F403589

General Info

Members Datasets Scaffolds Average Seq Length
316 213 273 533

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000289|Ga0068860_1000002899
Length 563
Sequence MVALIREFGLAIGPSLWSIELSRTTTSRGTPCMVARGYDYIIVGAGSAGCVLANRLSANPSCRVLLLEAGGPDRGFWLRLPVGYYRTIFNARFSRQFVTEPEETTGGRAIVWPRGRVLGGSSSINGLIFIRGQQEGFDDWERVGATGWNYRDLLPYFRRTERYRGGESHXXXXRGEFDVSDLRTGNPASAAWVEAGVEFGLPRNPDFNGATTLGVGPYQLGIGRHWRSSSASAFLHPVARRPNLTIVTGAQVSKVQFKGTVACGVQWIRNGTVFGAVADAEVVLSAGALQSPQLLQLSGIGPAGLLRELGIPVIVDAPEVGLNLQDHYQARMIVRLKQPISLNDQVRNPVELAKMGLQWALAGRGPLTAGAGQVGGAACTAYAVGGRPDIQFNVMPLSVDKPGDPLHRYSGFTASVWQCHGTSRGHLAIRSTDPFDQPRIVPNYFAEDIDRKTIVAGLKMLRDIYRQKSFRDLWDIEMAPGEAAADSAALWDFARTTGGTVFHCVGTCRMGDDDRSVLDPQLRVRGVKRLRVVDASVMPLITSANTNATSLMIGERGAALIMS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
9 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
10 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
11 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
12 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
13 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
14 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
15 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
16 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
17 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
18 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
19 2858950400 Achromobacter sp. K91 Isolate Unclassified
20 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
21 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
22 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
23 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
24 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
25 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
26 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
29 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
30 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
31 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
32 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
33 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
34 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
35 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
36 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
37 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
38 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
39 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
40 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
41 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
139 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
140 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
205 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
206 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
209 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
213 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.39
Metatranscriptomes 0
Isolates 13.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 12.66
Rhizoplane 5.38
Rhizosphere 66.14
Stem 0
Stem Tuber 0
Unclassified 8.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000060 3300003203 Bacteria 50068
2 rootH2_10020844 3300003320 Bacteria 4418
3 rootH1_10082096 3300003323 Bacteria 8605
4 JGI25404J52841_10000476 3300003659 Bacteria 5765
5 Ga0070658_10035940 3300005327 Bacteria 3992
6 Ga0070683_100008289 3300005329 Bacteria 8831
7 Ga0070670_100006753 3300005331 Bacteria 9725
8 Ga0070670_100018584 3300005331 Bacteria 5957
9 Ga0070661_100049517 3300005344 Bacteria 3076
10 Ga0070661_100053856 3300005344 Bacteria 2946
11 Ga0070661_100083594 3300005344 Bacteria 2358
12 Ga0070668_100009888 3300005347 Bacteria 7064
13 Ga0070669_100110184 3300005353 Bacteria 2088
14 Ga0070659_100012332 3300005366 Bacteria 6333
15 Ga0070709_10002208 3300005434 Bacteria 10539
16 Ga0070714_100002040 3300005435 Bacteria 14795
17 Ga0070714_100025364 3300005435 Bacteria 4892
18 Ga0070713_100002893 3300005436 Bacteria 11231
19 Ga0070713_100007608 3300005436 Bacteria 7621
20 Ga0070713_100022365 3300005436 Bacteria 4886
21 Ga0070710_10000650 3300005437 Bacteria 16572
22 Ga0070710_10076668 3300005437 Bacteria 1941
23 Ga0070711_100002615 3300005439 Bacteria 10302
24 Ga0070663_100041684 3300005455 Bacteria 3222
25 Ga0070678_100011753 3300005456 Bacteria 5415
26 Ga0070681_10001413 3300005458 Bacteria 21075
27 Ga0070681_10001542 3300005458 Bacteria 20408
28 Ga0068867_100055975 3300005459 Bacteria 2917
29 Ga0070698_100023633 3300005471 Bacteria 6423
30 Ga0070698_100085546 3300005471 Bacteria 3140
31 Ga0068853_100022991 3300005539 Bacteria 5214
32 Ga0068853_100109891 3300005539 Bacteria 2448
33 Ga0070693_100036415 3300005547 Bacteria 2735
34 Ga0068855_100073293 3300005563 Bacteria 3979
35 Ga0068855_100266866 3300005563 Bacteria 1905
36 Ga0070664_100020902 3300005564 Bacteria 5393
37 Ga0068854_100055938 3300005578 Bacteria 2842
38 Ga0068856_100021750 3300005614 Bacteria 6233
39 Ga0068852_100000371 3300005616 Bacteria 30327
40 Ga0068852_100037389 3300005616 Bacteria 4069
41 Ga0068859_100006107 3300005617 Bacteria 12235
42 Ga0068864_100022080 3300005618 Bacteria 5335
43 Ga0068861_100019659 3300005719 Bacteria 4825
44 Ga0068851_10027267 3300005834 Bacteria 2814
45 Ga0068860_100000289 3300005843 Bacteria 71608
46 Ga0081455_10000062 3300005937 Bacteria 115850
47 Ga0081540_1000862 3300005983 Bacteria 27458
48 Ga0081540_1022473 3300005983 Bacteria 3725
49 Ga0081539_10000003 3300005985 Bacteria 594833
50 Ga0070717_10155683 3300006028 Bacteria 1980
51 Ga0075365_10033796 3300006038 Bacteria 3298
52 Ga0070712_100001472 3300006175 Bacteria 14360
53 Ga0070712_100011985 3300006175 Bacteria 5511
54 Ga0075367_10001332 3300006178 Bacteria 10472
55 Ga0075369_10042423 3300006186 Bacteria 1950
56 Ga0068871_100031425 3300006358 Bacteria 4188
57 Ga0075428_100018652 3300006844 Bacteria 7669
58 Ga0075428_100020453 3300006844 Bacteria 7327
59 Ga0075428_100262139 3300006844 Bacteria 1861
60 Ga0075431_100006362 3300006847 Bacteria 11724
61 Ga0075431_100019118 3300006847 Bacteria 6980
62 Ga0075431_100061347 3300006847 Bacteria 3880
63 Ga0075429_100000922 3300006880 Bacteria 23290
64 Ga0075429_100009907 3300006880 Bacteria 8261
65 Ga0097620_100006104 3300006931 Bacteria 12235
66 Ga0099824_1021223 3300006942 Bacteria 4583
67 Ga0099822_1002451 3300006943 Bacteria 23110
68 Ga0099823_1000008 3300006944 Bacteria 105646
69 Ga0099795_10015236 3300007788 Bacteria 2403
70 Ga0105240_10003803 3300009093 Bacteria 23321
71 Ga0105247_10068655 3300009101 Bacteria 2210
72 Ga0114129_10005286 3300009147 Bacteria 18217
73 Ga0105243_10038453 3300009148 Bacteria 3726
74 Ga0105243_10046520 3300009148 Bacteria 3414
75 Ga0105241_10035230 3300009174 Bacteria 3764
76 Ga0105241_10081972 3300009174 Bacteria 2528
77 Ga0105237_10032643 3300009545 Bacteria 5271
78 Ga0105237_10148929 3300009545 Bacteria 2336
79 Ga0105238_10000556 3300009551 Bacteria 39015
80 Ga0105249_10027163 3300009553 Bacteria 5163
81 Ga0105239_10191322 3300010375 Bacteria 2290
82 Ga0105246_10037493 3300011119 Bacteria 3254
83 Ga0157373_10028652 3300013100 Bacteria 4017
84 Ga0157371_10047983 3300013102 Bacteria 3036
85 Ga0157370_10005227 3300013104 Bacteria 14617
86 Ga0157370_10023145 3300013104 Bacteria 6175
87 Ga0157370_10077152 3300013104 Bacteria 3139
88 Ga0157370_10141221 3300013104 Bacteria 2244
89 Ga0157369_10005626 3300013105 Bacteria 14557
90 Ga0157374_10077215 3300013296 Bacteria 3151
91 Ga0157372_10007555 3300013307 Bacteria 11556
92 Ga0157372_10009605 3300013307 Bacteria 10280
93 Ga0157372_10059404 3300013307 Bacteria 4276
94 Ga0157372_10235660 3300013307 Bacteria 2123
95 Ga0163163_10002739 3300014325 Bacteria 14874
96 Ga0157380_10028619 3300014326 Bacteria 4251
97 Ga0157380_10063531 3300014326 Bacteria 2960
98 Ga0157376_10093759 3300014969 Bacteria 2607
99 Ga0163161_10033327 3300017792 Bacteria 3681
100 Ga0213876_10001443 3300021384 Bacteria 14779
101 Ga0209677_103344 3300025253 Bacteria 5277
102 Ga0209455_1002178 3300025272 Bacteria 7774
103 Ga0209758_1000838 3300025297 Bacteria 42919
104 Ga0207692_10002847 3300025898 Bacteria 6687
105 Ga0207699_10001240 3300025906 Bacteria 12128
106 Ga0207699_10013006 3300025906 Bacteria 4245
107 Ga0207654_10011066 3300025911 Bacteria 4592
108 Ga0207707_10015206 3300025912 Bacteria 6701
109 Ga0207707_10050260 3300025912 Bacteria 3632
110 Ga0207707_10055662 3300025912 Bacteria 3441
111 Ga0207671_10074465 3300025914 Bacteria 2538
112 Ga0207693_10003335 3300025915 Bacteria 13737
113 Ga0207693_10020057 3300025915 Bacteria 5317
114 Ga0207657_10001312 3300025919 Bacteria 26386
115 Ga0207657_10001491 3300025919 Bacteria 25043
116 Ga0207649_10052228 3300025920 Bacteria 2535
117 Ga0207649_10064829 3300025920 Bacteria 2311
118 Ga0207694_10006006 3300025924 Bacteria 9294
119 Ga0207650_10033376 3300025925 Bacteria 3727
120 Ga0207700_10005496 3300025928 Bacteria 7600
121 Ga0207700_10023639 3300025928 Bacteria 4243
122 Ga0207700_10053279 3300025928 Bacteria 3030
123 Ga0207706_10004262 3300025933 Bacteria 13461
124 Ga0207689_10004916 3300025942 Bacteria 12036
125 Ga0207668_10026654 3300025972 Bacteria 3755
126 Ga0207639_10198888 3300026041 Bacteria 1717
127 Ga0207678_10005947 3300026067 Bacteria 10864
128 Ga0207702_10041597 3300026078 Bacteria 3854
129 Ga0207702_10114789 3300026078 Bacteria 2400
130 Ga0207641_10081993 3300026088 Bacteria 2802
131 Ga0207674_10005327 3300026116 Bacteria 15304
132 Ga0207674_10070625 3300026116 Bacteria 3511
133 Ga0207675_100007890 3300026118 Bacteria 10039
134 Ga0207675_100008391 3300026118 Bacteria 9742
135 Ga0207698_10001704 3300026142 Bacteria 12816
136 Ga0209389_1000032 3300027296 Bacteria 134064
137 Ga0209589_1000001 3300027357 Bacteria 794224
138 Ga0209489_100001 3300027361 Bacteria 794224
139 Ga0209489_100035 3300027361 Bacteria 168255
140 Ga0209700_100001 3300027363 Bacteria 794224
141 Ga0209700_100005 3300027363 Bacteria 573969
142 Ga0209974_10001017 3300027876 Bacteria 9903
143 Ga0268265_10122791 3300028380 Bacteria 2143
144 Ga0268264_10000065 3300028381 Bacteria 298403
145 Ga0268264_10224921 3300028381 Bacteria 1729
146 Ga0307410_10000909 3300031852 Bacteria 12620
147 Ga0307406_10003664 3300031901 Bacteria 8365
148 Ga0307406_10134058 3300031901 Bacteria 1743
149 Ga0307407_10002869 3300031903 Bacteria 6892
150 Ga0307412_10009500 3300031911 Bacteria 5583
151 Ga0307409_100005569 3300031995 Bacteria 7276
152 Ga0307416_100041775 3300032002 Bacteria 3574
153 Ga0315911_1000007 3300033442 Bacteria 413725
154 Ga0373949_0002196 3300035090 Bacteria 5105
155 Ga0373936_0011351 3300035113 Bacteria 3372
156 Ga0373962_0001670 3300035242 Bacteria 5273
157 Ga0395900_0001627 3300037418 Bacteria 26397
158 Ga0395898_0089028 3300037466 Bacteria 2971
159 Ga0395901_0002678 3300038443 Bacteria 17967
160 Ga0395901_0024265 3300038443 Bacteria 6222
161 Ga0436365_1095754 3300039437 Bacteria 43052
162 Ga0436362_0811936 3300039453 Bacteria 8754
163 Ga0466967_0018209 3300045976 Bacteria 5604
164 Ga0466967_0084705 3300045976 Bacteria 2869
165 Ga0466967_0154630 3300045976 Bacteria 2147
166 Ga0496102_0118809 3300048905 Bacteria 2468
167 Ga0496104_0001601 3300048907 Bacteria 19480
168 Ga0496104_0002148 3300048907 Bacteria 17117
169 Ga0496104_0072073 3300048907 Bacteria 3285
170 Ga0496105_0000763 3300048908 Bacteria 21869
171 Ga0496105_0075126 3300048908 Bacteria 2791
172 Ga0496108_0001146 3300048911 Bacteria 20697
173 Ga0496108_0147882 3300048911 Bacteria 2026
174 Ga0496109_0000698 3300048912 Bacteria 27915
175 Ga0496109_0096073 3300048912 Bacteria 2745
176 Ga0496110_0002949 3300048913 Bacteria 12892
177 Ga0496110_0092873 3300048913 Bacteria 2701
178 Ga0496111_0002486 3300048914 Bacteria 11109
179 Ga0496112_0003373 3300048915 Bacteria 13191
180 Ga0496112_0006407 3300048915 Bacteria 10328
181 Ga0496112_0135726 3300048915 Bacteria 2431
182 Ga0496113_0003929 3300048916 Bacteria 9018
183 Ga0496117_0018182 3300048920 Bacteria 5836
184 Ga0496117_0024082 3300048920 Bacteria 4828
185 Ga0496118_0013173 3300048921 Bacteria 7845
186 Ga0496121_0000285 3300048924 Bacteria 104880
187 Ga0496121_0018022 3300048924 Bacteria 7152
188 Ga0496121_0051030 3300048924 Bacteria 3487
189 Ga0496121_0071445 3300048924 Bacteria 2791
190 Ga0496126_0008408 3300048929 Bacteria 11135
191 Ga0496126_0050365 3300048929 Bacteria 3796
192 Ga0496126_0091295 3300048929 Bacteria 2678
193 Ga0501031_0000106 3300049568 Bacteria 44638
194 Ga0501031_0000160 3300049568 Bacteria 38562
195 Ga0501032_0000068 3300049569 Bacteria 89292
196 Ga0501032_0000086 3300049569 Bacteria 81788
197 Ga0501033_0000274 3300049570 Bacteria 49649
198 Ga0501033_0002698 3300049570 Bacteria 14883
199 Ga0501034_0000108 3300049571 Bacteria 152258
200 Ga0501034_0000790 3300049571 Bacteria 47085
201 Ga0501034_0012201 3300049571 Bacteria 8887
202 Ga0501036_0000065 3300049572 Bacteria 68031
203 Ga0501036_0000203 3300049572 Bacteria 39418
204 Ga0501036_0058915 3300049572 Bacteria 3254
205 Ga0501037_0000109 3300049573 Bacteria 77490
206 Ga0501037_0000173 3300049573 Bacteria 61084
207 Ga0501038_0000028 3300049574 Bacteria 144481
208 Ga0501038_0000076 3300049574 Bacteria 81908
209 Ga0501039_0000005 3300049575 Bacteria 295471
210 Ga0501039_0006739 3300049575 Bacteria 8740
211 Ga0501043_0000122 3300049579 Bacteria 71952
212 Ga0501043_0000459 3300049579 Bacteria 36316
213 Ga0501043_0028558 3300049579 Bacteria 4379
214 Ga0501046_0000032 3300049580 Bacteria 180265
215 Ga0501046_0000744 3300049580 Bacteria 31562
216 Ga0501047_0000543 3300049581 Bacteria 40726
217 Ga0501047_0001887 3300049581 Bacteria 20141
218 Ga0501047_0020822 3300049581 Bacteria 6300
219 Ga0501047_0084367 3300049581 Bacteria 3053
220 Ga0501048_0000271 3300049582 Bacteria 34755
221 Ga0501048_0002235 3300049582 Bacteria 14749
222 Ga0501067_0000176 3300049583 Bacteria 35984
223 Ga0501067_0001783 3300049583 Bacteria 11827
224 Ga0501068_0000517 3300049584 Bacteria 19556
225 Ga0501069_0006051 3300049585 Bacteria 6318
226 Ga0501069_0013561 3300049585 Bacteria 4346
227 Ga0501070_0000152 3300049586 Bacteria 63679
228 Ga0501070_0026936 3300049586 Bacteria 4820
229 Ga0501070_0027625 3300049586 Bacteria 4760
230 Ga0501070_0070730 3300049586 Bacteria 2889
231 Ga0501070_0159991 3300049586 Bacteria 1857
232 Ga0501072_0014497 3300049588 Bacteria 6041
233 Ga0501072_0131675 3300049588 Bacteria 1993
234 Ga0501073_0000058 3300049589 Bacteria 70421
235 Ga0501073_0001066 3300049589 Bacteria 19810
236 Ga0501073_0041047 3300049589 Bacteria 3270
237 Ga0501074_0005950 3300049590 Bacteria 8797
238 Ga0501074_0048452 3300049590 Bacteria 3069
239 Ga0501080_0000104 3300049742 Bacteria 57865
240 Ga0501080_0002986 3300049742 Bacteria 14898
241 Ga0501080_0003379 3300049742 Bacteria 14071
242 Ga0501080_0024886 3300049742 Bacteria 5552
243 Ga0501035_0000016 3300049822 Bacteria 243412
244 Ga0501035_0000079 3300049822 Bacteria 118194
245 Ga0501044_0000085 3300049823 Bacteria 114339
246 Ga0501044_0000657 3300049823 Bacteria 41841
247 Ga0501044_0120443 3300049823 Bacteria 2626
248 nmdc:mga06z11_14578_c1 3300050494 Bacteria 3486
249 nmdc:mga05p37_201_c1 3300050507 Bacteria 59705
250 nmdc:mga05p37_63610_c1 3300050507 Bacteria 4541
251 nmdc:mga09592_1332_c1 3300050508 Bacteria 19780
252 nmdc:mga06r32_112967_c1 3300050510 Bacteria 2673
253 nmdc:mga06r32_11479_c1 3300050510 Bacteria 7979
254 nmdc:mga06r32_208664_c1 3300050510 Bacteria 1941
255 nmdc:mga06r32_7358_c1 3300050510 Bacteria 9909
256 Ga0500566_0000227 3300053094 Bacteria 30040
257 Ga0500572_000023 3300053111 Bacteria 47431
258 Ga0500572_001565 3300053111 Bacteria 6111
259 Ga0500595_001362 3300053119 Bacteria 13149
260 Ga0500595_001888 3300053119 Bacteria 10797
261 Ga0500595_009136 3300053119 Bacteria 4016
262 Ga0500642_0048502 3300053130 Bacteria 1866
263 Ga0500559_0001416 3300053136 Bacteria 13619
264 Ga0500603_000274 3300053150 Bacteria 13673
265 Ga0500630_000387 3300053159 Bacteria 18759
266 Ga0500639_000022 3300053163 Bacteria 87814
267 Ga0500639_035382 3300053163 Bacteria 2637
268 Ga0500636_0023813 3300053177 Bacteria 3620
269 Ga0500596_001209 3300053735 Bacteria 5215
270 Ga0500596_001335 3300053735 Bacteria 4972
271 Ga0500601_001119 3300053737 Bacteria 3034
272 Ga0501084_0026023 3300054114 Bacteria 4880
273 Ga0501082_0039902 3300060353 Bacteria 4050

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025253 Ga0209677_103344 Ga0209677_1033444 471
2 3300006186 Ga0075369_10042423 Ga0075369_100424232 500
3 3300049581 Ga0501047_0020822 Ga0501047_0020822_903_2408 501
4 3300005458 Ga0070681_10001413 Ga0070681_100014139 509
5 3300005563 Ga0068855_100073293 Ga0068855_1000732932 509
6 3300026078 Ga0207702_10041597 Ga0207702_100415972 509
7 3300026116 Ga0207674_10070625 Ga0207674_100706252 509
8 3300035090 Ga0373949_0002196 Ga0373949_0002196_63_1610 513
9 3300035242 Ga0373962_0001670 Ga0373962_0001670_840_2387 513
10 3300013307 Ga0157372_10059404 Ga0157372_100594042 514
11 3300053177 Ga0500636_0023813 Ga0500636_0023813_1923_3518 518
12 3300045976 Ga0466967_0154630 Ga0466967_0154630_524_2119 520
13 3300048929 Ga0496126_0008408 Ga0496126_0008408_4163_5758 520
14 3300048908 Ga0496105_0075126 Ga0496105_0075126_689_2293 522
15 3300005331 Ga0070670_100018584 Ga0070670_1000185843 523
16 3300005331 Ga0070670_100006753 Ga0070670_1000067535 524
17 3300025925 Ga0207650_10033376 Ga0207650_100333762 524
18 3300005456 Ga0070678_100011753 Ga0070678_1000117533 525
19 3300005471 Ga0070698_100085546 Ga0070698_1000855463 525
20 3300005617 Ga0068859_100006107 Ga0068859_1000061072 525
21 3300006931 Ga0097620_100006104 Ga0097620_10000610411 525
22 3300009148 Ga0105243_10046520 Ga0105243_100465202 525
23 3300050507 nmdc:mga05p37_63610_c1 nmdc:mga05p37_63610_c1_2561_4156 525
24 3300050508 nmdc:mga09592_1332_c1 nmdc:mga09592_1332_c1_7613_9208 525
25 3300050510 nmdc:mga06r32_11479_c1 nmdc:mga06r32_11479_c1_63_1658 525
26 3300050510 nmdc:mga06r32_208664_c1 nmdc:mga06r32_208664_c1_137_1720 525
27 iso_pu_bacteria 2935908558 2935912493 526
28 iso_pu_bacteria 2935916978 2935921672 526
29 iso_pu_bacteria 2935926038 2935929618 526
30 iso_pu_bacteria 2935934488 2935938850 526
31 iso_pu_bacteria 2935942939 2935948315 526
32 iso_pu_bacteria 2935951376 2935955039 526
33 iso_pu_bacteria 2935967501 2935971927 526
34 iso_pu_bacteria 8019687851 8019693839 526
35 3300006844 Ga0075428_100018652 Ga0075428_1000186523 527
36 3300006847 Ga0075431_100019118 Ga0075431_1000191182 527
37 3300006880 Ga0075429_100000922 Ga0075429_1000009229 527
38 iso_pu_bacteria 2507262055 2507510500 527
39 iso_pu_bacteria 2513237096 2513658631 527
40 iso_pu_bacteria 2513237137 2513859836 527
41 iso_pu_bacteria 2513237145 2513920805 527
42 iso_pu_bacteria 2517572143 2517895032 527
43 iso_pu_bacteria 2617270735 2617347270 527
44 iso_pu_bacteria 2728368998 2728749470 527
45 iso_pu_bacteria 2824600985 2824604099 527
46 iso_pu_bacteria 2824609381 2824610368 527
47 iso_pu_bacteria 2824653114 2824654112 527
48 iso_pu_bacteria 2838122688 2838122822 527
49 iso_pu_bacteria 2841941048 2841946870 527
50 iso_pu_bacteria 2841949485 2841950914 527
51 iso_pu_bacteria 2841983080 2841988890 527
52 iso_pu_bacteria 2842038055 2842038823 527
53 iso_pu_bacteria 2842045827 2842048232 527
54 iso_pu_bacteria 2849076700 2849077990 527
55 iso_pu_bacteria 2874620515 2874627594 527
56 iso_pu_bacteria 2874628541 2874631559 527
57 iso_pu_bacteria 2881364244 2881366110 527
58 iso_pu_bacteria 2888419890 2888425029 527
59 iso_pu_bacteria 2904666416 2904673086 527
60 iso_pu_bacteria 2906635258 2906639689 527
61 iso_pu_bacteria 2906643746 2906645093 527
62 iso_pu_bacteria 2906660503 2906660568 527
63 iso_pu_bacteria 2935648319 2935652576 527
64 iso_pu_bacteria 2935656913 2935661158 527
65 iso_pu_bacteria 2936011229 2936015215 527
66 iso_pu_bacteria 2936019824 2936023360 527
67 iso_pu_bacteria 2936028420 2936032187 527
68 iso_pu_bacteria 2936046547 2936050048 527
69 iso_pu_bacteria 2936055302 2936061850 527
70 iso_pu_bacteria 8056681323 8056685593 527
71 3300005937 Ga0081455_10000062 Ga0081455_1000006236 529
72 3300049586 Ga0501070_0159991 Ga0501070_0159991_255_1844 529
73 3300003320 rootH2_10020844 rootH2_100208442 530
74 3300003323 rootH1_10082096 rootH1_100820963 530
75 3300003659 JGI25404J52841_10000476 JGI25404J52841_100004765 530
76 3300005983 Ga0081540_1000862 Ga0081540_10008622 530
77 3300006844 Ga0075428_100020453 Ga0075428_1000204536 530
78 3300006847 Ga0075431_100006362 Ga0075431_1000063626 530
79 3300006880 Ga0075429_100009907 Ga0075429_1000099072 530
80 3300009147 Ga0114129_10005286 Ga0114129_100052866 530
81 3300025272 Ga0209455_1002178 Ga0209455_10021783 530
82 3300027876 Ga0209974_10001017 Ga0209974_100010177 530
83 3300050507 nmdc:mga05p37_201_c1 nmdc:mga05p37_201_c1_12594_14192 530
84 3300050510 nmdc:mga06r32_7358_c1 nmdc:mga06r32_7358_c1_4272_5870 530
85 iso_pu_bacteria 2643221651 2644289113 530
86 iso_pu_bacteria 2858950400 2858951534 530
87 3300003203 JGI25406J46586_10000060 JGI25406J46586_100000607 531
88 3300005327 Ga0070658_10035940 Ga0070658_100359402 531
89 3300005329 Ga0070683_100008289 Ga0070683_1000082897 531
90 3300005344 Ga0070661_100049517 Ga0070661_1000495172 531
91 3300005344 Ga0070661_100053856 Ga0070661_1000538562 531
92 3300005344 Ga0070661_100083594 Ga0070661_1000835942 531
93 3300005347 Ga0070668_100009888 Ga0070668_1000098884 531
94 3300005353 Ga0070669_100110184 Ga0070669_1001101842 531
95 3300005366 Ga0070659_100012332 Ga0070659_1000123322 531
96 3300005434 Ga0070709_10002208 Ga0070709_100022087 531
97 3300005435 Ga0070714_100002040 Ga0070714_1000020408 531
98 3300005435 Ga0070714_100025364 Ga0070714_1000253642 531
99 3300005436 Ga0070713_100002893 Ga0070713_1000028934 531
100 3300005436 Ga0070713_100007608 Ga0070713_1000076084 531
101 3300005436 Ga0070713_100022365 Ga0070713_1000223654 531
102 3300005437 Ga0070710_10000650 Ga0070710_1000065016 531
103 3300005437 Ga0070710_10076668 Ga0070710_100766681 531
104 3300005439 Ga0070711_100002615 Ga0070711_1000026159 531
105 3300005455 Ga0070663_100041684 Ga0070663_1000416843 531
106 3300005458 Ga0070681_10001542 Ga0070681_1000154214 531
107 3300005459 Ga0068867_100055975 Ga0068867_1000559752 531
108 3300005471 Ga0070698_100023633 Ga0070698_1000236336 531
109 3300005539 Ga0068853_100022991 Ga0068853_1000229912 531
110 3300005539 Ga0068853_100109891 Ga0068853_1001098912 531
111 3300005547 Ga0070693_100036415 Ga0070693_1000364153 531
112 3300005563 Ga0068855_100266866 Ga0068855_1002668661 531
113 3300005564 Ga0070664_100020902 Ga0070664_1000209023 531
114 3300005578 Ga0068854_100055938 Ga0068854_1000559382 531
115 3300005614 Ga0068856_100021750 Ga0068856_1000217505 531
116 3300005616 Ga0068852_100000371 Ga0068852_10000037117 531
117 3300005616 Ga0068852_100037389 Ga0068852_1000373894 531
118 3300005618 Ga0068864_100022080 Ga0068864_1000220804 531
119 3300005719 Ga0068861_100019659 Ga0068861_1000196594 531
120 3300005834 Ga0068851_10027267 Ga0068851_100272672 531
121 3300005843 Ga0068860_100000289 Ga0068860_1000002899 531
122 3300005983 Ga0081540_1022473 Ga0081540_10224732 531
123 3300005985 Ga0081539_10000003 Ga0081539_10000003279 531
124 3300006028 Ga0070717_10155683 Ga0070717_101556832 531
125 3300006038 Ga0075365_10033796 Ga0075365_100337962 531
126 3300006175 Ga0070712_100001472 Ga0070712_1000014728 531
127 3300006175 Ga0070712_100011985 Ga0070712_1000119854 531
128 3300006178 Ga0075367_10001332 Ga0075367_100013329 531
129 3300006358 Ga0068871_100031425 Ga0068871_1000314251 531
130 3300006844 Ga0075428_100262139 Ga0075428_1002621391 531
131 3300006847 Ga0075431_100061347 Ga0075431_1000613472 531
132 3300006942 Ga0099824_1021223 Ga0099824_10212232 531
133 3300006943 Ga0099822_1002451 Ga0099822_100245118 531
134 3300006944 Ga0099823_1000008 Ga0099823_100000826 531
135 3300007788 Ga0099795_10015236 Ga0099795_100152362 531
136 3300009093 Ga0105240_10003803 Ga0105240_1000380314 531
137 3300009101 Ga0105247_10068655 Ga0105247_100686551 531
138 3300009148 Ga0105243_10038453 Ga0105243_100384532 531
139 3300009174 Ga0105241_10035230 Ga0105241_100352303 531
140 3300009174 Ga0105241_10081972 Ga0105241_100819722 531
141 3300009545 Ga0105237_10032643 Ga0105237_100326434 531
142 3300009545 Ga0105237_10148929 Ga0105237_101489293 531
143 3300009551 Ga0105238_10000556 Ga0105238_1000055625 531
144 3300009553 Ga0105249_10027163 Ga0105249_100271633 531
145 3300010375 Ga0105239_10191322 Ga0105239_101913222 531
146 3300011119 Ga0105246_10037493 Ga0105246_100374932 531
147 3300013100 Ga0157373_10028652 Ga0157373_100286523 531
148 3300013102 Ga0157371_10047983 Ga0157371_100479832 531
149 3300013104 Ga0157370_10005227 Ga0157370_1000522718 531
150 3300013104 Ga0157370_10023145 Ga0157370_100231451 531
151 3300013104 Ga0157370_10077152 Ga0157370_100771523 531
152 3300013104 Ga0157370_10141221 Ga0157370_101412212 531
153 3300013105 Ga0157369_10005626 Ga0157369_100056263 531
154 3300013296 Ga0157374_10077215 Ga0157374_100772153 531
155 3300013307 Ga0157372_10007555 Ga0157372_100075554 531
156 3300013307 Ga0157372_10009605 Ga0157372_100096056 531
157 3300013307 Ga0157372_10235660 Ga0157372_102356602 531
158 3300014325 Ga0163163_10002739 Ga0163163_100027397 531
159 3300014326 Ga0157380_10028619 Ga0157380_100286193 531
160 3300014326 Ga0157380_10063531 Ga0157380_100635312 531
161 3300014969 Ga0157376_10093759 Ga0157376_100937592 531
162 3300017792 Ga0163161_10033327 Ga0163161_100333272 531
163 3300021384 Ga0213876_10001443 Ga0213876_100014438 531
164 3300025297 Ga0209758_1000838 Ga0209758_100083813 531
165 3300025898 Ga0207692_10002847 Ga0207692_100028479 531
166 3300025906 Ga0207699_10001240 Ga0207699_100012407 531
167 3300025906 Ga0207699_10013006 Ga0207699_100130063 531
168 3300025911 Ga0207654_10011066 Ga0207654_100110661 531
169 3300025912 Ga0207707_10015206 Ga0207707_100152062 531
170 3300025912 Ga0207707_10050260 Ga0207707_100502602 531
171 3300025912 Ga0207707_10055662 Ga0207707_100556622 531
172 3300025914 Ga0207671_10074465 Ga0207671_100744652 531
173 3300025915 Ga0207693_10003335 Ga0207693_1000333514 531
174 3300025915 Ga0207693_10020057 Ga0207693_100200571 531
175 3300025919 Ga0207657_10001312 Ga0207657_100013128 531
176 3300025919 Ga0207657_10001491 Ga0207657_1000149114 531
177 3300025920 Ga0207649_10052228 Ga0207649_100522282 531
178 3300025920 Ga0207649_10064829 Ga0207649_100648291 531
179 3300025924 Ga0207694_10006006 Ga0207694_100060068 531
180 3300025928 Ga0207700_10005496 Ga0207700_100054966 531
181 3300025928 Ga0207700_10023639 Ga0207700_100236393 531
182 3300025928 Ga0207700_10053279 Ga0207700_100532792 531
183 3300025933 Ga0207706_10004262 Ga0207706_1000426211 531
184 3300025942 Ga0207689_10004916 Ga0207689_1000491611 531
185 3300025972 Ga0207668_10026654 Ga0207668_100266543 531
186 3300026041 Ga0207639_10198888 Ga0207639_101988881 531
187 3300026067 Ga0207678_10005947 Ga0207678_100059476 531
188 3300026078 Ga0207702_10114789 Ga0207702_101147892 531
189 3300026088 Ga0207641_10081993 Ga0207641_100819932 531
190 3300026116 Ga0207674_10005327 Ga0207674_100053278 531
191 3300026118 Ga0207675_100007890 Ga0207675_10000789010 531
192 3300026118 Ga0207675_100008391 Ga0207675_1000083918 531
193 3300026142 Ga0207698_10001704 Ga0207698_100017042 531
194 3300027296 Ga0209389_1000032 Ga0209389_100003287 531
195 3300027357 Ga0209589_1000001 Ga0209589_1000001600 531
196 3300027361 Ga0209489_100001 Ga0209489_100001600 531
197 3300027361 Ga0209489_100035 Ga0209489_10003592 531
198 3300027363 Ga0209700_100001 Ga0209700_100001600 531
199 3300027363 Ga0209700_100005 Ga0209700_10000595 531
200 3300028380 Ga0268265_10122791 Ga0268265_101227912 531
201 3300028381 Ga0268264_10000065 Ga0268264_1000006559 531
202 3300028381 Ga0268264_10224921 Ga0268264_102249211 531
203 3300031852 Ga0307410_10000909 Ga0307410_100009094 531
204 3300031901 Ga0307406_10003664 Ga0307406_100036642 531
205 3300031901 Ga0307406_10134058 Ga0307406_101340581 531
206 3300031903 Ga0307407_10002869 Ga0307407_100028695 531
207 3300031911 Ga0307412_10009500 Ga0307412_100095003 531
208 3300031995 Ga0307409_100005569 Ga0307409_1000055696 531
209 3300032002 Ga0307416_100041775 Ga0307416_1000417753 531
210 3300033442 Ga0315911_1000007 Ga0315911_1000007290 531
211 3300035113 Ga0373936_0011351 Ga0373936_0011351_1539_3140 531
212 3300037418 Ga0395900_0001627 Ga0395900_0001627_23855_25450 531
213 3300037466 Ga0395898_0089028 Ga0395898_0089028_1024_2619 531
214 3300038443 Ga0395901_0002678 Ga0395901_0002678_15328_16923 531
215 3300038443 Ga0395901_0024265 Ga0395901_0024265_4352_5998 531
216 3300039437 Ga0436365_1095754 Ga0436365_1095754_14575_16179 531
217 3300039453 Ga0436362_0811936 Ga0436362_0811936_7121_8722 531
218 3300045976 Ga0466967_0018209 Ga0466967_0018209_2677_4275 531
219 3300045976 Ga0466967_0084705 Ga0466967_0084705_1070_2665 531
220 3300048905 Ga0496102_0118809 Ga0496102_0118809_25_1620 531
221 3300048907 Ga0496104_0001601 Ga0496104_0001601_2714_4357 531
222 3300048907 Ga0496104_0002148 Ga0496104_0002148_10744_12375 531
223 3300048907 Ga0496104_0072073 Ga0496104_0072073_1271_2866 531
224 3300048908 Ga0496105_0000763 Ga0496105_0000763_12075_13718 531
225 3300048911 Ga0496108_0001146 Ga0496108_0001146_14473_16116 531
226 3300048911 Ga0496108_0147882 Ga0496108_0147882_365_1975 531
227 3300048912 Ga0496109_0000698 Ga0496109_0000698_9463_11106 531
228 3300048912 Ga0496109_0096073 Ga0496109_0096073_599_2209 531
229 3300048913 Ga0496110_0002949 Ga0496110_0002949_8408_10051 531
230 3300048913 Ga0496110_0092873 Ga0496110_0092873_759_2354 531
231 3300048914 Ga0496111_0002486 Ga0496111_0002486_5032_6675 531
232 3300048915 Ga0496112_0003373 Ga0496112_0003373_6905_8548 531
233 3300048915 Ga0496112_0006407 Ga0496112_0006407_3881_5491 531
234 3300048915 Ga0496112_0135726 Ga0496112_0135726_48_1643 531
235 3300048916 Ga0496113_0003929 Ga0496113_0003929_2841_4484 531
236 3300048920 Ga0496117_0018182 Ga0496117_0018182_2053_3669 531
237 3300048920 Ga0496117_0024082 Ga0496117_0024082_2096_3700 531
238 3300048921 Ga0496118_0013173 Ga0496118_0013173_1044_2660 531
239 3300048924 Ga0496121_0000285 Ga0496121_0000285_32937_34532 531
240 3300048924 Ga0496121_0018022 Ga0496121_0018022_2165_3781 531
241 3300048924 Ga0496121_0051030 Ga0496121_0051030_298_1902 531
242 3300048924 Ga0496121_0071445 Ga0496121_0071445_854_2449 531
243 3300048929 Ga0496126_0050365 Ga0496126_0050365_750_2354 531
244 3300048929 Ga0496126_0091295 Ga0496126_0091295_70_1665 531
245 3300049568 Ga0501031_0000106 Ga0501031_0000106_24532_26127 531
246 3300049568 Ga0501031_0000160 Ga0501031_0000160_16163_17776 531
247 3300049569 Ga0501032_0000068 Ga0501032_0000068_56417_58030 531
248 3300049569 Ga0501032_0000086 Ga0501032_0000086_48047_49642 531
249 3300049570 Ga0501033_0000274 Ga0501033_0000274_32887_34500 531
250 3300049570 Ga0501033_0002698 Ga0501033_0002698_5625_7220 531
251 3300049571 Ga0501034_0000108 Ga0501034_0000108_14646_16241 531
252 3300049571 Ga0501034_0000790 Ga0501034_0000790_14706_16319 531
253 3300049571 Ga0501034_0012201 Ga0501034_0012201_1267_2883 531
254 3300049572 Ga0501036_0000065 Ga0501036_0000065_2857_4452 531
255 3300049572 Ga0501036_0000203 Ga0501036_0000203_31487_33100 531
256 3300049572 Ga0501036_0058915 Ga0501036_0058915_1320_2921 531
257 3300049573 Ga0501037_0000109 Ga0501037_0000109_32742_34355 531
258 3300049573 Ga0501037_0000173 Ga0501037_0000173_53183_54778 531
259 3300049574 Ga0501038_0000028 Ga0501038_0000028_106556_108169 531
260 3300049574 Ga0501038_0000076 Ga0501038_0000076_59178_60773 531
261 3300049575 Ga0501039_0000005 Ga0501039_0000005_258269_259882 531
262 3300049575 Ga0501039_0006739 Ga0501039_0006739_1982_3577 531
263 3300049579 Ga0501043_0000122 Ga0501043_0000122_38757_40370 531
264 3300049579 Ga0501043_0000459 Ga0501043_0000459_24369_25964 531
265 3300049579 Ga0501043_0028558 Ga0501043_0028558_2233_3834 531
266 3300049580 Ga0501046_0000032 Ga0501046_0000032_35142_36755 531
267 3300049580 Ga0501046_0000744 Ga0501046_0000744_12735_14330 531
268 3300049581 Ga0501047_0000543 Ga0501047_0000543_32918_34531 531
269 3300049581 Ga0501047_0001887 Ga0501047_0001887_8041_9636 531
270 3300049581 Ga0501047_0084367 Ga0501047_0084367_301_1917 531
271 3300049582 Ga0501048_0000271 Ga0501048_0000271_28804_30399 531
272 3300049582 Ga0501048_0002235 Ga0501048_0002235_2597_4210 531
273 3300049583 Ga0501067_0000176 Ga0501067_0000176_29334_30929 531
274 3300049583 Ga0501067_0001783 Ga0501067_0001783_8571_10184 531
275 3300049584 Ga0501068_0000517 Ga0501068_0000517_9233_10846 531
276 3300049585 Ga0501069_0006051 Ga0501069_0006051_2784_4379 531
277 3300049585 Ga0501069_0013561 Ga0501069_0013561_1413_3026 531
278 3300049586 Ga0501070_0000152 Ga0501070_0000152_31830_33443 531
279 3300049586 Ga0501070_0026936 Ga0501070_0026936_569_2164 531
280 3300049586 Ga0501070_0027625 Ga0501070_0027625_1597_3207 531
281 3300049586 Ga0501070_0070730 Ga0501070_0070730_308_1987 531
282 3300049588 Ga0501072_0014497 Ga0501072_0014497_3106_4701 531
283 3300049588 Ga0501072_0131675 Ga0501072_0131675_158_1771 531
284 3300049589 Ga0501073_0000058 Ga0501073_0000058_44458_46053 531
285 3300049589 Ga0501073_0001066 Ga0501073_0001066_14505_16118 531
286 3300049589 Ga0501073_0041047 Ga0501073_0041047_130_1746 531
287 3300049590 Ga0501074_0005950 Ga0501074_0005950_296_1891 531
288 3300049590 Ga0501074_0048452 Ga0501074_0048452_603_2198 531
289 3300049742 Ga0501080_0000104 Ga0501080_0000104_40496_42109 531
290 3300049742 Ga0501080_0002986 Ga0501080_0002986_6121_7716 531
291 3300049742 Ga0501080_0003379 Ga0501080_0003379_2513_4129 531
292 3300049742 Ga0501080_0024886 Ga0501080_0024886_2243_3838 531
293 3300049822 Ga0501035_0000016 Ga0501035_0000016_200252_201865 531
294 3300049822 Ga0501035_0000079 Ga0501035_0000079_13428_15023 531
295 3300049823 Ga0501044_0000085 Ga0501044_0000085_105343_106938 531
296 3300049823 Ga0501044_0000657 Ga0501044_0000657_35831_37444 531
297 3300049823 Ga0501044_0120443 Ga0501044_0120443_889_2499 531
298 3300050494 nmdc:mga06z11_14578_c1 nmdc:mga06z11_14578_c1_990_2606 531
299 3300050510 nmdc:mga06r32_112967_c1 nmdc:mga06r32_112967_c1_285_1904 531
300 3300053094 Ga0500566_0000227 Ga0500566_0000227_2125_3726 531
301 3300053111 Ga0500572_000023 Ga0500572_000023_23006_24649 531
302 3300053111 Ga0500572_001565 Ga0500572_001565_2349_3950 531
303 3300053119 Ga0500595_001362 Ga0500595_001362_6630_8225 531
304 3300053119 Ga0500595_001888 Ga0500595_001888_5026_6630 531
305 3300053119 Ga0500595_009136 Ga0500595_009136_659_2257 531
306 3300053130 Ga0500642_0048502 Ga0500642_0048502_179_1777 531
307 3300053136 Ga0500559_0001416 Ga0500559_0001416_2316_3959 531
308 3300053150 Ga0500603_000274 Ga0500603_000274_5540_7141 531
309 3300053159 Ga0500630_000387 Ga0500630_000387_15020_16621 531
310 3300053163 Ga0500639_000022 Ga0500639_000022_39507_41108 531
311 3300053163 Ga0500639_035382 Ga0500639_035382_911_2542 531
312 3300053735 Ga0500596_001209 Ga0500596_001209_2015_3616 531
313 3300053735 Ga0500596_001335 Ga0500596_001335_92_1735 531
314 3300053737 Ga0500601_001119 Ga0500601_001119_556_2157 531
315 3300054114 Ga0501084_0026023 Ga0501084_0026023_2010_3605 531
316 3300060353 Ga0501082_0039902 Ga0501082_0039902_1082_2677 531

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00732

GMC_oxred_N

GMC oxidoreductase

38

329

0.98

PF05199

GMC_oxred_C

GMC oxidoreductase

421

554

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r36-assembly1.cif.gz_A difference-refined structure of fatty acid photodecarboxylase 2 microsecond following 400-nm laser irradiation of the dark-state determined by sfx 0.9506 3 530
6yrz-assembly1.cif.gz_AAA crystal structure of fap et ph 8.5 after illumination at 150k 0.95 2 530
6yru-assembly1.cif.gz_AAA crystal structure of fap in the dark at 100k 0.9492 2 530
6ys1-assembly1.cif.gz_AAA crystal structure of fap r451k mutant in the dark at 100k 0.9481 2 530
6yrx-assembly1.cif.gz_AAA low-dose crystal structure of fap at room temperature 0.9469 2 530
ID Description Score Start End Superfamily
af_Q6UPE0_47_576_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9628 8 528 3.50.50.60
af_P17444_4_531_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9586 7 527 3.50.50.60
af_Q2FV11_9_533_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9477 7 525 3.50.50.60
af_P9WMV5_6_524_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9468 7 526 3.40.50.2000
af_Q6UPE0_47_576_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.945 8 528 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1S8YTK6-F1-model_v4 Choline dehydrogenase 0.99 6 530 GO:0016614
GO:0050660
AF-A0A2G4J7R9-F1-model_v4 Choline dehydrogenase 0.9888 6 530 GO:0016614
GO:0050660
AF-A0A351NU01-F1-model_v4 Choline dehydrogenase 0.9848 95 530 GO:0016614
GO:0050660
AF-A0A537T8Z9-F1-model_v4 Choline dehydrogenase 0.9824 6 294 GO:0016614
GO:0050660
AF-A0A2W4NRR9-F1-model_v4 deleted 0.9817 6 263

Feature Viewer

pLDDT pTM Quality
92.39 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map