F404172

General Info

Members Datasets Scaffolds Average Seq Length
317 221 634 230

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10037234|Ga0213874_100372341
Length 256
Sequence MPNPQSPVASDQSRLVAASLRRVPLCGYRKPAPGIHPPHLHPDYLASLKRAPAQPLVPIPQTLSEITGPCFQPHHLRIGADLTGQGKGAPLGQKMLLTGRVLDENGKPVRHTLVEIWQANAAGRYRHLVDQHAAPIDPNFVGKGQLLTDDEGRYQFKTIKPGAYPWRNHPNAWRPPHIHFSLFGPAFSTRLVTQMYFPGDPLLPFDPIFNGIRDEAARQRLIAQFDWQTTVPEEALGFRFDIVLRGRLETPMENRP

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
214 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
215 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
221 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.32
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.83
Nodule 1.26
Rhizoplane 2.21
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10037234 3300021377 Bacteria 1438
2 JGI25159J45721_1010161 3300002987 Bacteria 2423
3 JGI25406J46586_10007018 3300003203 Bacteria 5170
4 Ga0055537_1000493 3300003773 Bacteria 24035
5 Ga0055537_1012777 3300003773 Bacteria 1616
6 Ga0055524_1000145 3300003775 Bacteria 84202
7 Ga0055534_1005486 3300003784 Bacteria 3385
8 Ga0055528_1004710 3300003790 Bacteria 6510
9 Ga0055530_10000244 3300003791 Bacteria 49128
10 Ga0055540_1000237 3300003792 Bacteria 50309
11 Ga0065707_10018726 3300005295 Bacteria 1956
12 Ga0065707_10138547 3300005295 Bacteria 1804
13 Ga0070658_10001541 3300005327 Bacteria 19533
14 Ga0070658_10239865 3300005327 Bacteria 1536
15 Ga0070683_100850124 3300005329 Bacteria 875
16 Ga0070666_10278402 3300005335 Bacteria 1189
17 Ga0070680_100079289 3300005336 Bacteria 2706
18 Ga0070668_100042325 3300005347 Bacteria 3491
19 Ga0070668_100158530 3300005347 Bacteria 1835
20 Ga0070675_100049233 3300005354 Bacteria 3458
21 Ga0070675_100070245 3300005354 Bacteria 2902
22 Ga0070675_100549492 3300005354 Bacteria 1044
23 Ga0070674_100010505 3300005356 Bacteria 5601
24 Ga0070659_100213272 3300005366 Bacteria 1591
25 Ga0070714_100068543 3300005435 Unclassified 3061
26 Ga0070713_100015353 3300005436 Bacteria 5720
27 Ga0070705_100009960 3300005440 Bacteria 4745
28 Ga0070705_100305178 3300005440 Bacteria 1142
29 Ga0070700_100070603 3300005441 Bacteria 2227
30 Ga0070708_100651100 3300005445 Bacteria 993
31 Ga0070663_100025329 3300005455 Bacteria 4004
32 Ga0070662_100413948 3300005457 Bacteria 1114
33 Ga0070681_10010832 3300005458 Bacteria 9010
34 Ga0068867_100680462 3300005459 Bacteria 906
35 Ga0070707_100297830 3300005468 Bacteria 1567
36 Ga0070707_100318664 3300005468 Bacteria 1511
37 Ga0070698_100385351 3300005471 Bacteria 1334
38 Ga0070699_100140336 3300005518 Bacteria 2133
39 Ga0070679_100018908 3300005530 Bacteria 6690
40 Ga0070679_100080892 3300005530 Bacteria 3238
41 Ga0070697_100090047 3300005536 Bacteria 2535
42 Ga0070686_100108814 3300005544 Bacteria 1885
43 Ga0070695_100082275 3300005545 Bacteria 2131
44 Ga0070696_100045848 3300005546 Bacteria 3029
45 Ga0070696_100188746 3300005546 Bacteria 1533
46 Ga0070665_100029905 3300005548 Bacteria 5482
47 Ga0070704_100201001 3300005549 Bacteria 1609
48 Ga0068855_100079194 3300005563 Bacteria 3811
49 Ga0068855_100432543 3300005563 Bacteria 1438
50 Ga0068857_100161169 3300005577 Bacteria 2035
51 Ga0068856_100039703 3300005614 Bacteria 4621
52 Ga0070702_100541268 3300005615 Bacteria 862
53 Ga0068859_100131251 3300005617 Bacteria 2577
54 Ga0068859_100641575 3300005617 Bacteria 1154
55 Ga0068861_100231727 3300005719 Bacteria 1566
56 Ga0068861_100335185 3300005719 Bacteria 1322
57 Ga0068858_100057775 3300005842 Bacteria 3585
58 Ga0068860_100081310 3300005843 Bacteria 3081
59 Ga0068860_100618165 3300005843 Bacteria 1090
60 Ga0068862_100027230 3300005844 Bacteria 4810
61 Ga0081455_10064892 3300005937 Bacteria 3056
62 Ga0081539_10000847 3300005985 Bacteria 58528
63 Ga0075365_10207043 3300006038 Bacteria 1375
64 Ga0075368_10003985 3300006042 Bacteria 4974
65 Ga0075368_10094184 3300006042 Bacteria 1226
66 Ga0075364_10081518 3300006051 Bacteria 2139
67 Ga0075364_10084748 3300006051 Bacteria 2098
68 Ga0070712_100034470 3300006175 Unclassified 3431
69 Ga0075367_10012465 3300006178 Bacteria 4535
70 Ga0075366_10003293 3300006195 Bacteria 8491
71 Ga0075366_10033321 3300006195 Bacteria 3034
72 Ga0075366_10116355 3300006195 Bacteria 1610
73 Ga0075428_100124464 3300006844 Bacteria 2806
74 Ga0075428_100655454 3300006844 Bacteria 1119
75 Ga0075430_100058607 3300006846 Bacteria 3237
76 Ga0075431_100171107 3300006847 Bacteria 2232
77 Ga0075431_100368321 3300006847 Bacteria 1442
78 Ga0075431_100668706 3300006847 Bacteria 1018
79 Ga0075431_100679764 3300006847 Bacteria 1008
80 Ga0075433_10028125 3300006852 Bacteria 4777
81 Ga0075433_10039563 3300006852 Bacteria 4078
82 Ga0075433_10109990 3300006852 Bacteria 2445
83 Ga0075434_100044090 3300006871 Bacteria 4425
84 Ga0075434_100170059 3300006871 Bacteria 2199
85 Ga0075434_100786725 3300006871 Bacteria 968
86 Ga0075429_100010739 3300006880 Bacteria 7919
87 Ga0075429_100046591 3300006880 Bacteria 3772
88 Ga0075436_100025003 3300006914 Bacteria 4106
89 Ga0097620_100131253 3300006931 Bacteria 2577
90 Ga0097620_100641595 3300006931 Bacteria 1154
91 Ga0079104_1015379 3300006946 Bacteria 2269
92 Ga0099826_10084606 3300006948 Bacteria 1962
93 Ga0075435_100008144 3300007076 Bacteria 7505
94 Ga0075435_100033069 3300007076 Bacteria 4087
95 Ga0075435_100051115 3300007076 Bacteria 3328
96 Ga0075435_100070635 3300007076 Bacteria 2850
97 Ga0075435_100485964 3300007076 Bacteria 1067
98 Ga0099794_10084096 3300007265 Bacteria 1573
99 Ga0105240_10238910 3300009093 Bacteria 2107
100 Ga0111539_10014252 3300009094 Bacteria 9929
101 Ga0111539_10209260 3300009094 Bacteria 2273
102 Ga0111539_10292700 3300009094 Bacteria 1895
103 Ga0114129_10055400 3300009147 Bacteria 5557
104 Ga0114129_10333262 3300009147 Bacteria 2014
105 Ga0114129_10342535 3300009147 Bacteria 1982
106 Ga0114129_10439956 3300009147 Bacteria 1712
107 Ga0114129_10611696 3300009147 Bacteria 1411
108 Ga0114129_10740080 3300009147 Bacteria 1260
109 Ga0105243_10208040 3300009148 Bacteria 1721
110 Ga0105237_10194117 3300009545 Bacteria 2030
111 Ga0105249_10199062 3300009553 Bacteria 1959
112 Ga0105249_10570059 3300009553 Bacteria 1184
113 Ga0105239_10269348 3300010375 Bacteria 1915
114 Ga0157326_1003498 3300012513 Bacteria 1650
115 Ga0157373_10252245 3300013100 Bacteria 1248
116 Ga0157371_10000337 3300013102 Bacteria 60433
117 Ga0157370_10142695 3300013104 Bacteria 2231
118 Ga0157370_10208410 3300013104 Bacteria 1812
119 Ga0157369_10010055 3300013105 Bacteria 10801
120 Ga0157374_10004383 3300013296 Bacteria 11877
121 Ga0157378_10801169 3300013297 Bacteria 968
122 Ga0163162_11057203 3300013306 Bacteria 919
123 Ga0157372_10581037 3300013307 Bacteria 1306
124 Ga0157375_11369534 3300013308 Bacteria 833
125 Ga0163163_10262083 3300014325 Bacteria 1780
126 Ga0163163_10691003 3300014325 Bacteria 1084
127 Ga0182008_10116840 3300014497 Bacteria 1324
128 Ga0182007_10000103 3300015262 Bacteria 59975
129 Ga0163161_10395897 3300017792 Bacteria 1107
130 Ga0206356_11783373 3300020070 Bacteria 2608
131 Ga0213872_10066908 3300021361 Unclassified 1622
132 Ga0207425_1002316 3300025245 Bacteria 6830
133 Ga0209565_1000026 3300025263 Bacteria 365910
134 Ga0209673_1000009 3300025273 Bacteria 620735
135 Ga0209130_1000863 3300025284 Bacteria 24942
136 Ga0209675_1000849 3300025291 Bacteria 19886
137 Ga0209676_1000013 3300025292 Bacteria 816080
138 Ga0209564_1000243 3300025295 Bacteria 118066
139 Ga0209564_1000676 3300025295 Bacteria 50422
140 Ga0209050_1000008 3300025298 Bacteria 1144179
141 Ga0209256_1000003 3300025299 Bacteria 1661127
142 Ga0209051_1000005 3300025303 Bacteria 1142353
143 Ga0209257_1000048 3300025304 Bacteria 455536
144 Ga0207699_10472704 3300025906 Bacteria 902
145 Ga0207645_10366843 3300025907 Bacteria 965
146 Ga0207705_10094536 3300025909 Bacteria 2192
147 Ga0207705_10146612 3300025909 Bacteria 1766
148 Ga0207693_10189319 3300025915 Bacteria 1619
149 Ga0207660_10139576 3300025917 Bacteria 1852
150 Ga0207662_10062784 3300025918 Bacteria 2233
151 Ga0207657_10010682 3300025919 Bacteria 9144
152 Ga0207652_10045225 3300025921 Bacteria 3752
153 Ga0207681_10236939 3300025923 Bacteria 1419
154 Ga0207694_10602112 3300025924 Bacteria 924
155 Ga0207659_10050771 3300025926 Bacteria 2948
156 Ga0207659_10435744 3300025926 Bacteria 1102
157 Ga0207690_10191698 3300025932 Bacteria 1546
158 Ga0207670_10088163 3300025936 Bacteria 2188
159 Ga0207669_10018676 3300025937 Bacteria 3591
160 Ga0207689_10425205 3300025942 Bacteria 1109
161 Ga0207712_10212445 3300025961 Bacteria 1542
162 Ga0207668_10066371 3300025972 Bacteria 2558
163 Ga0207640_10141438 3300025981 Bacteria 1755
164 Ga0207640_10193054 3300025981 Bacteria 1536
165 Ga0207678_10135091 3300026067 Bacteria 2104
166 Ga0207641_10337743 3300026088 Bacteria 1433
167 Ga0207648_10554745 3300026089 Bacteria 1056
168 Ga0207674_10028012 3300026116 Bacteria 5954
169 Ga0207674_10294245 3300026116 Bacteria 1572
170 Ga0207675_100012915 3300026118 Bacteria 7799
171 Ga0207698_10387255 3300026142 Bacteria 1332
172 Ga0207698_10866352 3300026142 Bacteria 909
173 Ga0209281_1015057 3300027111 Bacteria 1620
174 Ga0209282_1119167 3300027666 Bacteria 1323
175 Ga0209588_1091739 3300027671 Bacteria 979
176 Ga0209813_10019121 3300027866 Bacteria 1900
177 Ga0207428_10000069 3300027907 Bacteria 149507
178 Ga0268266_10220995 3300028379 Bacteria 1741
179 Ga0268265_10628271 3300028380 Bacteria 1030
180 Ga0268264_10445749 3300028381 Bacteria 1253
181 Ga0265338_10122209 3300028800 Bacteria 2073
182 Ga0265338_10189094 3300028800 Bacteria 1562
183 Ga0265338_10226197 3300028800 Bacteria 1394
184 Ga0307513_10000057 3300031456 Bacteria 146564
185 Ga0307408_100002845 3300031548 Bacteria 12005
186 Ga0307408_100100732 3300031548 Bacteria 2201
187 Ga0307405_10131309 3300031731 Bacteria 1731
188 Ga0307405_10169771 3300031731 Bacteria 1555
189 Ga0307406_10048127 3300031901 Bacteria 2691
190 Ga0307412_10070138 3300031911 Bacteria 2388
191 Ga0307416_100033851 3300032002 Bacteria 3880
192 Ga0307416_100067062 3300032002 Bacteria 2958
193 Ga0307416_100658744 3300032002 Bacteria 1132
194 Ga0307415_100013798 3300032126 Bacteria 4728
195 Ga0373932_0026927 3300035112 Bacteria 1568
196 Ga0373939_0060200 3300035114 Bacteria 1206
197 Ga0373956_0112383 3300035119 Bacteria 1269
198 Ga0373942_0100856 3300035207 Bacteria 882
199 Ga0373931_0067821 3300035691 Bacteria 1940
200 Ga0373937_0243695 3300036401 Bacteria 1694
201 Ga0395899_0456573 3300037312 Bacteria 836
202 Ga0395900_0035785 3300037418 Bacteria 5116
203 Ga0436364_0766515 3300037853 Bacteria 1712
204 Ga0395901_0036488 3300038443 Bacteria 5082
205 Ga0395901_0313877 3300038443 Bacteria 1623
206 Ga0395901_0654020 3300038443 Bacteria 1054
207 Ga0436365_1449670 3300039437 Bacteria 1674
208 Ga0436360_0131093 3300039438 Bacteria 2874
209 Ga0436360_0516894 3300039438 Bacteria 1045
210 Ga0436360_0775859 3300039438 Unclassified 3183
211 Ga0436360_1055028 3300039438 Unclassified 1444
212 Ga0436361_0472981 3300039447 Bacteria 3098
213 Ga0436361_0799972 3300039447 Bacteria 5171
214 Ga0436361_0835752 3300039447 Unclassified 2063
215 Ga0436361_1186286 3300039447 Bacteria 5057
216 Ga0436363_0770710 3300039450 Bacteria 5750
217 Ga0436362_0484585 3300039453 Bacteria 808
218 Ga0436362_0642904 3300039453 Unclassified 1211
219 Ga0451789_1345060 3300041443 Bacteria 1196
220 Ga0451853_2895117 3300041512 Bacteria 1416
221 Ga0450894_001251 3300042131 Bacteria 3728
222 Ga0439435_0029990 3300042436 Bacteria 1472
223 Ga0439464_0048340 3300042439 Bacteria 1225
224 Ga0451577_0204906 3300042876 Bacteria 1781
225 Ga0466963_0013385 3300044694 Bacteria 5037
226 Ga0466963_0015736 3300044694 Bacteria 4692
227 Ga0466963_0047280 3300044694 Bacteria 2840
228 Ga0466971_0241738 3300044719 Bacteria 859
229 Ga0466960_0355088 3300044901 Bacteria 837
230 Ga0451576_0247476 3300045051 Bacteria 1863
231 Ga0451576_0384866 3300045051 Bacteria 1470
232 Ga0466958_0073042 3300045836 Bacteria 2101
233 Ga0466967_0010192 3300045976 Bacteria 7030
234 Ga0466967_0082229 3300045976 Bacteria 2910
235 Ga0466967_0084787 3300045976 Bacteria 2867
236 Ga0495638_0013126 3300046460 Bacteria 5655
237 Ga0495650_0030949 3300046471 Bacteria 2415
238 Ga0495580_0019813 3300046472 Bacteria 4991
239 Ga0495582_0173218 3300046473 Bacteria 1229
240 Ga0495594_0191051 3300046499 Bacteria 1167
241 Ga0495648_0016213 3300046524 Bacteria 5376
242 Ga0495667_0151635 3300046559 Bacteria 1492
243 Ga0495659_0043767 3300046664 Bacteria 1608
244 Ga0495680_0266262 3300047322 Bacteria 1211
245 Ga0496101_0305458 3300048904 Bacteria 1247
246 Ga0496102_0212940 3300048905 Bacteria 1822
247 Ga0496104_0139539 3300048907 Bacteria 2329
248 Ga0496106_0061603 3300048909 Bacteria 2847
249 Ga0496112_0225332 3300048915 Bacteria 1830
250 Ga0496112_0229671 3300048915 Bacteria 1810
251 Ga0496116_0226846 3300048919 Bacteria 951
252 Ga0496119_0004992 3300048922 Bacteria 12953
253 Ga0496120_0000511 3300048923 Bacteria 60526
254 Ga0496121_0009473 3300048924 Bacteria 11188
255 Ga0496124_0003904 3300048927 Bacteria 17822
256 Ga0496125_0001775 3300048928 Bacteria 29811
257 Ga0496126_0005721 3300048929 Bacteria 14084
258 Ga0501037_0224697 3300049573 Bacteria 1320
259 Ga0501047_0342665 3300049581 Bacteria 1332
260 Ga0501048_0105118 3300049582 Bacteria 1993
261 Ga0501072_0048002 3300049588 Bacteria 3362
262 Ga0501077_0453940 3300049593 Bacteria 821
263 Ga0501079_0049511 3300049741 Bacteria 3243
264 Ga0501081_0318934 3300049743 Bacteria 1142
265 Ga0501044_0163133 3300049823 Bacteria 2204
266 nmdc:mga03n38_38077_c1 3300050490 Bacteria 2078
267 nmdc:mga0k408_137095_c1 3300050493 Bacteria 1454
268 nmdc:mga0k408_33383_c1 3300050493 Bacteria 2943
269 nmdc:mga06z11_45936_c1 3300050494 Bacteria 2211
270 nmdc:mga04h51_14535_c1 3300050495 Bacteria 2251
271 nmdc:mga04h51_72314_c1 3300050495 Bacteria 1207
272 nmdc:mga07m45_29168_c1 3300050496 Bacteria 3049
273 nmdc:mga07m45_47701_c1 3300050496 Bacteria 2408
274 nmdc:mga05p37_23419_c1 3300050507 Bacteria 7493
275 nmdc:mga05p37_568366_c1 3300050507 Bacteria 1287
276 nmdc:mga05p37_76698_c2 3300050507 Bacteria 1750
277 nmdc:mga05p37_87722_c1 3300050507 Bacteria 3835
278 nmdc:mga05p37_91675_c1 3300050507 Bacteria 3745
279 nmdc:mga09592_15994_c1 3300050508 Bacteria 6132
280 nmdc:mga09592_296180_c1 3300050508 Bacteria 1403
281 nmdc:mga0qj67_109559_c1 3300050509 Bacteria 2229
282 nmdc:mga0qj67_141518_c1 3300050509 Bacteria 1951
283 nmdc:mga06r32_1048004_c1 3300050510 Bacteria 766
284 nmdc:mga06r32_190326_c1 3300050510 Bacteria 2040
285 nmdc:mga06r32_274974_c1 3300050510 Bacteria 1672
286 nmdc:mga06r32_561235_c1 3300050510 Bacteria 1115
287 nmdc:mga08y16_182_c1 3300050511 Bacteria 55595
288 nmdc:mga08y16_90709_c1 3300050511 Bacteria 3186
289 nmdc:mga0n895_107784_c1 3300050512 Bacteria 2800
290 nmdc:mga0n895_34872_c1 3300050512 Bacteria 4847
291 nmdc:mga0n895_52273_c1 3300050512 Bacteria 4010
292 nmdc:mga0n895_729773_c1 3300050512 Bacteria 985
293 nmdc:mga0rr50_168941_c1 3300050513 Bacteria 1781
294 nmdc:mga0rr50_19596_c1 3300050513 Bacteria 4571
295 nmdc:mga0rr50_252028_c1 3300050513 Bacteria 1466
296 nmdc:mga0rr50_529741_c1 3300050513 Bacteria 1003
297 nmdc:mga0rr50_553990_c1 3300050513 Bacteria 979
298 nmdc:mga0rr50_72451_c1 3300050513 Bacteria 2631
299 nmdc:mga0a205_135086_c1 3300050515 Bacteria 2367
300 nmdc:mga0a205_165371_c1 3300050515 Bacteria 2108
301 nmdc:mga0a205_40237_c1 3300050515 Bacteria 4500
302 nmdc:mga0a205_644834_c1 3300050515 Bacteria 910
303 Ga0495595_0063578 3300053084 Bacteria 1733
304 Ga0495619_0047440 3300053085 Bacteria 2828
305 Ga0500651_0000883 3300053093 Bacteria 14706
306 Ga0500555_000308 3300053103 Bacteria 21077
307 Ga0500555_018190 3300053103 Bacteria 2026
308 Ga0500593_000162 3300053117 Bacteria 26813
309 Ga0500628_002096 3300053129 Bacteria 3343
310 Ga0500604_0006975 3300053151 Bacteria 2991
311 Ga0500645_000115 3300053730 Bacteria 64208
312 Ga0500645_000209 3300053730 Bacteria 45050
313 Ga0500645_001768 3300053730 Bacteria 10449
314 Ga0501082_0366049 3300060353 Bacteria 1258
315 Ga0466962_0121320 3300061719 Bacteria 1261
316 2929203799 2929199973 Bacteria 7260745
317 8055915640 8055909800 Bacteria 7278581
318 Ga0213874_10037234
319 JGI25159J45721_1010161
320 JGI25406J46586_10007018
321 Ga0055537_1000493
322 Ga0055537_1012777
323 Ga0055524_1000145
324 Ga0055534_1005486
325 Ga0055528_1004710
326 Ga0055530_10000244
327 Ga0055540_1000237
328 Ga0065707_10018726
329 Ga0065707_10138547
330 Ga0070658_10001541
331 Ga0070658_10239865
332 Ga0070683_100850124
333 Ga0070666_10278402
334 Ga0070680_100079289
335 Ga0070668_100042325
336 Ga0070668_100158530
337 Ga0070675_100049233
338 Ga0070675_100070245
339 Ga0070675_100549492
340 Ga0070674_100010505
341 Ga0070659_100213272
342 Ga0070714_100068543
343 Ga0070713_100015353
344 Ga0070705_100009960
345 Ga0070705_100305178
346 Ga0070700_100070603
347 Ga0070708_100651100
348 Ga0070663_100025329
349 Ga0070662_100413948
350 Ga0070681_10010832
351 Ga0068867_100680462
352 Ga0070707_100297830
353 Ga0070707_100318664
354 Ga0070698_100385351
355 Ga0070699_100140336
356 Ga0070679_100018908
357 Ga0070679_100080892
358 Ga0070697_100090047
359 Ga0070686_100108814
360 Ga0070695_100082275
361 Ga0070696_100045848
362 Ga0070696_100188746
363 Ga0070665_100029905
364 Ga0070704_100201001
365 Ga0068855_100079194
366 Ga0068855_100432543
367 Ga0068857_100161169
368 Ga0068856_100039703
369 Ga0070702_100541268
370 Ga0068859_100131251
371 Ga0068859_100641575
372 Ga0068861_100231727
373 Ga0068861_100335185
374 Ga0068858_100057775
375 Ga0068860_100081310
376 Ga0068860_100618165
377 Ga0068862_100027230
378 Ga0081455_10064892
379 Ga0081539_10000847
380 Ga0075365_10207043
381 Ga0075368_10003985
382 Ga0075368_10094184
383 Ga0075364_10081518
384 Ga0075364_10084748
385 Ga0070712_100034470
386 Ga0075367_10012465
387 Ga0075366_10003293
388 Ga0075366_10033321
389 Ga0075366_10116355
390 Ga0075428_100124464
391 Ga0075428_100655454
392 Ga0075430_100058607
393 Ga0075431_100171107
394 Ga0075431_100368321
395 Ga0075431_100668706
396 Ga0075431_100679764
397 Ga0075433_10028125
398 Ga0075433_10039563
399 Ga0075433_10109990
400 Ga0075434_100044090
401 Ga0075434_100170059
402 Ga0075434_100786725
403 Ga0075429_100010739
404 Ga0075429_100046591
405 Ga0075436_100025003
406 Ga0097620_100131253
407 Ga0097620_100641595
408 Ga0079104_1015379
409 Ga0099826_10084606
410 Ga0075435_100008144
411 Ga0075435_100033069
412 Ga0075435_100051115
413 Ga0075435_100070635
414 Ga0075435_100485964
415 Ga0099794_10084096
416 Ga0105240_10238910
417 Ga0111539_10014252
418 Ga0111539_10209260
419 Ga0111539_10292700
420 Ga0114129_10055400
421 Ga0114129_10333262
422 Ga0114129_10342535
423 Ga0114129_10439956
424 Ga0114129_10611696
425 Ga0114129_10740080
426 Ga0105243_10208040
427 Ga0105237_10194117
428 Ga0105249_10199062
429 Ga0105249_10570059
430 Ga0105239_10269348
431 Ga0157326_1003498
432 Ga0157373_10252245
433 Ga0157371_10000337
434 Ga0157370_10142695
435 Ga0157370_10208410
436 Ga0157369_10010055
437 Ga0157374_10004383
438 Ga0157378_10801169
439 Ga0163162_11057203
440 Ga0157372_10581037
441 Ga0157375_11369534
442 Ga0163163_10262083
443 Ga0163163_10691003
444 Ga0182008_10116840
445 Ga0182007_10000103
446 Ga0163161_10395897
447 Ga0206356_11783373
448 Ga0213872_10066908
449 Ga0207425_1002316
450 Ga0209565_1000026
451 Ga0209673_1000009
452 Ga0209130_1000863
453 Ga0209675_1000849
454 Ga0209676_1000013
455 Ga0209564_1000243
456 Ga0209564_1000676
457 Ga0209050_1000008
458 Ga0209256_1000003
459 Ga0209051_1000005
460 Ga0209257_1000048
461 Ga0207699_10472704
462 Ga0207645_10366843
463 Ga0207705_10094536
464 Ga0207705_10146612
465 Ga0207693_10189319
466 Ga0207660_10139576
467 Ga0207662_10062784
468 Ga0207657_10010682
469 Ga0207652_10045225
470 Ga0207681_10236939
471 Ga0207694_10602112
472 Ga0207659_10050771
473 Ga0207659_10435744
474 Ga0207690_10191698
475 Ga0207670_10088163
476 Ga0207669_10018676
477 Ga0207689_10425205
478 Ga0207712_10212445
479 Ga0207668_10066371
480 Ga0207640_10141438
481 Ga0207640_10193054
482 Ga0207678_10135091
483 Ga0207641_10337743
484 Ga0207648_10554745
485 Ga0207674_10028012
486 Ga0207674_10294245
487 Ga0207675_100012915
488 Ga0207698_10387255
489 Ga0207698_10866352
490 Ga0209281_1015057
491 Ga0209282_1119167
492 Ga0209588_1091739
493 Ga0209813_10019121
494 Ga0207428_10000069
495 Ga0268266_10220995
496 Ga0268265_10628271
497 Ga0268264_10445749
498 Ga0265338_10122209
499 Ga0265338_10189094
500 Ga0265338_10226197
501 Ga0307513_10000057
502 Ga0307408_100002845
503 Ga0307408_100100732
504 Ga0307405_10131309
505 Ga0307405_10169771
506 Ga0307406_10048127
507 Ga0307412_10070138
508 Ga0307416_100033851
509 Ga0307416_100067062
510 Ga0307416_100658744
511 Ga0307415_100013798
512 Ga0373932_0026927
513 Ga0373939_0060200
514 Ga0373956_0112383
515 Ga0373942_0100856
516 Ga0373931_0067821
517 Ga0373937_0243695
518 Ga0395899_0456573
519 Ga0395900_0035785
520 Ga0436364_0766515
521 Ga0395901_0036488
522 Ga0395901_0313877
523 Ga0395901_0654020
524 Ga0436365_1449670
525 Ga0436360_0131093
526 Ga0436360_0516894
527 Ga0436360_0775859
528 Ga0436360_1055028
529 Ga0436361_0472981
530 Ga0436361_0799972
531 Ga0436361_0835752
532 Ga0436361_1186286
533 Ga0436363_0770710
534 Ga0436362_0484585
535 Ga0436362_0642904
536 Ga0451789_1345060
537 Ga0451853_2895117
538 Ga0450894_001251
539 Ga0439435_0029990
540 Ga0439464_0048340
541 Ga0451577_0204906
542 Ga0466963_0013385
543 Ga0466963_0015736
544 Ga0466963_0047280
545 Ga0466971_0241738
546 Ga0466960_0355088
547 Ga0451576_0247476
548 Ga0451576_0384866
549 Ga0466958_0073042
550 Ga0466967_0010192
551 Ga0466967_0082229
552 Ga0466967_0084787
553 Ga0495638_0013126
554 Ga0495650_0030949
555 Ga0495580_0019813
556 Ga0495582_0173218
557 Ga0495594_0191051
558 Ga0495648_0016213
559 Ga0495667_0151635
560 Ga0495659_0043767
561 Ga0495680_0266262
562 Ga0496101_0305458
563 Ga0496102_0212940
564 Ga0496104_0139539
565 Ga0496106_0061603
566 Ga0496112_0225332
567 Ga0496112_0229671
568 Ga0496116_0226846
569 Ga0496119_0004992
570 Ga0496120_0000511
571 Ga0496121_0009473
572 Ga0496124_0003904
573 Ga0496125_0001775
574 Ga0496126_0005721
575 Ga0501037_0224697
576 Ga0501047_0342665
577 Ga0501048_0105118
578 Ga0501072_0048002
579 Ga0501077_0453940
580 Ga0501079_0049511
581 Ga0501081_0318934
582 Ga0501044_0163133
583 nmdc:mga03n38_38077_c1
584 nmdc:mga0k408_137095_c1
585 nmdc:mga0k408_33383_c1
586 nmdc:mga06z11_45936_c1
587 nmdc:mga04h51_14535_c1
588 nmdc:mga04h51_72314_c1
589 nmdc:mga07m45_29168_c1
590 nmdc:mga07m45_47701_c1
591 nmdc:mga05p37_23419_c1
592 nmdc:mga05p37_568366_c1
593 nmdc:mga05p37_76698_c2
594 nmdc:mga05p37_87722_c1
595 nmdc:mga05p37_91675_c1
596 nmdc:mga09592_15994_c1
597 nmdc:mga09592_296180_c1
598 nmdc:mga0qj67_109559_c1
599 nmdc:mga0qj67_141518_c1
600 nmdc:mga06r32_1048004_c1
601 nmdc:mga06r32_190326_c1
602 nmdc:mga06r32_274974_c1
603 nmdc:mga06r32_561235_c1
604 nmdc:mga08y16_182_c1
605 nmdc:mga08y16_90709_c1
606 nmdc:mga0n895_107784_c1
607 nmdc:mga0n895_34872_c1
608 nmdc:mga0n895_52273_c1
609 nmdc:mga0n895_729773_c1
610 nmdc:mga0rr50_168941_c1
611 nmdc:mga0rr50_19596_c1
612 nmdc:mga0rr50_252028_c1
613 nmdc:mga0rr50_529741_c1
614 nmdc:mga0rr50_553990_c1
615 nmdc:mga0rr50_72451_c1
616 nmdc:mga0a205_135086_c1
617 nmdc:mga0a205_165371_c1
618 nmdc:mga0a205_40237_c1
619 nmdc:mga0a205_644834_c1
620 Ga0495595_0063578
621 Ga0495619_0047440
622 Ga0500651_0000883
623 Ga0500555_000308
624 Ga0500555_018190
625 Ga0500593_000162
626 Ga0500628_002096
627 Ga0500604_0006975
628 Ga0500645_000115
629 Ga0500645_000209
630 Ga0500645_001768
631 Ga0501082_0366049
632 Ga0466962_0121320
633 2929203799
634 8055915640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

66

246

0.93

PF12391

PCDO_beta_N

Protocatechuate 3,4-dioxygenase beta subunit N terminal

28

62

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.8526 62 237
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.852 62 237
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8347 56 237
3lkt-assembly1.cif.gz_A tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.8055 63 237
3lkt-assembly1.cif.gz_M tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.7759 11 237
ID Description Score Start End Superfamily
af_P01023_352_433_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8377 77 144 2.60.40.10
af_I1JQT5_407_1195_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7723 78 168 2.60.40.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7693 63 237 2.60.130.10
af_I1NBD7_943_1024_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7668 82 168 2.60.40.1120
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7544 11 237 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A7W1AXQ8-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9197 54 237 GO:0008199
GO:0016702
AF-A0A1C9ICQ1-F1-model_v4 Protocatechuate dioxygenase beta subunit 0.9188 62 219 GO:0008199
GO:0016702
AF-A0A7Y2FS74-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9166 82 237 GO:0008199
GO:0016702
AF-F5YYG0-F1-model_v4 Protocatechuate 34-dioxygenase beta subunit 0.9056 50 237 GO:0008199
GO:0018578
GO:0019619
AF-A0A382J2N4-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9035 99 237 GO:0008199
GO:0016702

Map