046679 Bacteria 3936
231 Ga0495646_0623348 3300046680 Bacteria 547
232 Ga0495647_0010968 3300046681 Bacteria 3097
233 Ga0495658_0003798 3300046683 Bacteria 7479
234 Ga0495613_0000118 3300046689 Eukaryota 78516
235 Ga0495613_0071511 3300046689 Bacteria 2528
236 Ga0495613_0423541 3300046689 Bacteria 905
237 Ga0495624_0000622 3300046690 Bacteria 27706
238 Ga0495600_0168134 3300046809 Bacteria 1416
239 Ga0495581_0000264 3300047315 Bacteria 25244
240 Ga0495604_0080631 3300047317 Bacteria 2438
241 Ga0495604_0083912 3300047317 Bacteria 2380
242 Ga0495674_0001665 3300047319 Bacteria 21844
243 Ga0495676_0041621 3300047321 Bacteria 3779
244 Ga0495680_0047012 3300047322 Bacteria 3399
245 Ga0495675_0061692 3300047444 Bacteria 2375
246 Ga0495593_0000007 3300047673 Bacteria 87657
247 Ga0495602_0046795 3300048088 Bacteria 3904
248 Ga0495614_0024797 3300048089 Bacteria 2589
249 Ga0496102_0004807 3300048905 Bacteria 11421
250 Ga0496103_0088584 3300048906 Bacteria 1952
251 Ga0496103_0660786 3300048906 Bacteria 664
252 Ga0496104_0172183 3300048907 Bacteria 2076
253 Ga0496105_1238527 3300048908 Bacteria 548
254 Ga0496106_0004354 3300048909 Bacteria 10516
255 Ga0496107_0004028 3300048910 Bacteria 9898
256 Ga0496108_0260612 3300048911 Bacteria 1509
257 Ga0496109_0430778 3300048912 Bacteria 1246
258 Ga0496109_0460302 3300048912 Bacteria 1201
259 Ga0496109_1957194 3300048912 Bacteria 518
260 Ga0496115_0524762 3300048918 Bacteria 949
261 Ga0501031_0306886 3300049568 Bacteria 1028
262 Ga0501034_0132783 3300049571 Bacteria 2472
263 Ga0501034_0500829 3300049571 Bacteria 1128
264 Ga0501042_0695429 3300049578 Bacteria 739
265 Ga0501043_0709688 3300049579 Bacteria 734
266 Ga0501046_0045326 3300049580 Bacteria 3495
267 Ga0501047_0224824 3300049581 Bacteria 1732
268 Ga0501047_1238321 3300049581 Bacteria 560
269 Ga0501048_0786100 3300049582 Bacteria 684
270 Ga0501048_1025965 3300049582 Bacteria 593
271 Ga0501067_0125286 3300049583 Bacteria 1430
272 Ga0501069_0078096 3300049585 Bacteria 1861
273 Ga0501071_0410875 3300049587 Bacteria 1034
274 Ga0501074_0146298 3300049590 Bacteria 1690
275 Ga0501075_0769307 3300049591 Bacteria 733
276 Ga0501075_1188402 3300049591 Bacteria 579
277 Ga0501075_1252238 3300049591 Bacteria 562
278 Ga0501076_0668517 3300049592 Bacteria 857
279 Ga0501079_1330240 3300049741 Bacteria 566
280 nmdc:mga05p37_208042_c1 3300050507 Bacteria 1700
281 nmdc:mga05p37_289778_c1 3300050507 Bacteria 1949
282 nmdc:mga05p37_369690_c1 3300050507 Bacteria 1683
283 nmdc:mga09592_854933_c1 3300050508 Bacteria 767
284 nmdc:mga0qj67_24178_c1 3300050509 Bacteria 4681
285 nmdc:mga06r32_3394_c1 3300050510 Bacteria 14241
286 nmdc:mga0rr50_1424217_c1 3300050513 Bacteria 586
287 nmdc:mga08x19_14137_c1 3300050514 Bacteria 4837
288 Ga0495601_0010504 3300053077 Bacteria 5513
289 Ga0495619_0017269 3300053085 Bacteria 4570
290 Ga0500641_0140455 3300053096 Bacteria 1043
291 Ga0500595_009523 3300053119 Bacteria 3917
292 Ga0501084_0078494 3300054114 Bacteria 2767
293 Ga0501082_0348497 3300060353 Bacteria 1291
294 Ga0501082_0732520 3300060353 Bacteria 865
295 Ga0501082_1020127 3300060353 Bacteria 723
296 Ga0530510_0667166 3300061734 Bacteria 792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100395315 Ga0070673_1003953153 94
2 3300007076 Ga0075435_100984939 Ga0075435_1009849392 109
3 3300026118 Ga0207675_100940446 Ga0207675_1009404462 109
4 3300031824 Ga0307413_11077441 Ga0307413_110774412 109
5 3300031901 Ga0307406_11580726 Ga0307406_115807262 109
6 3300031903 Ga0307407_11008031 Ga0307407_110080312 109
7 3300031995 Ga0307409_102308921 Ga0307409_1023089211 109
8 3300005981 Ga0081538_10147177 Ga0081538_101471772 110
9 3300041512 Ga0451853_0578048 Ga0451853_0578048_102_485 110
10 3300042001 Ga0439441_047646 Ga0439441_047646_161_514 110
11 3300009551 Ga0105238_11912706 Ga0105238_119127061 111
12 3300037471 Ga0395905_1024121 Ga0395905_1024121_268_633 111
13 3300053096 Ga0500641_0140455 Ga0500641_0140455_141_506 111
14 iso_pu_bacteria 2513237141 2513888880 111
15 iso_pu_bacteria 2828305725 2828306449 111
16 3300005445 Ga0070708_100996411 Ga0070708_1009964111 112
17 3300026089 Ga0207648_11180206 Ga0207648_111802062 112
18 3300027876 Ga0209974_10283348 Ga0209974_102833482 112
19 3300042125 Ga0450923_050384 Ga0450923_050384_397_768 112
20 3300046537 Ga0495598_0092480 Ga0495598_0092480_383_754 112
21 3300045051 Ga0451576_1061131 Ga0451576_1061131_178_681 113
22 3300049591 Ga0501075_0769307 Ga0501075_0769307_126_494 113
23 3300049592 Ga0501076_0668517 Ga0501076_0668517_286_654 113
24 3300049741 Ga0501079_1330240 Ga0501079_1330240_105_473 113
25 3300061734 Ga0530510_0667166 Ga0530510_0667166_186_554 113
26 3300050513 nmdc:mga0rr50_1424217_c1 nmdc:mga0rr50_1424217_c1_66_428 114
27 3300005841 Ga0068863_101447320 Ga0068863_1014473202 115
28 3300006914 Ga0075436_100017731 Ga0075436_1000177312 115
29 3300009147 Ga0114129_10401557 Ga0114129_104015573 115
30 3300021361 Ga0213872_10016238 Ga0213872_100162384 115
31 3300021377 Ga0213874_10031399 Ga0213874_100313991 115
32 3300021388 Ga0213875_10628176 Ga0213875_106281761 115
33 3300026088 Ga0207641_11144608 Ga0207641_111446082 115
34 3300037853 Ga0436364_0638111 Ga0436364_0638111_289_651 115
35 3300039437 Ga0436365_0259964 Ga0436365_0259964_110_493 115
36 3300039447 Ga0436361_1149125 Ga0436361_1149125_1075_1458 115
37 3300039450 Ga0436363_0445502 Ga0436363_0445502_2786_3169 115
38 3300044735 Ga0466968_0047609 Ga0466968_0047609_1320_1700 115
39 3300045976 Ga0466967_0465254 Ga0466967_0465254_450_839 115
40 3300050507 nmdc:mga05p37_208042_c1 nmdc:mga05p37_208042_c1_1221_1583 115
41 3300050514 nmdc:mga08x19_14137_c1 nmdc:mga08x19_14137_c1_4314_4679 115
42 3300005331 Ga0070670_100636574 Ga0070670_1006365741 116
43 3300005356 Ga0070674_100194250 Ga0070674_1001942502 116
44 3300005455 Ga0070663_100519877 Ga0070663_1005198771 116
45 3300005471 Ga0070698_100307609 Ga0070698_1003076091 116
46 3300005549 Ga0070704_100203673 Ga0070704_1002036731 116
47 3300006038 Ga0075365_10161438 Ga0075365_101614381 116
48 3300025893 Ga0207682_10121082 Ga0207682_101210822 116
49 3300025911 Ga0207654_10561145 Ga0207654_105611452 116
50 3300025937 Ga0207669_10122812 Ga0207669_101228124 116
51 3300026067 Ga0207678_10436127 Ga0207678_104361272 116
52 3300031616 Ga0307508_10150461 Ga0307508_101504612 116
53 3300031616 Ga0307508_10278868 Ga0307508_102788682 116
54 3300031731 Ga0307405_10335659 Ga0307405_103356592 116
55 3300031911 Ga0307412_10400029 Ga0307412_104000292 116
56 3300035116 Ga0373945_0147653 Ga0373945_0147653_336_722 116
57 3300035118 Ga0373954_0080365 Ga0373954_0080365_247_633 116
58 3300035170 Ga0373943_0002848 Ga0373943_0002848_6870_7256 116
59 3300035170 Ga0373943_0340763 Ga0373943_0340763_302_733 116
60 3300035171 Ga0373946_0343104 Ga0373946_0343104_199_585 116
61 3300035172 Ga0373955_0016124 Ga0373955_0016124_231_617 116
62 3300035410 Ga0373924_0118210 Ga0373924_0118210_534_920 116
63 3300035692 Ga0373935_0000046 Ga0373935_0000046_46916_47302 116
64 3300035695 Ga0373927_0000209 Ga0373927_0000209_34764_35150 116
65 3300035725 Ga0373947_0000571 Ga0373947_0000571_6776_7162 116
66 3300036401 Ga0373937_0002640 Ga0373937_0002640_4903_5289 116
67 3300037068 Ga0373925_0000882 Ga0373925_0000882_21306_21692 116
68 3300046454 Ga0495592_0050398 Ga0495592_0050398_387_773 116
69 3300046455 Ga0495603_0000259 Ga0495603_0000259_15956_16342 116
70 3300046459 Ga0495629_0002432 Ga0495629_0002432_10334_10720 116
71 3300046461 Ga0495641_0002618 Ga0495641_0002618_4123_4509 116
72 3300046462 Ga0495651_0383222 Ga0495651_0383222_229_618 116
73 3300046472 Ga0495580_0003494 Ga0495580_0003494_9014_9400 116
74 3300046473 Ga0495582_0002146 Ga0495582_0002146_3187_3573 116
75 3300046475 Ga0495639_0000244 Ga0495639_0000244_22469_22855 116
76 3300046476 Ga0495662_0001127 Ga0495662_0001127_9488_9874 116
77 3300046477 Ga0495664_0003791 Ga0495664_0003791_5092_5478 116
78 3300046499 Ga0495594_0011483 Ga0495594_0011483_3895_4281 116
79 3300046511 Ga0495608_0173847 Ga0495608_0173847_651_1037 116
80 3300046514 Ga0495618_0085592 Ga0495618_0085592_56_442 116
81 3300046516 Ga0495628_0095731 Ga0495628_0095731_63_449 116
82 3300046517 Ga0495630_0075438 Ga0495630_0075438_1905_2294 116
83 3300046517 Ga0495630_0087822 Ga0495630_0087822_1659_2045 116
84 3300046529 Ga0495652_0038385 Ga0495652_0038385_2948_3334 116
85 3300046531 Ga0495665_0000311 Ga0495665_0000311_2312_2698 116
86 3300046533 Ga0495640_0002913 Ga0495640_0002913_9653_10042 116
87 3300046533 Ga0495640_0012008 Ga0495640_0012008_5081_5467 116
88 3300046535 Ga0495586_0194407 Ga0495586_0194407_543_929 116
89 3300046543 Ga0495645_0651830 Ga0495645_0651830_109_495 116
90 3300046557 Ga0495622_0159015 Ga0495622_0159015_122_508 116
91 3300046559 Ga0495667_0020613 Ga0495667_0020613_1764_2150 116
92 3300046642 Ga0495634_0002680 Ga0495634_0002680_10301_10687 116
93 3300046663 Ga0495635_0002191 Ga0495635_0002191_1571_1957 116
94 3300046665 Ga0495661_0155089 Ga0495661_0155089_821_1207 116
95 3300046674 Ga0495588_0028347 Ga0495588_0028347_129_515 116
96 3300046675 Ga0495657_0117447 Ga0495657_0117447_191_577 116
97 3300046681 Ga0495647_0010968 Ga0495647_0010968_966_1352 116
98 3300046683 Ga0495658_0003798 Ga0495658_0003798_2689_3075 116
99 3300046689 Ga0495613_0000118 Ga0495613_0000118_16598_16987 116
100 3300046689 Ga0495613_0071511 Ga0495613_0071511_1477_1863 116
101 3300046689 Ga0495613_0423541 Ga0495613_0423541_410_802 116
102 3300046690 Ga0495624_0000622 Ga0495624_0000622_10957_11343 116
103 3300046809 Ga0495600_0168134 Ga0495600_0168134_550_936 116
104 3300047315 Ga0495581_0000264 Ga0495581_0000264_1236_1622 116
105 3300047317 Ga0495604_0080631 Ga0495604_0080631_882_1268 116
106 3300047319 Ga0495674_0001665 Ga0495674_0001665_10418_10804 116
107 3300047321 Ga0495676_0041621 Ga0495676_0041621_1709_2095 116
108 3300047322 Ga0495680_0047012 Ga0495680_0047012_2248_2634 116
109 3300047673 Ga0495593_0000007 Ga0495593_0000007_75598_75984 116
110 3300048089 Ga0495614_0024797 Ga0495614_0024797_57_443 116
111 3300048907 Ga0496104_0172183 Ga0496104_0172183_1582_1977 116
112 3300048912 Ga0496109_0460302 Ga0496109_0460302_239_634 116
113 3300048912 Ga0496109_1957194 Ga0496109_1957194_12_398 116
114 3300049571 Ga0501034_0500829 Ga0501034_0500829_645_1031 116
115 3300049581 Ga0501047_0224824 Ga0501047_0224824_529_915 116
116 3300053119 Ga0500595_009523 Ga0500595_009523_3094_3480 116
117 3300005330 Ga0070690_100335897 Ga0070690_1003358972 117
118 3300005334 Ga0068869_100041656 Ga0068869_1000416565 117
119 3300005334 Ga0068869_100551857 Ga0068869_1005518572 117
120 3300005335 Ga0070666_11363915 Ga0070666_113639151 117
121 3300005336 Ga0070680_100005298 Ga0070680_1000052982 117
122 3300005338 Ga0068868_100275704 Ga0068868_1002757042 117
123 3300005340 Ga0070689_100135765 Ga0070689_1001357653 117
124 3300005341 Ga0070691_10089487 Ga0070691_100894872 117
125 3300005354 Ga0070675_100070841 Ga0070675_1000708412 117
126 3300005364 Ga0070673_100612470 Ga0070673_1006124702 117
127 3300005406 Ga0070703_10006177 Ga0070703_100061772 117
128 3300005438 Ga0070701_10330236 Ga0070701_103302362 117
129 3300005440 Ga0070705_100000171 Ga0070705_10000017135 117
130 3300005440 Ga0070705_100834692 Ga0070705_1008346922 117
131 3300005441 Ga0070700_100039219 Ga0070700_1000392192 117
132 3300005444 Ga0070694_100001844 Ga0070694_1000018447 117
133 3300005444 Ga0070694_100210375 Ga0070694_1002103751 117
134 3300005445 Ga0070708_100038930 Ga0070708_1000389302 117
135 3300005455 Ga0070663_100010498 Ga0070663_1000104982 117
136 3300005458 Ga0070681_10020366 Ga0070681_100203666 117
137 3300005459 Ga0068867_100115166 Ga0068867_1001151664 117
138 3300005471 Ga0070698_100123177 Ga0070698_1001231772 117
139 3300005518 Ga0070699_100000167 Ga0070699_1000001673 117
140 3300005536 Ga0070697_100007449 Ga0070697_1000074493 117
141 3300005545 Ga0070695_100002688 Ga0070695_1000026883 117
142 3300005546 Ga0070696_100000417 Ga0070696_10000041720 117
143 3300005547 Ga0070693_100035904 Ga0070693_1000359042 117
144 3300005548 Ga0070665_100287186 Ga0070665_1002871861 117
145 3300005549 Ga0070704_100010186 Ga0070704_1000101862 117
146 3300005549 Ga0070704_100278058 Ga0070704_1002780582 117
147 3300005577 Ga0068857_100134392 Ga0068857_1001343922 117
148 3300005615 Ga0070702_100383528 Ga0070702_1003835282 117
149 3300005617 Ga0068859_100028533 Ga0068859_1000285334 117
150 3300005617 Ga0068859_100816938 Ga0068859_1008169382 117
151 3300005618 Ga0068864_100291062 Ga0068864_1002910621 117
152 3300005618 Ga0068864_101213873 Ga0068864_1012138732 117
153 3300005719 Ga0068861_100090570 Ga0068861_1000905702 117
154 3300005719 Ga0068861_100225832 Ga0068861_1002258322 117
155 3300005719 Ga0068861_100638954 Ga0068861_1006389542 117
156 3300005840 Ga0068870_10663221 Ga0068870_106632212 117
157 3300005841 Ga0068863_100104171 Ga0068863_1001041713 117
158 3300005842 Ga0068858_100038228 Ga0068858_1000382286 117
159 3300005842 Ga0068858_101460241 Ga0068858_1014602412 117
160 3300005843 Ga0068860_100018242 Ga0068860_1000182422 117
161 3300005844 Ga0068862_100015426 Ga0068862_1000154267 117
162 3300006237 Ga0097621_100056077 Ga0097621_1000560773 117
163 3300006237 Ga0097621_100080936 Ga0097621_1000809365 117
164 3300006237 Ga0097621_100191909 Ga0097621_1001919091 117
165 3300006358 Ga0068871_100020067 Ga0068871_1000200677 117
166 3300006358 Ga0068871_100031142 Ga0068871_1000311422 117
167 3300006358 Ga0068871_100046091 Ga0068871_1000460912 117
168 3300006846 Ga0075430_100007945 Ga0075430_1000079451 117
169 3300006847 Ga0075431_100001530 Ga0075431_1000015302 117
170 3300006931 Ga0097620_100028534 Ga0097620_1000285347 117
171 3300006931 Ga0097620_100817130 Ga0097620_1008171302 117
172 3300009092 Ga0105250_10124974 Ga0105250_101249742 117
173 3300009098 Ga0105245_10282574 Ga0105245_102825742 117
174 3300009101 Ga0105247_10040484 Ga0105247_100404842 117
175 3300009147 Ga0114129_10113060 Ga0114129_101130602 117
176 3300009147 Ga0114129_10374794 Ga0114129_103747942 117
177 3300009174 Ga0105241_10342042 Ga0105241_103420421 117
178 3300009176 Ga0105242_11097493 Ga0105242_110974932 117
179 3300009177 Ga0105248_10014635 Ga0105248_100146356 117
180 3300009551 Ga0105238_10008604 Ga0105238_100086048 117
181 3300009553 Ga0105249_10004920 Ga0105249_100049206 117
182 3300009553 Ga0105249_10951599 Ga0105249_109515992 117
183 3300010375 Ga0105239_11798436 Ga0105239_117984361 117
184 3300011119 Ga0105246_10363081 Ga0105246_103630811 117
185 3300011119 Ga0105246_10485710 Ga0105246_104857102 117
186 3300013296 Ga0157374_10993546 Ga0157374_109935462 117
187 3300013297 Ga0157378_10000378 Ga0157378_1000037841 117
188 3300013297 Ga0157378_10908186 Ga0157378_109081862 117
189 3300013306 Ga0163162_10022972 Ga0163162_100229724 117
190 3300013308 Ga0157375_10051111 Ga0157375_100511115 117
191 3300014326 Ga0157380_12047459 Ga0157380_120474591 117
192 3300014968 Ga0157379_10171487 Ga0157379_101714871 117
193 3300014969 Ga0157376_10100405 Ga0157376_101004054 117
194 3300025900 Ga0207710_10147866 Ga0207710_101478661 117
195 3300025908 Ga0207643_10485428 Ga0207643_104854282 117
196 3300025912 Ga0207707_10023867 Ga0207707_100238673 117
197 3300025914 Ga0207671_11463037 Ga0207671_114630371 117
198 3300025917 Ga0207660_10081559 Ga0207660_100815592 117
199 3300025918 Ga0207662_11168404 Ga0207662_111684041 117
200 3300025924 Ga0207694_10846092 Ga0207694_108460922 117
201 3300025927 Ga0207687_10126861 Ga0207687_101268613 117
202 3300025934 Ga0207686_10702378 Ga0207686_107023781 117
203 3300025936 Ga0207670_10432056 Ga0207670_104320562 117
204 3300025937 Ga0207669_11505160 Ga0207669_115051601 117
205 3300025938 Ga0207704_10699331 Ga0207704_106993312 117
206 3300025941 Ga0207711_10005309 Ga0207711_100053094 117
207 3300025942 Ga0207689_10028715 Ga0207689_100287156 117
208 3300025942 Ga0207689_10549573 Ga0207689_105495732 117
209 3300025960 Ga0207651_10316650 Ga0207651_103166502 117
210 3300025961 Ga0207712_10005088 Ga0207712_100050882 117
211 3300026023 Ga0207677_10244897 Ga0207677_102448973 117
212 3300026035 Ga0207703_10047940 Ga0207703_100479402 117
213 3300026067 Ga0207678_10023515 Ga0207678_100235156 117
214 3300026075 Ga0207708_10038921 Ga0207708_100389213 117
215 3300026088 Ga0207641_10105079 Ga0207641_101050793 117
216 3300026088 Ga0207641_10229015 Ga0207641_102290153 117
217 3300026089 Ga0207648_10034437 Ga0207648_100344376 117
218 3300026089 Ga0207648_10174489 Ga0207648_101744892 117
219 3300026095 Ga0207676_10056928 Ga0207676_100569284 117
220 3300026095 Ga0207676_10264915 Ga0207676_102649152 117
221 3300026095 Ga0207676_11431333 Ga0207676_114313332 117
222 3300026116 Ga0207674_10003809 Ga0207674_100038097 117
223 3300026118 Ga0207675_100060826 Ga0207675_1000608262 117
224 3300026118 Ga0207675_100125943 Ga0207675_1001259433 117
225 3300026118 Ga0207675_100705991 Ga0207675_1007059912 117
226 3300026121 Ga0207683_10043532 Ga0207683_100435325 117
227 3300028379 Ga0268266_11050506 Ga0268266_110505061 117
228 3300028380 Ga0268265_10003039 Ga0268265_100030397 117
229 3300028381 Ga0268264_10002938 Ga0268264_100029386 117
230 3300028381 Ga0268264_10145395 Ga0268264_101453952 117
231 3300032005 Ga0307411_10653110 Ga0307411_106531101 117
232 3300035121 Ga0373960_0086294 Ga0373960_0086294_556_921 117
233 3300036401 Ga0373937_0069661 Ga0373937_0069661_935_1309 117
234 3300036401 Ga0373937_1052794 Ga0373937_1052794_59_424 117
235 3300037068 Ga0373925_0312554 Ga0373925_0312554_677_1042 117
236 3300038996 Ga0242420_043439 Ga0242420_043439_344_742 117
237 3300039438 Ga0436360_1336034 Ga0436360_1336034_74_460 117
238 3300044683 Ga0466965_0195112 Ga0466965_0195112_294_674 117
239 3300046454 Ga0495592_0131829 Ga0495592_0131829_848_1222 117
240 3300046477 Ga0495664_0225614 Ga0495664_0225614_747_1121 117
241 3300046511 Ga0495608_0036809 Ga0495608_0036809_556_930 117
242 3300046516 Ga0495628_0413284 Ga0495628_0413284_223_597 117
243 3300046529 Ga0495652_0414730 Ga0495652_0414730_135_509 117
244 3300046536 Ga0495587_0025244 Ga0495587_0025244_2703_3077 117
245 3300046543 Ga0495645_0026803 Ga0495645_0026803_149_523 117
246 3300046559 Ga0495667_0066478 Ga0495667_0066478_1482_1856 117
247 3300046663 Ga0495635_0213337 Ga0495635_0213337_682_1056 117
248 3300046675 Ga0495657_0017374 Ga0495657_0017374_1578_1952 117
249 3300046678 Ga0495599_0014046 Ga0495599_0014046_2550_2924 117
250 3300046679 Ga0495623_0023984 Ga0495623_0023984_3395_3769 117
251 3300046680 Ga0495646_0623348 Ga0495646_0623348_116_490 117
252 3300047317 Ga0495604_0083912 Ga0495604_0083912_277_651 117
253 3300047444 Ga0495675_0061692 Ga0495675_0061692_1816_2190 117
254 3300048088 Ga0495602_0046795 Ga0495602_0046795_3078_3452 117
255 3300048905 Ga0496102_0004807 Ga0496102_0004807_10968_11366 117
256 3300048906 Ga0496103_0088584 Ga0496103_0088584_45_443 117
257 3300048908 Ga0496105_1238527 Ga0496105_1238527_132_497 117
258 3300048909 Ga0496106_0004354 Ga0496106_0004354_1610_2008 117
259 3300048910 Ga0496107_0004028 Ga0496107_0004028_6033_6431 117
260 3300048911 Ga0496108_0260612 Ga0496108_0260612_42_440 117
261 3300048912 Ga0496109_0430778 Ga0496109_0430778_489_887 117
262 3300048918 Ga0496115_0524762 Ga0496115_0524762_423_821 117
263 3300049568 Ga0501031_0306886 Ga0501031_0306886_472_861 117
264 3300049571 Ga0501034_0132783 Ga0501034_0132783_183_575 117
265 3300049578 Ga0501042_0695429 Ga0501042_0695429_29_427 117
266 3300049579 Ga0501043_0709688 Ga0501043_0709688_184_582 117
267 3300049580 Ga0501046_0045326 Ga0501046_0045326_1241_1639 117
268 3300049581 Ga0501047_1238321 Ga0501047_1238321_37_435 117
269 3300049582 Ga0501048_0786100 Ga0501048_0786100_83_481 117
270 3300049582 Ga0501048_1025965 Ga0501048_1025965_182_574 117
271 3300049583 Ga0501067_0125286 Ga0501067_0125286_177_575 117
272 3300049585 Ga0501069_0078096 Ga0501069_0078096_423_812 117
273 3300049587 Ga0501071_0410875 Ga0501071_0410875_533_931 117
274 3300049590 Ga0501074_0146298 Ga0501074_0146298_1071_1469 117
275 3300049591 Ga0501075_1188402 Ga0501075_1188402_110_505 117
276 3300049591 Ga0501075_1252238 Ga0501075_1252238_81_479 117
277 3300050507 nmdc:mga05p37_289778_c1 nmdc:mga05p37_289778_c1_1259_1660 117
278 3300050507 nmdc:mga05p37_369690_c1 nmdc:mga05p37_369690_c1_169_567 117
279 3300050508 nmdc:mga09592_854933_c1 nmdc:mga09592_854933_c1_143_544 117
280 3300050509 nmdc:mga0qj67_24178_c1 nmdc:mga0qj67_24178_c1_217_618 117
281 3300050510 nmdc:mga06r32_3394_c1 nmdc:mga06r32_3394_c1_4880_5281 117
282 3300053077 Ga0495601_0010504 Ga0495601_0010504_1957_2331 117
283 3300053085 Ga0495619_0017269 Ga0495619_0017269_1805_2179 117
284 3300054114 Ga0501084_0078494 Ga0501084_0078494_2287_2685 117
285 3300060353 Ga0501082_0348497 Ga0501082_0348497_800_1192 117
286 3300060353 Ga0501082_0732520 Ga0501082_0732520_142_543 117
287 3300060353 Ga0501082_1020127 Ga0501082_1020127_173_571 117
288 3300025292 Ga0209676_1001997 Ga0209676_10019975 119
289 3300027312 Ga0209371_1073605 Ga0209371_10736051 119
290 3300030500 Ga0268256_1081949 Ga0268256_10819491 119
291 iso_pu_bacteria 3000135777 3000138474 120
292 iso_pu_bacteria 2856349417 2856355103 121
293 iso_pu_bacteria 2871495908 2871500731 121
294 iso_pu_bacteria 2874123672 2874125982 121
295 iso_pu_bacteria 2878760144 2878764820 121
296 iso_pu_bacteria 2878767105 2878771921 121
297 iso_pu_bacteria 2881155292 2881156342 121
298 iso_pu_bacteria 2881853255 2881857150 121
299 iso_pu_bacteria 2885342637 2885349821 121
300 iso_pu_bacteria 2885350715 2885356216 121
301 iso_pu_bacteria 2937822353 2937827284 121
302 iso_pu_bacteria 2937994558 2937999394 121
303 iso_pu_bacteria 2958165035 2958169868 121
304 iso_pu_bacteria 2961127735 2961135369 121
305 iso_pu_bacteria 2961163497 2961168328 121
306 iso_pu_bacteria 2965018300 2965023147 121
307 iso_pu_bacteria 2968171901 2968176728 121
308 iso_pu_bacteria 2970554993 2970559667 121
309 iso_pu_bacteria 2987659509 2987664342 121
310 iso_pu_bacteria 3004188549 3004193397 121
311 iso_pu_bacteria 2903540706 2903545544 122
312 3300002741 JGI25157J39369_1000136 JGI25157J39369_100013656 125
313 3300009093 Ga0105240_10237128 Ga0105240_102371282 125
314 3300025246 Ga0209646_1027601 Ga0209646_10276012 125
315 3300025250 Ga0209026_1000002 Ga0209026_1000002335 125
316 3300025256 Ga0209759_1000238 Ga0209759_100023821 125
317 3300025913 Ga0207695_10182620 Ga0207695_101826202 125
318 3300046522 Ga0495643_0277457 Ga0495643_0277457_317_694 125
319 3300048906 Ga0496103_0660786 Ga0496103_0660786_252_641 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

126

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9057 1 125
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8919 1 125
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8807 4 121
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8755 3 121
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8677 4 121
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9057 1 125 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8919 1 125 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8772 64 125 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8669 65 124 3.30.720.110
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8614 6 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A258S9W4-F1-model_v4 Uncharacterized protein 1.004 69 123
AF-A2S116-F1-model_v4 Conserved domain protein 1.003 66 125
AF-A0A520H5Z8-F1-model_v4 Glyoxalase 0.9988 67 124
AF-B9KRJ3-F1-model_v4 deleted 0.9986 64 125
AF-A0A7Y3TTJ6-F1-model_v4 Uncharacterized protein 0.9974 66 124

Feature Viewer

pLDDT pTM Quality
90.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map