F404711

General Info

Members Datasets Scaffolds Average Seq Length
318 204 636 156

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0509574|Ga0436360_0509574_1914_2483
Length 189
Sequence VDLTSADGLLDRLALIAYMTGSRGRAEFRPWAFPHRAMKTFSAKPSDIEKKWLVIDADGLVLGRLASIIATRLRGKHKPSFTPHMDCGDNIIVVNAEKVQLTGNKRSDSIFYWHTGYPGGIKGRSKGAILEGKHPERVIQKAVERMIPRGPLGRRVMRNLRVFAGPDHPHEAQQPERLDVAALNRKNRV

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
86 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
87 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
88 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
89 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.74
Metatranscriptomes 12.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 0.63
Rhizosphere 83.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0509574 3300039438 Bacteria 2540
2 SwRhRL2b_contig_336987 2162886007 Bacteria 1113
3 Ga0007429J51699_1006806 3300003579 Bacteria 662
4 Ga0007411J51799_108746 3300003611 Bacteria 629
5 Ga0070683_100391137 3300005329 Bacteria 1325
6 Ga0070683_100783656 3300005329 Bacteria 914
7 Ga0070666_10200049 3300005335 Bacteria 1406
8 Ga0070689_101043251 3300005340 Bacteria 729
9 Ga0070668_101316772 3300005347 Bacteria 657
10 Ga0070675_100675164 3300005354 Bacteria 940
11 Ga0070671_100202735 3300005355 Bacteria 1682
12 Ga0070671_100735645 3300005355 Bacteria 857
13 Ga0070688_100353933 3300005365 Bacteria 1076
14 Ga0070709_10008776 3300005434 Bacteria 5561
15 Ga0070709_10228426 3300005434 Bacteria 1330
16 Ga0070714_100027058 3300005435 Bacteria 4745
17 Ga0070714_100040209 3300005435 Bacteria 3940
18 Ga0070713_100012412 3300005436 Bacteria 6248
19 Ga0070713_100707649 3300005436 Bacteria 962
20 Ga0070710_10012332 3300005437 Bacteria 4241
21 Ga0070711_100035307 3300005439 Bacteria 3341
22 Ga0070711_100077117 3300005439 Bacteria 2364
23 Ga0070708_101143405 3300005445 Bacteria 729
24 Ga0070681_10025507 3300005458 Bacteria 5945
25 Ga0070681_10159809 3300005458 Bacteria 2177
26 Ga0070681_10280254 3300005458 Bacteria 1578
27 Ga0070706_100057820 3300005467 Bacteria 3579
28 Ga0070706_100470992 3300005467 Bacteria 1169
29 Ga0070706_100925538 3300005467 Bacteria 805
30 Ga0070707_100013801 3300005468 Bacteria 7564
31 Ga0070707_100437604 3300005468 Bacteria 1268
32 Ga0070698_100001353 3300005471 Bacteria 27266
33 Ga0070699_100330237 3300005518 Bacteria 1371
34 Ga0070699_100918353 3300005518 Bacteria 802
35 Ga0070679_100035527 3300005530 Bacteria 4944
36 Ga0070679_100377911 3300005530 Bacteria 1363
37 Ga0070679_101002839 3300005530 Bacteria 779
38 Ga0070697_100171221 3300005536 Bacteria 1838
39 Ga0070697_100174848 3300005536 Bacteria 1818
40 Ga0070697_100247802 3300005536 Bacteria 1523
41 Ga0070697_100733354 3300005536 Bacteria 873
42 Ga0068853_100156184 3300005539 Bacteria 2056
43 Ga0070686_100111327 3300005544 Bacteria 1866
44 Ga0068864_101893937 3300005618 Bacteria 602
45 Ga0068858_100782072 3300005842 Bacteria 931
46 Ga0081540_1006892 3300005983 Bacteria 8193
47 Ga0081540_1096382 3300005983 Bacteria 1287
48 Ga0070717_10000398 3300006028 Bacteria 27863
49 Ga0070717_10254356 3300006028 Bacteria 1552
50 Ga0070717_10317407 3300006028 Bacteria 1388
51 Ga0070717_10618479 3300006028 Bacteria 983
52 Ga0070717_10794712 3300006028 Bacteria 861
53 Ga0075368_10054354 3300006042 Bacteria 1595
54 Ga0075363_100019388 3300006048 Bacteria 3401
55 Ga0075364_10073413 3300006051 Bacteria 2255
56 Ga0070715_10803160 3300006163 Bacteria 571
57 Ga0070712_100246352 3300006175 Bacteria 1426
58 Ga0070712_100411632 3300006175 Bacteria 1119
59 Ga0070712_100673103 3300006175 Bacteria 880
60 Ga0075366_10136013 3300006195 Bacteria 1484
61 Ga0075428_101760075 3300006844 Bacteria 646
62 Ga0075433_11268492 3300006852 Bacteria 639
63 Ga0075436_100071781 3300006914 Bacteria 2394
64 Ga0075435_100212769 3300007076 Bacteria 1640
65 Ga0099795_10059076 3300007788 Bacteria 1418
66 Ga0099795_10075842 3300007788 Bacteria 1277
67 Ga0105251_10224602 3300009011 Bacteria 846
68 Ga0111539_10550587 3300009094 Bacteria 1344
69 Ga0105247_11105021 3300009101 Bacteria 626
70 Ga0105242_10839059 3300009176 Bacteria 913
71 Ga0105248_10411129 3300009177 Bacteria 1523
72 Ga0105238_10012210 3300009551 Bacteria 8660
73 Ga0099796_10001288 3300010159 Bacteria 4951
74 Ga0105239_11685102 3300010375 Bacteria 734
75 Ga0105246_10992508 3300011119 Bacteria 760
76 Ga0157370_11793893 3300013104 Bacteria 551
77 Ga0157374_10237605 3300013296 Bacteria 1791
78 Ga0163162_10163396 3300013306 Bacteria 2349
79 Ga0157375_10805190 3300013308 Bacteria 1088
80 Ga0163163_11135432 3300014325 Bacteria 844
81 Ga0157380_10675338 3300014326 Bacteria 1034
82 Ga0182008_10335822 3300014497 Bacteria 798
83 Ga0157379_10127582 3300014968 Bacteria 2289
84 Ga0157379_10438585 3300014968 Bacteria 1204
85 Ga0157376_12602417 3300014969 Bacteria 546
86 Ga0206353_11612535 3300020082 Bacteria 1168
87 Ga0213873_10011069 3300021358 Bacteria 1920
88 Ga0213873_10029647 3300021358 Bacteria 1350
89 Ga0213873_10074271 3300021358 Bacteria 942
90 Ga0213872_10033400 3300021361 Bacteria 2357
91 Ga0213872_10089104 3300021361 Bacteria 1382
92 Ga0213876_10048897 3300021384 Bacteria 2234
93 Ga0213876_10077733 3300021384 Bacteria 1753
94 Ga0213876_10302236 3300021384 Bacteria 851
95 Ga0213875_10000114 3300021388 Bacteria 91363
96 Ga0213875_10049346 3300021388 Bacteria 1973
97 Ga0213875_10176418 3300021388 Bacteria 1003
98 Ga0224712_10309779 3300022467 Bacteria 740
99 Ga0224712_10570906 3300022467 Bacteria 551
100 Ga0228598_1004692 3300024227 Bacteria 2886
101 Ga0207692_10141524 3300025898 Bacteria 1368
102 Ga0207692_10185220 3300025898 Bacteria 1215
103 Ga0207680_10086992 3300025903 Bacteria 1978
104 Ga0207685_10556515 3300025905 Bacteria 610
105 Ga0207699_10196503 3300025906 Bacteria 1364
106 Ga0207699_10329847 3300025906 Bacteria 1072
107 Ga0207684_10344363 3300025910 Bacteria 1284
108 Ga0207684_10671789 3300025910 Bacteria 882
109 Ga0207684_10887229 3300025910 Bacteria 750
110 Ga0207707_10014070 3300025912 Bacteria 6974
111 Ga0207707_10169212 3300025912 Bacteria 1910
112 Ga0207707_10426836 3300025912 Bacteria 1136
113 Ga0207693_10003170 3300025915 Bacteria 14130
114 Ga0207693_10019102 3300025915 Bacteria 5454
115 Ga0207693_10089153 3300025915 Bacteria 2418
116 Ga0207693_10342403 3300025915 Bacteria 1170
117 Ga0207663_10074248 3300025916 Bacteria 2203
118 Ga0207663_10232899 3300025916 Bacteria 1347
119 Ga0207646_10016691 3300025922 Bacteria 6887
120 Ga0207646_10580762 3300025922 Bacteria 1007
121 Ga0207694_10081235 3300025924 Bacteria 2546
122 Ga0207665_10112978 3300025939 Bacteria 1910
123 Ga0207665_10404196 3300025939 Bacteria 1040
124 Ga0207661_10677934 3300025944 Bacteria 948
125 Ga0207703_10674688 3300026035 Bacteria 982
126 Ga0207639_10077574 3300026041 Bacteria 2619
127 Ga0207676_10755249 3300026095 Bacteria 946
128 Ga0207676_11766207 3300026095 Bacteria 617
129 Ga0207683_10941529 3300026121 Bacteria 802
130 Ga0209813_10014031 3300027866 Bacteria 2150
131 Ga0265338_10110245 3300028800 Bacteria 2219
132 Ga0311000_115315 3300029272 Bacteria 1562
133 Ga0311003_106063 3300029282 Bacteria 607
134 Ga0310982_106266 3300029283 Bacteria 862
135 Ga0310981_1059876 3300029285 Bacteria 535
136 Ga0265764_116021 3300030882 Bacteria 518
137 Ga0265325_10040778 3300031241 Bacteria 2437
138 Ga0265327_10006981 3300031251 Bacteria 8858
139 Ga0265316_10048134 3300031344 Bacteria 3369
140 Ga0316576_10310451 3300031727 Bacteria 1178
141 Ga0316578_10701171 3300031728 Bacteria 590
142 Ga0307410_10357900 3300031852 Bacteria 1168
143 Ga0307409_100607057 3300031995 Bacteria 1082
144 Ga0307414_10070240 3300032004 Bacteria 2521
145 Ga0307411_11677212 3300032005 Bacteria 588
146 Ga0316593_10188889 3300032168 Bacteria 759
147 Ga0316592_1076953 3300033524 Bacteria 757
148 Ga0373926_0131995 3300035083 Bacteria 946
149 Ga0373934_0046094 3300035086 Bacteria 1724
150 Ga0373936_0195119 3300035113 Bacteria 892
151 Ga0373953_0172162 3300035117 Bacteria 932
152 Ga0373954_0013044 3300035118 Bacteria 3699
153 Ga0373954_0366298 3300035118 Bacteria 712
154 Ga0373954_0452048 3300035118 Bacteria 636
155 Ga0373956_0029251 3300035119 Bacteria 2402
156 Ga0373956_0102897 3300035119 Bacteria 1326
157 Ga0373957_0185581 3300035120 Bacteria 863
158 Ga0373960_0260547 3300035121 Bacteria 633
159 Ga0373955_0141713 3300035172 Bacteria 1410
160 Ga0373961_0161135 3300035241 Bacteria 771
161 Ga0316574_0207710 3300035398 Bacteria 1257
162 Ga0316574_0561433 3300035398 Bacteria 708
163 Ga0373924_0264292 3300035410 Bacteria 763
164 Ga0373931_0834867 3300035691 Bacteria 616
165 Ga0373935_0187815 3300035692 Bacteria 1422
166 Ga0373935_0552830 3300035692 Bacteria 839
167 Ga0373927_0081979 3300035695 Bacteria 2091
168 Ga0373927_0234391 3300035695 Bacteria 1206
169 Ga0373933_0004882 3300035724 Bacteria 7320
170 Ga0373933_0222009 3300035724 Bacteria 1213
171 Ga0373947_0211598 3300035725 Bacteria 1272
172 Ga0373947_0227757 3300035725 Bacteria 1227
173 Ga0373937_0051990 3300036401 Bacteria 3755
174 Ga0373937_0077733 3300036401 Bacteria 3067
175 Ga0373937_0126971 3300036401 Bacteria 2380
176 Ga0310112_018666 3300036458 Bacteria 977
177 Ga0316584_0473038 3300036712 Bacteria 884
178 Ga0373925_1362621 3300037068 Bacteria 581
179 Ga0395900_0030625 3300037418 Bacteria 5526
180 Ga0395905_0304689 3300037471 Bacteria 1481
181 Ga0436364_0087102 3300037853 Bacteria 984
182 Ga0436364_0169683 3300037853 Bacteria 86149
183 Ga0436364_0394460 3300037853 Bacteria 1337
184 Ga0436364_0655385 3300037853 Bacteria 1128
185 Ga0436364_0740590 3300037853 Bacteria 36420
186 Ga0436364_0839622 3300037853 Bacteria 565
187 Ga0436364_1130006 3300037853 Bacteria 3211
188 Ga0436364_1245271 3300037853 Bacteria 49699
189 Ga0436364_1247082 3300037853 Bacteria 11390
190 Ga0436364_1306809 3300037853 Bacteria 1210
191 Ga0395901_0249870 3300038443 Bacteria 1848
192 Ga0400483_144608 3300039062 Bacteria 3667
193 Ga0400483_164597 3300039062 Bacteria 2620
194 Ga0436365_0030032 3300039437 Bacteria 656
195 Ga0436365_0048129 3300039437 Bacteria 1080
196 Ga0436365_0221767 3300039437 Bacteria 3374
197 Ga0436365_0261811 3300039437 Bacteria 1041
198 Ga0436365_0540582 3300039437 Bacteria 598
199 Ga0436365_0920657 3300039437 Bacteria 1699
200 Ga0436365_0925068 3300039437 Bacteria 1109
201 Ga0436365_1180617 3300039437 Bacteria 2008
202 Ga0436365_1487039 3300039437 Bacteria 2222
203 Ga0436365_1503025 3300039437 Bacteria 850
204 Ga0436360_0483172 3300039438 Bacteria 660
205 Ga0436360_0601941 3300039438 Bacteria 875
206 Ga0436360_0613706 3300039438 Bacteria 1542
207 Ga0436360_1047531 3300039438 Bacteria 769
208 Ga0436360_1316929 3300039438 Bacteria 1154
209 Ga0436361_0073423 3300039447 Bacteria 1991
210 Ga0436361_0191205 3300039447 Bacteria 1040
211 Ga0436361_0786672 3300039447 Bacteria 6087
212 Ga0436361_1170696 3300039447 Bacteria 1219
213 Ga0436361_1171501 3300039447 Bacteria 894
214 Ga0436361_1192808 3300039447 Bacteria 670
215 Ga0436363_0308739 3300039450 Bacteria 704
216 Ga0436363_0740567 3300039450 Bacteria 1626
217 Ga0436363_0815394 3300039450 Bacteria 1291
218 Ga0436363_0981701 3300039450 Bacteria 613
219 Ga0436363_1273992 3300039450 Bacteria 1508
220 Ga0436363_1374455 3300039450 Bacteria 892
221 Ga0436363_1657090 3300039450 Bacteria 811
222 Ga0436362_0008782 3300039453 Bacteria 1522
223 Ga0436362_0232429 3300039453 Bacteria 622
224 Ga0436362_0270574 3300039453 Bacteria 1160
225 Ga0436362_0280744 3300039453 Bacteria 644
226 Ga0436362_0627213 3300039453 Bacteria 1352
227 Ga0436362_0766360 3300039453 Bacteria 2061
228 Ga0436362_0778891 3300039453 Bacteria 948
229 Ga0436362_1140663 3300039453 Bacteria 512
230 Ga0436362_1240410 3300039453 Bacteria 1701
231 Ga0436362_1251867 3300039453 Bacteria 1308
232 Ga0439435_0178546 3300042436 Bacteria 693
233 Ga0466961_0630481 3300044693 Bacteria 644
234 Ga0466963_0275551 3300044694 Bacteria 1182
235 Ga0453684_0004682 3300044712 Bacteria 28347
236 Ga0466959_0512943 3300045049 Bacteria 810
237 Ga0451576_0004280 3300045051 Bacteria 18694
238 Ga0451576_1449904 3300045051 Bacteria 714
239 Ga0466958_0696403 3300045836 Bacteria 662
240 Ga0466967_0141817 3300045976 Bacteria 2239
241 Ga0466967_2010715 3300045976 Bacteria 574
242 Ga0495629_0258122 3300046459 Bacteria 1198
243 Ga0495651_0269841 3300046462 Bacteria 1154
244 Ga0495580_0210188 3300046472 Bacteria 1339
245 Ga0495580_0720582 3300046472 Bacteria 651
246 Ga0495662_0071016 3300046476 Bacteria 1687
247 Ga0495652_0673951 3300046529 Bacteria 698
248 Ga0495640_0375737 3300046533 Bacteria 875
249 Ga0495586_0775387 3300046535 Bacteria 553
250 Ga0495667_0004630 3300046559 Bacteria 9299
251 Ga0495667_0271610 3300046559 Bacteria 1077
252 Ga0495634_0100164 3300046642 Bacteria 1873
253 Ga0495635_0603615 3300046663 Bacteria 716
254 Ga0495599_0209496 3300046678 Bacteria 1195
255 Ga0495613_0460877 3300046689 Bacteria 860
256 Ga0495600_0071028 3300046809 Bacteria 2275
257 Ga0495680_0089930 3300047322 Bacteria 2304
258 Ga0495602_0435759 3300048088 Bacteria 928
259 Ga0496112_0157817 3300048915 Bacteria 2235
260 Ga0496113_0524895 3300048916 Bacteria 950
261 Ga0496121_0419999 3300048924 Bacteria 870
262 Ga0501306_016000 3300049127 Bacteria 1003
263 Ga0501344_11491 3300049133 Bacteria 549
264 Ga0501345_07782 3300049134 Bacteria 520
265 Ga0501304_007669 3300049160 Bacteria 895
266 Ga0501312_026880 3300049528 Bacteria 884
267 Ga0501315_023948 3300049531 Bacteria 841
268 Ga0501315_038107 3300049531 Bacteria 718
269 Ga0501315_067151 3300049531 Bacteria 589
270 Ga0501317_002980 3300049533 Bacteria 1651
271 Ga0501317_006064 3300049533 Bacteria 1316
272 Ga0501317_010678 3300049533 Bacteria 1102
273 Ga0501317_051037 3300049533 Bacteria 657
274 Ga0501318_010943 3300049534 Bacteria 1017
275 Ga0501318_078309 3300049534 Bacteria 532
276 Ga0501321_053877 3300049537 Bacteria 594
277 Ga0501323_027268 3300049539 Bacteria 786
278 Ga0501325_008479 3300049541 Bacteria 893
279 Ga0501325_020878 3300049541 Bacteria 690
280 Ga0501331_13497 3300049547 Bacteria 530
281 Ga0501031_0782420 3300049568 Bacteria 612
282 Ga0501033_0401755 3300049570 Bacteria 956
283 Ga0501034_0000189 3300049571 Bacteria 115780
284 Ga0501036_0708449 3300049572 Bacteria 832
285 Ga0501047_0735490 3300049581 Bacteria 803
286 Ga0501069_0662073 3300049585 Bacteria 629
287 Ga0501070_0044450 3300049586 Bacteria 3696
288 Ga0501073_0223105 3300049589 Bacteria 1302
289 Ga0501075_0360784 3300049591 Bacteria 1108
290 Ga0501077_0486895 3300049593 Bacteria 791
291 Ga0501079_0329919 3300049741 Bacteria 1195
292 Ga0501080_0788742 3300049742 Bacteria 834
293 Ga0501081_0804279 3300049743 Bacteria 708
294 Ga0501083_0010056 3300049744 Bacteria 6671
295 Ga0501035_0539274 3300049822 Bacteria 957
296 nmdc:mga03n38_33489_c2 3300050490 Bacteria 1563
297 nmdc:mga00v17_189170_c1 3300050491 Bacteria 1329
298 nmdc:mga0k408_151850_c1 3300050493 Bacteria 1379
299 nmdc:mga06z11_46762_c1 3300050494 Bacteria 2195
300 nmdc:mga04h51_56926_c1 3300050495 Bacteria 1329
301 nmdc:mga0rr50_924985_c1 3300050513 Bacteria 743
302 nmdc:mga08x19_392929_c1 3300050514 Bacteria 972
303 Ga0495601_0023319 3300053077 Bacteria 3802
304 Ga0495601_0172772 3300053077 Bacteria 1413
305 Ga0495595_0096883 3300053084 Bacteria 1420
306 Ga0495619_0007478 3300053085 Bacteria 6919
307 Ga0495619_0421107 3300053085 Bacteria 921
308 Ga0500643_019834 3300053087 Bacteria 2208
309 Ga0500556_0075752 3300053104 Bacteria 1264
310 Ga0501084_0892948 3300054114 Bacteria 747
311 Ga0587077_183595 3300059493 Bacteria 568
312 Ga0587090_005959 3300059510 Bacteria 1550
313 Ga0587101_003653 3300059623 Bacteria 1583
314 Ga0587117_098873 3300059627 Bacteria 554
315 Ga0587062_024426 3300059639 Bacteria 883
316 Ga0587068_046295 3300059641 Bacteria 802
317 Ga0587111_0010135 3300060346 Bacteria 1611
318 Ga0501082_0158831 3300060353 Bacteria 1964
319 Ga0436360_0509574
320 SwRhRL2b_contig_336987
321 Ga0007429J51699_1006806
322 Ga0007411J51799_108746
323 Ga0070683_100391137
324 Ga0070683_100783656
325 Ga0070666_10200049
326 Ga0070689_101043251
327 Ga0070668_101316772
328 Ga0070675_100675164
329 Ga0070671_100202735
330 Ga0070671_100735645
331 Ga0070688_100353933
332 Ga0070709_10008776
333 Ga0070709_10228426
334 Ga0070714_100027058
335 Ga0070714_100040209
336 Ga0070713_100012412
337 Ga0070713_100707649
338 Ga0070710_10012332
339 Ga0070711_100035307
340 Ga0070711_100077117
341 Ga0070708_101143405
342 Ga0070681_10025507
343 Ga0070681_10159809
344 Ga0070681_10280254
345 Ga0070706_100057820
346 Ga0070706_100470992
347 Ga0070706_100925538
348 Ga0070707_100013801
349 Ga0070707_100437604
350 Ga0070698_100001353
351 Ga0070699_100330237
352 Ga0070699_100918353
353 Ga0070679_100035527
354 Ga0070679_100377911
355 Ga0070679_101002839
356 Ga0070697_100171221
357 Ga0070697_100174848
358 Ga0070697_100247802
359 Ga0070697_100733354
360 Ga0068853_100156184
361 Ga0070686_100111327
362 Ga0068864_101893937
363 Ga0068858_100782072
364 Ga0081540_1006892
365 Ga0081540_1096382
366 Ga0070717_10000398
367 Ga0070717_10254356
368 Ga0070717_10317407
369 Ga0070717_10618479
370 Ga0070717_10794712
371 Ga0075368_10054354
372 Ga0075363_100019388
373 Ga0075364_10073413
374 Ga0070715_10803160
375 Ga0070712_100246352
376 Ga0070712_100411632
377 Ga0070712_100673103
378 Ga0075366_10136013
379 Ga0075428_101760075
380 Ga0075433_11268492
381 Ga0075436_100071781
382 Ga0075435_100212769
383 Ga0099795_10059076
384 Ga0099795_10075842
385 Ga0105251_10224602
386 Ga0111539_10550587
387 Ga0105247_11105021
388 Ga0105242_10839059
389 Ga0105248_10411129
390 Ga0105238_10012210
391 Ga0099796_10001288
392 Ga0105239_11685102
393 Ga0105246_10992508
394 Ga0157370_11793893
395 Ga0157374_10237605
396 Ga0163162_10163396
397 Ga0157375_10805190
398 Ga0163163_11135432
399 Ga0157380_10675338
400 Ga0182008_10335822
401 Ga0157379_10127582
402 Ga0157379_10438585
403 Ga0157376_12602417
404 Ga0206353_11612535
405 Ga0213873_10011069
406 Ga0213873_10029647
407 Ga0213873_10074271
408 Ga0213872_10033400
409 Ga0213872_10089104
410 Ga0213876_10048897
411 Ga0213876_10077733
412 Ga0213876_10302236
413 Ga0213875_10000114
414 Ga0213875_10049346
415 Ga0213875_10176418
416 Ga0224712_10309779
417 Ga0224712_10570906
418 Ga0228598_1004692
419 Ga0207692_10141524
420 Ga0207692_10185220
421 Ga0207680_10086992
422 Ga0207685_10556515
423 Ga0207699_10196503
424 Ga0207699_10329847
425 Ga0207684_10344363
426 Ga0207684_10671789
427 Ga0207684_10887229
428 Ga0207707_10014070
429 Ga0207707_10169212
430 Ga0207707_10426836
431 Ga0207693_10003170
432 Ga0207693_10019102
433 Ga0207693_10089153
434 Ga0207693_10342403
435 Ga0207663_10074248
436 Ga0207663_10232899
437 Ga0207646_10016691
438 Ga0207646_10580762
439 Ga0207694_10081235
440 Ga0207665_10112978
441 Ga0207665_10404196
442 Ga0207661_10677934
443 Ga0207703_10674688
444 Ga0207639_10077574
445 Ga0207676_10755249
446 Ga0207676_11766207
447 Ga0207683_10941529
448 Ga0209813_10014031
449 Ga0265338_10110245
450 Ga0311000_115315
451 Ga0311003_106063
452 Ga0310982_106266
453 Ga0310981_1059876
454 Ga0265764_116021
455 Ga0265325_10040778
456 Ga0265327_10006981
457 Ga0265316_10048134
458 Ga0316576_10310451
459 Ga0316578_10701171
460 Ga0307410_10357900
461 Ga0307409_100607057
462 Ga0307414_10070240
463 Ga0307411_11677212
464 Ga0316593_10188889
465 Ga0316592_1076953
466 Ga0373926_0131995
467 Ga0373934_0046094
468 Ga0373936_0195119
469 Ga0373953_0172162
470 Ga0373954_0013044
471 Ga0373954_0366298
472 Ga0373954_0452048
473 Ga0373956_0029251
474 Ga0373956_0102897
475 Ga0373957_0185581
476 Ga0373960_0260547
477 Ga0373955_0141713
478 Ga0373961_0161135
479 Ga0316574_0207710
480 Ga0316574_0561433
481 Ga0373924_0264292
482 Ga0373931_0834867
483 Ga0373935_0187815
484 Ga0373935_0552830
485 Ga0373927_0081979
486 Ga0373927_0234391
487 Ga0373933_0004882
488 Ga0373933_0222009
489 Ga0373947_0211598
490 Ga0373947_0227757
491 Ga0373937_0051990
492 Ga0373937_0077733
493 Ga0373937_0126971
494 Ga0310112_018666
495 Ga0316584_0473038
496 Ga0373925_1362621
497 Ga0395900_0030625
498 Ga0395905_0304689
499 Ga0436364_0087102
500 Ga0436364_0169683
501 Ga0436364_0394460
502 Ga0436364_0655385
503 Ga0436364_0740590
504 Ga0436364_0839622
505 Ga0436364_1130006
506 Ga0436364_1245271
507 Ga0436364_1247082
508 Ga0436364_1306809
509 Ga0395901_0249870
510 Ga0400483_144608
511 Ga0400483_164597
512 Ga0436365_0030032
513 Ga0436365_0048129
514 Ga0436365_0221767
515 Ga0436365_0261811
516 Ga0436365_0540582
517 Ga0436365_0920657
518 Ga0436365_0925068
519 Ga0436365_1180617
520 Ga0436365_1487039
521 Ga0436365_1503025
522 Ga0436360_0483172
523 Ga0436360_0601941
524 Ga0436360_0613706
525 Ga0436360_1047531
526 Ga0436360_1316929
527 Ga0436361_0073423
528 Ga0436361_0191205
529 Ga0436361_0786672
530 Ga0436361_1170696
531 Ga0436361_1171501
532 Ga0436361_1192808
533 Ga0436363_0308739
534 Ga0436363_0740567
535 Ga0436363_0815394
536 Ga0436363_0981701
537 Ga0436363_1273992
538 Ga0436363_1374455
539 Ga0436363_1657090
540 Ga0436362_0008782
541 Ga0436362_0232429
542 Ga0436362_0270574
543 Ga0436362_0280744
544 Ga0436362_0627213
545 Ga0436362_0766360
546 Ga0436362_0778891
547 Ga0436362_1140663
548 Ga0436362_1240410
549 Ga0436362_1251867
550 Ga0439435_0178546
551 Ga0466961_0630481
552 Ga0466963_0275551
553 Ga0453684_0004682
554 Ga0466959_0512943
555 Ga0451576_0004280
556 Ga0451576_1449904
557 Ga0466958_0696403
558 Ga0466967_0141817
559 Ga0466967_2010715
560 Ga0495629_0258122
561 Ga0495651_0269841
562 Ga0495580_0210188
563 Ga0495580_0720582
564 Ga0495662_0071016
565 Ga0495652_0673951
566 Ga0495640_0375737
567 Ga0495586_0775387
568 Ga0495667_0004630
569 Ga0495667_0271610
570 Ga0495634_0100164
571 Ga0495635_0603615
572 Ga0495599_0209496
573 Ga0495613_0460877
574 Ga0495600_0071028
575 Ga0495680_0089930
576 Ga0495602_0435759
577 Ga0496112_0157817
578 Ga0496113_0524895
579 Ga0496121_0419999
580 Ga0501306_016000
581 Ga0501344_11491
582 Ga0501345_07782
583 Ga0501304_007669
584 Ga0501312_026880
585 Ga0501315_023948
586 Ga0501315_038107
587 Ga0501315_067151
588 Ga0501317_002980
589 Ga0501317_006064
590 Ga0501317_010678
591 Ga0501317_051037
592 Ga0501318_010943
593 Ga0501318_078309
594 Ga0501321_053877
595 Ga0501323_027268
596 Ga0501325_008479
597 Ga0501325_020878
598 Ga0501331_13497
599 Ga0501031_0782420
600 Ga0501033_0401755
601 Ga0501034_0000189
602 Ga0501036_0708449
603 Ga0501047_0735490
604 Ga0501069_0662073
605 Ga0501070_0044450
606 Ga0501073_0223105
607 Ga0501075_0360784
608 Ga0501077_0486895
609 Ga0501079_0329919
610 Ga0501080_0788742
611 Ga0501081_0804279
612 Ga0501083_0010056
613 Ga0501035_0539274
614 nmdc:mga03n38_33489_c2
615 nmdc:mga00v17_189170_c1
616 nmdc:mga0k408_151850_c1
617 nmdc:mga06z11_46762_c1
618 nmdc:mga04h51_56926_c1
619 nmdc:mga0rr50_924985_c1
620 nmdc:mga08x19_392929_c1
621 Ga0495601_0023319
622 Ga0495601_0172772
623 Ga0495595_0096883
624 Ga0495619_0007478
625 Ga0495619_0421107
626 Ga0500643_019834
627 Ga0500556_0075752
628 Ga0501084_0892948
629 Ga0587077_183595
630 Ga0587090_005959
631 Ga0587101_003653
632 Ga0587117_098873
633 Ga0587062_024426
634 Ga0587068_046295
635 Ga0587111_0010135
636 Ga0501082_0158831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

50

169

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9323 1 143
7m4w-assembly1.cif.gz_I a. baumannii ribosome-eravacycline complex: empty 70s 0.9315 1 143
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9291 1 143
7nhn-assembly1.cif.gz_M vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9279 1 143
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9261 1 143
ID Description Score Start End Superfamily
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9304 1 143 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9241 1 143 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8971 12 154 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.892 12 154 3.90.1180.10
2v47N00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8887 1 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A1Q7BZ54-F1-model_v4 50S ribosomal protein L13 0.9585 15 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-V7EN88-F1-model_v4 50S ribosomal protein L13 0.9565 1 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-P75178-F1-model_v4 Large ribosomal subunit protein uL13 (50S ribosomal protein L13) 0.9563 13 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1Y2K1C2-F1-model_v4 Large ribosomal subunit protein uL13 0.9557 6 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A258RNK1-F1-model_v4 Large ribosomal subunit protein uL13 0.9541 18 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Map