F403589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 213 | 273 | 533 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100000289|Ga0068860_1000002899 |
| Length | 563 |
| Sequence | MVALIREFGLAIGPSLWSIELSRTTTSRGTPCMVARGYDYIIVGAGSAGCVLANRLSANPSCRVLLLEAGGPDRGFWLRLPVGYYRTIFNARFSRQFVTEPEETTGGRAIVWPRGRVLGGSSSINGLIFIRGQQEGFDDWERVGATGWNYRDLLPYFRRTERYRGGESHXXXXRGEFDVSDLRTGNPASAAWVEAGVEFGLPRNPDFNGATTLGVGPYQLGIGRHWRSSSASAFLHPVARRPNLTIVTGAQVSKVQFKGTVACGVQWIRNGTVFGAVADAEVVLSAGALQSPQLLQLSGIGPAGLLRELGIPVIVDAPEVGLNLQDHYQARMIVRLKQPISLNDQVRNPVELAKMGLQWALAGRGPLTAGAGQVGGAACTAYAVGGRPDIQFNVMPLSVDKPGDPLHRYSGFTASVWQCHGTSRGHLAIRSTDPFDQPRIVPNYFAEDIDRKTIVAGLKMLRDIYRQKSFRDLWDIEMAPGEAAADSAALWDFARTTGGTVFHCVGTCRMGDDDRSVLDPQLRVRGVKRLRVVDASVMPLITSANTNATSLMIGERGAALIMS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 9 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 10 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 11 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 12 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 13 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 14 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 15 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 16 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 17 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 18 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 19 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 20 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 21 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 22 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 23 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 24 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 25 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 26 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 27 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 28 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 29 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 30 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 31 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 32 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 33 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 34 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 35 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 36 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 37 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 38 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 39 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 40 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 41 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 44 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 45 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 90 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 141 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 151 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 200 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 201 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 202 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 203 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 204 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 205 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 206 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 207 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 209 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 210 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 213 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.39 |
| Metatranscriptomes | 0 |
| Isolates | 13.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.28 |
| Nodule | 12.66 |
| Rhizoplane | 5.38 |
| Rhizosphere | 66.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000060 | 3300003203 | Bacteria | 50068 |
| 2 | rootH2_10020844 | 3300003320 | Bacteria | 4418 |
| 3 | rootH1_10082096 | 3300003323 | Bacteria | 8605 |
| 4 | JGI25404J52841_10000476 | 3300003659 | Bacteria | 5765 |
| 5 | Ga0070658_10035940 | 3300005327 | Bacteria | 3992 |
| 6 | Ga0070683_100008289 | 3300005329 | Bacteria | 8831 |
| 7 | Ga0070670_100006753 | 3300005331 | Bacteria | 9725 |
| 8 | Ga0070670_100018584 | 3300005331 | Bacteria | 5957 |
| 9 | Ga0070661_100049517 | 3300005344 | Bacteria | 3076 |
| 10 | Ga0070661_100053856 | 3300005344 | Bacteria | 2946 |
| 11 | Ga0070661_100083594 | 3300005344 | Bacteria | 2358 |
| 12 | Ga0070668_100009888 | 3300005347 | Bacteria | 7064 |
| 13 | Ga0070669_100110184 | 3300005353 | Bacteria | 2088 |
| 14 | Ga0070659_100012332 | 3300005366 | Bacteria | 6333 |
| 15 | Ga0070709_10002208 | 3300005434 | Bacteria | 10539 |
| 16 | Ga0070714_100002040 | 3300005435 | Bacteria | 14795 |
| 17 | Ga0070714_100025364 | 3300005435 | Bacteria | 4892 |
| 18 | Ga0070713_100002893 | 3300005436 | Bacteria | 11231 |
| 19 | Ga0070713_100007608 | 3300005436 | Bacteria | 7621 |
| 20 | Ga0070713_100022365 | 3300005436 | Bacteria | 4886 |
| 21 | Ga0070710_10000650 | 3300005437 | Bacteria | 16572 |
| 22 | Ga0070710_10076668 | 3300005437 | Bacteria | 1941 |
| 23 | Ga0070711_100002615 | 3300005439 | Bacteria | 10302 |
| 24 | Ga0070663_100041684 | 3300005455 | Bacteria | 3222 |
| 25 | Ga0070678_100011753 | 3300005456 | Bacteria | 5415 |
| 26 | Ga0070681_10001413 | 3300005458 | Bacteria | 21075 |
| 27 | Ga0070681_10001542 | 3300005458 | Bacteria | 20408 |
| 28 | Ga0068867_100055975 | 3300005459 | Bacteria | 2917 |
| 29 | Ga0070698_100023633 | 3300005471 | Bacteria | 6423 |
| 30 | Ga0070698_100085546 | 3300005471 | Bacteria | 3140 |
| 31 | Ga0068853_100022991 | 3300005539 | Bacteria | 5214 |
| 32 | Ga0068853_100109891 | 3300005539 | Bacteria | 2448 |
| 33 | Ga0070693_100036415 | 3300005547 | Bacteria | 2735 |
| 34 | Ga0068855_100073293 | 3300005563 | Bacteria | 3979 |
| 35 | Ga0068855_100266866 | 3300005563 | Bacteria | 1905 |
| 36 | Ga0070664_100020902 | 3300005564 | Bacteria | 5393 |
| 37 | Ga0068854_100055938 | 3300005578 | Bacteria | 2842 |
| 38 | Ga0068856_100021750 | 3300005614 | Bacteria | 6233 |
| 39 | Ga0068852_100000371 | 3300005616 | Bacteria | 30327 |
| 40 | Ga0068852_100037389 | 3300005616 | Bacteria | 4069 |
| 41 | Ga0068859_100006107 | 3300005617 | Bacteria | 12235 |
| 42 | Ga0068864_100022080 | 3300005618 | Bacteria | 5335 |
| 43 | Ga0068861_100019659 | 3300005719 | Bacteria | 4825 |
| 44 | Ga0068851_10027267 | 3300005834 | Bacteria | 2814 |
| 45 | Ga0068860_100000289 | 3300005843 | Bacteria | 71608 |
| 46 | Ga0081455_10000062 | 3300005937 | Bacteria | 115850 |
| 47 | Ga0081540_1000862 | 3300005983 | Bacteria | 27458 |
| 48 | Ga0081540_1022473 | 3300005983 | Bacteria | 3725 |
| 49 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 50 | Ga0070717_10155683 | 3300006028 | Bacteria | 1980 |
| 51 | Ga0075365_10033796 | 3300006038 | Bacteria | 3298 |
| 52 | Ga0070712_100001472 | 3300006175 | Bacteria | 14360 |
| 53 | Ga0070712_100011985 | 3300006175 | Bacteria | 5511 |
| 54 | Ga0075367_10001332 | 3300006178 | Bacteria | 10472 |
| 55 | Ga0075369_10042423 | 3300006186 | Bacteria | 1950 |
| 56 | Ga0068871_100031425 | 3300006358 | Bacteria | 4188 |
| 57 | Ga0075428_100018652 | 3300006844 | Bacteria | 7669 |
| 58 | Ga0075428_100020453 | 3300006844 | Bacteria | 7327 |
| 59 | Ga0075428_100262139 | 3300006844 | Bacteria | 1861 |
| 60 | Ga0075431_100006362 | 3300006847 | Bacteria | 11724 |
| 61 | Ga0075431_100019118 | 3300006847 | Bacteria | 6980 |
| 62 | Ga0075431_100061347 | 3300006847 | Bacteria | 3880 |
| 63 | Ga0075429_100000922 | 3300006880 | Bacteria | 23290 |
| 64 | Ga0075429_100009907 | 3300006880 | Bacteria | 8261 |
| 65 | Ga0097620_100006104 | 3300006931 | Bacteria | 12235 |
| 66 | Ga0099824_1021223 | 3300006942 | Bacteria | 4583 |
| 67 | Ga0099822_1002451 | 3300006943 | Bacteria | 23110 |
| 68 | Ga0099823_1000008 | 3300006944 | Bacteria | 105646 |
| 69 | Ga0099795_10015236 | 3300007788 | Bacteria | 2403 |
| 70 | Ga0105240_10003803 | 3300009093 | Bacteria | 23321 |
| 71 | Ga0105247_10068655 | 3300009101 | Bacteria | 2210 |
| 72 | Ga0114129_10005286 | 3300009147 | Bacteria | 18217 |
| 73 | Ga0105243_10038453 | 3300009148 | Bacteria | 3726 |
| 74 | Ga0105243_10046520 | 3300009148 | Bacteria | 3414 |
| 75 | Ga0105241_10035230 | 3300009174 | Bacteria | 3764 |
| 76 | Ga0105241_10081972 | 3300009174 | Bacteria | 2528 |
| 77 | Ga0105237_10032643 | 3300009545 | Bacteria | 5271 |
| 78 | Ga0105237_10148929 | 3300009545 | Bacteria | 2336 |
| 79 | Ga0105238_10000556 | 3300009551 | Bacteria | 39015 |
| 80 | Ga0105249_10027163 | 3300009553 | Bacteria | 5163 |
| 81 | Ga0105239_10191322 | 3300010375 | Bacteria | 2290 |
| 82 | Ga0105246_10037493 | 3300011119 | Bacteria | 3254 |
| 83 | Ga0157373_10028652 | 3300013100 | Bacteria | 4017 |
| 84 | Ga0157371_10047983 | 3300013102 | Bacteria | 3036 |
| 85 | Ga0157370_10005227 | 3300013104 | Bacteria | 14617 |
| 86 | Ga0157370_10023145 | 3300013104 | Bacteria | 6175 |
| 87 | Ga0157370_10077152 | 3300013104 | Bacteria | 3139 |
| 88 | Ga0157370_10141221 | 3300013104 | Bacteria | 2244 |
| 89 | Ga0157369_10005626 | 3300013105 | Bacteria | 14557 |
| 90 | Ga0157374_10077215 | 3300013296 | Bacteria | 3151 |
| 91 | Ga0157372_10007555 | 3300013307 | Bacteria | 11556 |
| 92 | Ga0157372_10009605 | 3300013307 | Bacteria | 10280 |
| 93 | Ga0157372_10059404 | 3300013307 | Bacteria | 4276 |
| 94 | Ga0157372_10235660 | 3300013307 | Bacteria | 2123 |
| 95 | Ga0163163_10002739 | 3300014325 | Bacteria | 14874 |
| 96 | Ga0157380_10028619 | 3300014326 | Bacteria | 4251 |
| 97 | Ga0157380_10063531 | 3300014326 | Bacteria | 2960 |
| 98 | Ga0157376_10093759 | 3300014969 | Bacteria | 2607 |
| 99 | Ga0163161_10033327 | 3300017792 | Bacteria | 3681 |
| 100 | Ga0213876_10001443 | 3300021384 | Bacteria | 14779 |
| 101 | Ga0209677_103344 | 3300025253 | Bacteria | 5277 |
| 102 | Ga0209455_1002178 | 3300025272 | Bacteria | 7774 |
| 103 | Ga0209758_1000838 | 3300025297 | Bacteria | 42919 |
| 104 | Ga0207692_10002847 | 3300025898 | Bacteria | 6687 |
| 105 | Ga0207699_10001240 | 3300025906 | Bacteria | 12128 |
| 106 | Ga0207699_10013006 | 3300025906 | Bacteria | 4245 |
| 107 | Ga0207654_10011066 | 3300025911 | Bacteria | 4592 |
| 108 | Ga0207707_10015206 | 3300025912 | Bacteria | 6701 |
| 109 | Ga0207707_10050260 | 3300025912 | Bacteria | 3632 |
| 110 | Ga0207707_10055662 | 3300025912 | Bacteria | 3441 |
| 111 | Ga0207671_10074465 | 3300025914 | Bacteria | 2538 |
| 112 | Ga0207693_10003335 | 3300025915 | Bacteria | 13737 |
| 113 | Ga0207693_10020057 | 3300025915 | Bacteria | 5317 |
| 114 | Ga0207657_10001312 | 3300025919 | Bacteria | 26386 |
| 115 | Ga0207657_10001491 | 3300025919 | Bacteria | 25043 |
| 116 | Ga0207649_10052228 | 3300025920 | Bacteria | 2535 |
| 117 | Ga0207649_10064829 | 3300025920 | Bacteria | 2311 |
| 118 | Ga0207694_10006006 | 3300025924 | Bacteria | 9294 |
| 119 | Ga0207650_10033376 | 3300025925 | Bacteria | 3727 |
| 120 | Ga0207700_10005496 | 3300025928 | Bacteria | 7600 |
| 121 | Ga0207700_10023639 | 3300025928 | Bacteria | 4243 |
| 122 | Ga0207700_10053279 | 3300025928 | Bacteria | 3030 |
| 123 | Ga0207706_10004262 | 3300025933 | Bacteria | 13461 |
| 124 | Ga0207689_10004916 | 3300025942 | Bacteria | 12036 |
| 125 | Ga0207668_10026654 | 3300025972 | Bacteria | 3755 |
| 126 | Ga0207639_10198888 | 3300026041 | Bacteria | 1717 |
| 127 | Ga0207678_10005947 | 3300026067 | Bacteria | 10864 |
| 128 | Ga0207702_10041597 | 3300026078 | Bacteria | 3854 |
| 129 | Ga0207702_10114789 | 3300026078 | Bacteria | 2400 |
| 130 | Ga0207641_10081993 | 3300026088 | Bacteria | 2802 |
| 131 | Ga0207674_10005327 | 3300026116 | Bacteria | 15304 |
| 132 | Ga0207674_10070625 | 3300026116 | Bacteria | 3511 |
| 133 | Ga0207675_100007890 | 3300026118 | Bacteria | 10039 |
| 134 | Ga0207675_100008391 | 3300026118 | Bacteria | 9742 |
| 135 | Ga0207698_10001704 | 3300026142 | Bacteria | 12816 |
| 136 | Ga0209389_1000032 | 3300027296 | Bacteria | 134064 |
| 137 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 138 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 139 | Ga0209489_100035 | 3300027361 | Bacteria | 168255 |
| 140 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 141 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 142 | Ga0209974_10001017 | 3300027876 | Bacteria | 9903 |
| 143 | Ga0268265_10122791 | 3300028380 | Bacteria | 2143 |
| 144 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 145 | Ga0268264_10224921 | 3300028381 | Bacteria | 1729 |
| 146 | Ga0307410_10000909 | 3300031852 | Bacteria | 12620 |
| 147 | Ga0307406_10003664 | 3300031901 | Bacteria | 8365 |
| 148 | Ga0307406_10134058 | 3300031901 | Bacteria | 1743 |
| 149 | Ga0307407_10002869 | 3300031903 | Bacteria | 6892 |
| 150 | Ga0307412_10009500 | 3300031911 | Bacteria | 5583 |
| 151 | Ga0307409_100005569 | 3300031995 | Bacteria | 7276 |
| 152 | Ga0307416_100041775 | 3300032002 | Bacteria | 3574 |
| 153 | Ga0315911_1000007 | 3300033442 | Bacteria | 413725 |
| 154 | Ga0373949_0002196 | 3300035090 | Bacteria | 5105 |
| 155 | Ga0373936_0011351 | 3300035113 | Bacteria | 3372 |
| 156 | Ga0373962_0001670 | 3300035242 | Bacteria | 5273 |
| 157 | Ga0395900_0001627 | 3300037418 | Bacteria | 26397 |
| 158 | Ga0395898_0089028 | 3300037466 | Bacteria | 2971 |
| 159 | Ga0395901_0002678 | 3300038443 | Bacteria | 17967 |
| 160 | Ga0395901_0024265 | 3300038443 | Bacteria | 6222 |
| 161 | Ga0436365_1095754 | 3300039437 | Bacteria | 43052 |
| 162 | Ga0436362_0811936 | 3300039453 | Bacteria | 8754 |
| 163 | Ga0466967_0018209 | 3300045976 | Bacteria | 5604 |
| 164 | Ga0466967_0084705 | 3300045976 | Bacteria | 2869 |
| 165 | Ga0466967_0154630 | 3300045976 | Bacteria | 2147 |
| 166 | Ga0496102_0118809 | 3300048905 | Bacteria | 2468 |
| 167 | Ga0496104_0001601 | 3300048907 | Bacteria | 19480 |
| 168 | Ga0496104_0002148 | 3300048907 | Bacteria | 17117 |
| 169 | Ga0496104_0072073 | 3300048907 | Bacteria | 3285 |
| 170 | Ga0496105_0000763 | 3300048908 | Bacteria | 21869 |
| 171 | Ga0496105_0075126 | 3300048908 | Bacteria | 2791 |
| 172 | Ga0496108_0001146 | 3300048911 | Bacteria | 20697 |
| 173 | Ga0496108_0147882 | 3300048911 | Bacteria | 2026 |
| 174 | Ga0496109_0000698 | 3300048912 | Bacteria | 27915 |
| 175 | Ga0496109_0096073 | 3300048912 | Bacteria | 2745 |
| 176 | Ga0496110_0002949 | 3300048913 | Bacteria | 12892 |
| 177 | Ga0496110_0092873 | 3300048913 | Bacteria | 2701 |
| 178 | Ga0496111_0002486 | 3300048914 | Bacteria | 11109 |
| 179 | Ga0496112_0003373 | 3300048915 | Bacteria | 13191 |
| 180 | Ga0496112_0006407 | 3300048915 | Bacteria | 10328 |
| 181 | Ga0496112_0135726 | 3300048915 | Bacteria | 2431 |
| 182 | Ga0496113_0003929 | 3300048916 | Bacteria | 9018 |
| 183 | Ga0496117_0018182 | 3300048920 | Bacteria | 5836 |
| 184 | Ga0496117_0024082 | 3300048920 | Bacteria | 4828 |
| 185 | Ga0496118_0013173 | 3300048921 | Bacteria | 7845 |
| 186 | Ga0496121_0000285 | 3300048924 | Bacteria | 104880 |
| 187 | Ga0496121_0018022 | 3300048924 | Bacteria | 7152 |
| 188 | Ga0496121_0051030 | 3300048924 | Bacteria | 3487 |
| 189 | Ga0496121_0071445 | 3300048924 | Bacteria | 2791 |
| 190 | Ga0496126_0008408 | 3300048929 | Bacteria | 11135 |
| 191 | Ga0496126_0050365 | 3300048929 | Bacteria | 3796 |
| 192 | Ga0496126_0091295 | 3300048929 | Bacteria | 2678 |
| 193 | Ga0501031_0000106 | 3300049568 | Bacteria | 44638 |
| 194 | Ga0501031_0000160 | 3300049568 | Bacteria | 38562 |
| 195 | Ga0501032_0000068 | 3300049569 | Bacteria | 89292 |
| 196 | Ga0501032_0000086 | 3300049569 | Bacteria | 81788 |
| 197 | Ga0501033_0000274 | 3300049570 | Bacteria | 49649 |
| 198 | Ga0501033_0002698 | 3300049570 | Bacteria | 14883 |
| 199 | Ga0501034_0000108 | 3300049571 | Bacteria | 152258 |
| 200 | Ga0501034_0000790 | 3300049571 | Bacteria | 47085 |
| 201 | Ga0501034_0012201 | 3300049571 | Bacteria | 8887 |
| 202 | Ga0501036_0000065 | 3300049572 | Bacteria | 68031 |
| 203 | Ga0501036_0000203 | 3300049572 | Bacteria | 39418 |
| 204 | Ga0501036_0058915 | 3300049572 | Bacteria | 3254 |
| 205 | Ga0501037_0000109 | 3300049573 | Bacteria | 77490 |
| 206 | Ga0501037_0000173 | 3300049573 | Bacteria | 61084 |
| 207 | Ga0501038_0000028 | 3300049574 | Bacteria | 144481 |
| 208 | Ga0501038_0000076 | 3300049574 | Bacteria | 81908 |
| 209 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 210 | Ga0501039_0006739 | 3300049575 | Bacteria | 8740 |
| 211 | Ga0501043_0000122 | 3300049579 | Bacteria | 71952 |
| 212 | Ga0501043_0000459 | 3300049579 | Bacteria | 36316 |
| 213 | Ga0501043_0028558 | 3300049579 | Bacteria | 4379 |
| 214 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 215 | Ga0501046_0000744 | 3300049580 | Bacteria | 31562 |
| 216 | Ga0501047_0000543 | 3300049581 | Bacteria | 40726 |
| 217 | Ga0501047_0001887 | 3300049581 | Bacteria | 20141 |
| 218 | Ga0501047_0020822 | 3300049581 | Bacteria | 6300 |
| 219 | Ga0501047_0084367 | 3300049581 | Bacteria | 3053 |
| 220 | Ga0501048_0000271 | 3300049582 | Bacteria | 34755 |
| 221 | Ga0501048_0002235 | 3300049582 | Bacteria | 14749 |
| 222 | Ga0501067_0000176 | 3300049583 | Bacteria | 35984 |
| 223 | Ga0501067_0001783 | 3300049583 | Bacteria | 11827 |
| 224 | Ga0501068_0000517 | 3300049584 | Bacteria | 19556 |
| 225 | Ga0501069_0006051 | 3300049585 | Bacteria | 6318 |
| 226 | Ga0501069_0013561 | 3300049585 | Bacteria | 4346 |
| 227 | Ga0501070_0000152 | 3300049586 | Bacteria | 63679 |
| 228 | Ga0501070_0026936 | 3300049586 | Bacteria | 4820 |
| 229 | Ga0501070_0027625 | 3300049586 | Bacteria | 4760 |
| 230 | Ga0501070_0070730 | 3300049586 | Bacteria | 2889 |
| 231 | Ga0501070_0159991 | 3300049586 | Bacteria | 1857 |
| 232 | Ga0501072_0014497 | 3300049588 | Bacteria | 6041 |
| 233 | Ga0501072_0131675 | 3300049588 | Bacteria | 1993 |
| 234 | Ga0501073_0000058 | 3300049589 | Bacteria | 70421 |
| 235 | Ga0501073_0001066 | 3300049589 | Bacteria | 19810 |
| 236 | Ga0501073_0041047 | 3300049589 | Bacteria | 3270 |
| 237 | Ga0501074_0005950 | 3300049590 | Bacteria | 8797 |
| 238 | Ga0501074_0048452 | 3300049590 | Bacteria | 3069 |
| 239 | Ga0501080_0000104 | 3300049742 | Bacteria | 57865 |
| 240 | Ga0501080_0002986 | 3300049742 | Bacteria | 14898 |
| 241 | Ga0501080_0003379 | 3300049742 | Bacteria | 14071 |
| 242 | Ga0501080_0024886 | 3300049742 | Bacteria | 5552 |
| 243 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 244 | Ga0501035_0000079 | 3300049822 | Bacteria | 118194 |
| 245 | Ga0501044_0000085 | 3300049823 | Bacteria | 114339 |
| 246 | Ga0501044_0000657 | 3300049823 | Bacteria | 41841 |
| 247 | Ga0501044_0120443 | 3300049823 | Bacteria | 2626 |
| 248 | nmdc:mga06z11_14578_c1 | 3300050494 | Bacteria | 3486 |
| 249 | nmdc:mga05p37_201_c1 | 3300050507 | Bacteria | 59705 |
| 250 | nmdc:mga05p37_63610_c1 | 3300050507 | Bacteria | 4541 |
| 251 | nmdc:mga09592_1332_c1 | 3300050508 | Bacteria | 19780 |
| 252 | nmdc:mga06r32_112967_c1 | 3300050510 | Bacteria | 2673 |
| 253 | nmdc:mga06r32_11479_c1 | 3300050510 | Bacteria | 7979 |
| 254 | nmdc:mga06r32_208664_c1 | 3300050510 | Bacteria | 1941 |
| 255 | nmdc:mga06r32_7358_c1 | 3300050510 | Bacteria | 9909 |
| 256 | Ga0500566_0000227 | 3300053094 | Bacteria | 30040 |
| 257 | Ga0500572_000023 | 3300053111 | Bacteria | 47431 |
| 258 | Ga0500572_001565 | 3300053111 | Bacteria | 6111 |
| 259 | Ga0500595_001362 | 3300053119 | Bacteria | 13149 |
| 260 | Ga0500595_001888 | 3300053119 | Bacteria | 10797 |
| 261 | Ga0500595_009136 | 3300053119 | Bacteria | 4016 |
| 262 | Ga0500642_0048502 | 3300053130 | Bacteria | 1866 |
| 263 | Ga0500559_0001416 | 3300053136 | Bacteria | 13619 |
| 264 | Ga0500603_000274 | 3300053150 | Bacteria | 13673 |
| 265 | Ga0500630_000387 | 3300053159 | Bacteria | 18759 |
| 266 | Ga0500639_000022 | 3300053163 | Bacteria | 87814 |
| 267 | Ga0500639_035382 | 3300053163 | Bacteria | 2637 |
| 268 | Ga0500636_0023813 | 3300053177 | Bacteria | 3620 |
| 269 | Ga0500596_001209 | 3300053735 | Bacteria | 5215 |
| 270 | Ga0500596_001335 | 3300053735 | Bacteria | 4972 |
| 271 | Ga0500601_001119 | 3300053737 | Bacteria | 3034 |
| 272 | Ga0501084_0026023 | 3300054114 | Bacteria | 4880 |
| 273 | Ga0501082_0039902 | 3300060353 | Bacteria | 4050 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025253 | Ga0209677_103344 | Ga0209677_1033444 | 471 |
| 2 | 3300006186 | Ga0075369_10042423 | Ga0075369_100424232 | 500 |
| 3 | 3300049581 | Ga0501047_0020822 | Ga0501047_0020822_903_2408 | 501 |
| 4 | 3300005458 | Ga0070681_10001413 | Ga0070681_100014139 | 509 |
| 5 | 3300005563 | Ga0068855_100073293 | Ga0068855_1000732932 | 509 |
| 6 | 3300026078 | Ga0207702_10041597 | Ga0207702_100415972 | 509 |
| 7 | 3300026116 | Ga0207674_10070625 | Ga0207674_100706252 | 509 |
| 8 | 3300035090 | Ga0373949_0002196 | Ga0373949_0002196_63_1610 | 513 |
| 9 | 3300035242 | Ga0373962_0001670 | Ga0373962_0001670_840_2387 | 513 |
| 10 | 3300013307 | Ga0157372_10059404 | Ga0157372_100594042 | 514 |
| 11 | 3300053177 | Ga0500636_0023813 | Ga0500636_0023813_1923_3518 | 518 |
| 12 | 3300045976 | Ga0466967_0154630 | Ga0466967_0154630_524_2119 | 520 |
| 13 | 3300048929 | Ga0496126_0008408 | Ga0496126_0008408_4163_5758 | 520 |
| 14 | 3300048908 | Ga0496105_0075126 | Ga0496105_0075126_689_2293 | 522 |
| 15 | 3300005331 | Ga0070670_100018584 | Ga0070670_1000185843 | 523 |
| 16 | 3300005331 | Ga0070670_100006753 | Ga0070670_1000067535 | 524 |
| 17 | 3300025925 | Ga0207650_10033376 | Ga0207650_100333762 | 524 |
| 18 | 3300005456 | Ga0070678_100011753 | Ga0070678_1000117533 | 525 |
| 19 | 3300005471 | Ga0070698_100085546 | Ga0070698_1000855463 | 525 |
| 20 | 3300005617 | Ga0068859_100006107 | Ga0068859_1000061072 | 525 |
| 21 | 3300006931 | Ga0097620_100006104 | Ga0097620_10000610411 | 525 |
| 22 | 3300009148 | Ga0105243_10046520 | Ga0105243_100465202 | 525 |
| 23 | 3300050507 | nmdc:mga05p37_63610_c1 | nmdc:mga05p37_63610_c1_2561_4156 | 525 |
| 24 | 3300050508 | nmdc:mga09592_1332_c1 | nmdc:mga09592_1332_c1_7613_9208 | 525 |
| 25 | 3300050510 | nmdc:mga06r32_11479_c1 | nmdc:mga06r32_11479_c1_63_1658 | 525 |
| 26 | 3300050510 | nmdc:mga06r32_208664_c1 | nmdc:mga06r32_208664_c1_137_1720 | 525 |
| 27 | iso_pu_bacteria | 2935908558 | 2935912493 | 526 |
| 28 | iso_pu_bacteria | 2935916978 | 2935921672 | 526 |
| 29 | iso_pu_bacteria | 2935926038 | 2935929618 | 526 |
| 30 | iso_pu_bacteria | 2935934488 | 2935938850 | 526 |
| 31 | iso_pu_bacteria | 2935942939 | 2935948315 | 526 |
| 32 | iso_pu_bacteria | 2935951376 | 2935955039 | 526 |
| 33 | iso_pu_bacteria | 2935967501 | 2935971927 | 526 |
| 34 | iso_pu_bacteria | 8019687851 | 8019693839 | 526 |
| 35 | 3300006844 | Ga0075428_100018652 | Ga0075428_1000186523 | 527 |
| 36 | 3300006847 | Ga0075431_100019118 | Ga0075431_1000191182 | 527 |
| 37 | 3300006880 | Ga0075429_100000922 | Ga0075429_1000009229 | 527 |
| 38 | iso_pu_bacteria | 2507262055 | 2507510500 | 527 |
| 39 | iso_pu_bacteria | 2513237096 | 2513658631 | 527 |
| 40 | iso_pu_bacteria | 2513237137 | 2513859836 | 527 |
| 41 | iso_pu_bacteria | 2513237145 | 2513920805 | 527 |
| 42 | iso_pu_bacteria | 2517572143 | 2517895032 | 527 |
| 43 | iso_pu_bacteria | 2617270735 | 2617347270 | 527 |
| 44 | iso_pu_bacteria | 2728368998 | 2728749470 | 527 |
| 45 | iso_pu_bacteria | 2824600985 | 2824604099 | 527 |
| 46 | iso_pu_bacteria | 2824609381 | 2824610368 | 527 |
| 47 | iso_pu_bacteria | 2824653114 | 2824654112 | 527 |
| 48 | iso_pu_bacteria | 2838122688 | 2838122822 | 527 |
| 49 | iso_pu_bacteria | 2841941048 | 2841946870 | 527 |
| 50 | iso_pu_bacteria | 2841949485 | 2841950914 | 527 |
| 51 | iso_pu_bacteria | 2841983080 | 2841988890 | 527 |
| 52 | iso_pu_bacteria | 2842038055 | 2842038823 | 527 |
| 53 | iso_pu_bacteria | 2842045827 | 2842048232 | 527 |
| 54 | iso_pu_bacteria | 2849076700 | 2849077990 | 527 |
| 55 | iso_pu_bacteria | 2874620515 | 2874627594 | 527 |
| 56 | iso_pu_bacteria | 2874628541 | 2874631559 | 527 |
| 57 | iso_pu_bacteria | 2881364244 | 2881366110 | 527 |
| 58 | iso_pu_bacteria | 2888419890 | 2888425029 | 527 |
| 59 | iso_pu_bacteria | 2904666416 | 2904673086 | 527 |
| 60 | iso_pu_bacteria | 2906635258 | 2906639689 | 527 |
| 61 | iso_pu_bacteria | 2906643746 | 2906645093 | 527 |
| 62 | iso_pu_bacteria | 2906660503 | 2906660568 | 527 |
| 63 | iso_pu_bacteria | 2935648319 | 2935652576 | 527 |
| 64 | iso_pu_bacteria | 2935656913 | 2935661158 | 527 |
| 65 | iso_pu_bacteria | 2936011229 | 2936015215 | 527 |
| 66 | iso_pu_bacteria | 2936019824 | 2936023360 | 527 |
| 67 | iso_pu_bacteria | 2936028420 | 2936032187 | 527 |
| 68 | iso_pu_bacteria | 2936046547 | 2936050048 | 527 |
| 69 | iso_pu_bacteria | 2936055302 | 2936061850 | 527 |
| 70 | iso_pu_bacteria | 8056681323 | 8056685593 | 527 |
| 71 | 3300005937 | Ga0081455_10000062 | Ga0081455_1000006236 | 529 |
| 72 | 3300049586 | Ga0501070_0159991 | Ga0501070_0159991_255_1844 | 529 |
| 73 | 3300003320 | rootH2_10020844 | rootH2_100208442 | 530 |
| 74 | 3300003323 | rootH1_10082096 | rootH1_100820963 | 530 |
| 75 | 3300003659 | JGI25404J52841_10000476 | JGI25404J52841_100004765 | 530 |
| 76 | 3300005983 | Ga0081540_1000862 | Ga0081540_10008622 | 530 |
| 77 | 3300006844 | Ga0075428_100020453 | Ga0075428_1000204536 | 530 |
| 78 | 3300006847 | Ga0075431_100006362 | Ga0075431_1000063626 | 530 |
| 79 | 3300006880 | Ga0075429_100009907 | Ga0075429_1000099072 | 530 |
| 80 | 3300009147 | Ga0114129_10005286 | Ga0114129_100052866 | 530 |
| 81 | 3300025272 | Ga0209455_1002178 | Ga0209455_10021783 | 530 |
| 82 | 3300027876 | Ga0209974_10001017 | Ga0209974_100010177 | 530 |
| 83 | 3300050507 | nmdc:mga05p37_201_c1 | nmdc:mga05p37_201_c1_12594_14192 | 530 |
| 84 | 3300050510 | nmdc:mga06r32_7358_c1 | nmdc:mga06r32_7358_c1_4272_5870 | 530 |
| 85 | iso_pu_bacteria | 2643221651 | 2644289113 | 530 |
| 86 | iso_pu_bacteria | 2858950400 | 2858951534 | 530 |
| 87 | 3300003203 | JGI25406J46586_10000060 | JGI25406J46586_100000607 | 531 |
| 88 | 3300005327 | Ga0070658_10035940 | Ga0070658_100359402 | 531 |
| 89 | 3300005329 | Ga0070683_100008289 | Ga0070683_1000082897 | 531 |
| 90 | 3300005344 | Ga0070661_100049517 | Ga0070661_1000495172 | 531 |
| 91 | 3300005344 | Ga0070661_100053856 | Ga0070661_1000538562 | 531 |
| 92 | 3300005344 | Ga0070661_100083594 | Ga0070661_1000835942 | 531 |
| 93 | 3300005347 | Ga0070668_100009888 | Ga0070668_1000098884 | 531 |
| 94 | 3300005353 | Ga0070669_100110184 | Ga0070669_1001101842 | 531 |
| 95 | 3300005366 | Ga0070659_100012332 | Ga0070659_1000123322 | 531 |
| 96 | 3300005434 | Ga0070709_10002208 | Ga0070709_100022087 | 531 |
| 97 | 3300005435 | Ga0070714_100002040 | Ga0070714_1000020408 | 531 |
| 98 | 3300005435 | Ga0070714_100025364 | Ga0070714_1000253642 | 531 |
| 99 | 3300005436 | Ga0070713_100002893 | Ga0070713_1000028934 | 531 |
| 100 | 3300005436 | Ga0070713_100007608 | Ga0070713_1000076084 | 531 |
| 101 | 3300005436 | Ga0070713_100022365 | Ga0070713_1000223654 | 531 |
| 102 | 3300005437 | Ga0070710_10000650 | Ga0070710_1000065016 | 531 |
| 103 | 3300005437 | Ga0070710_10076668 | Ga0070710_100766681 | 531 |
| 104 | 3300005439 | Ga0070711_100002615 | Ga0070711_1000026159 | 531 |
| 105 | 3300005455 | Ga0070663_100041684 | Ga0070663_1000416843 | 531 |
| 106 | 3300005458 | Ga0070681_10001542 | Ga0070681_1000154214 | 531 |
| 107 | 3300005459 | Ga0068867_100055975 | Ga0068867_1000559752 | 531 |
| 108 | 3300005471 | Ga0070698_100023633 | Ga0070698_1000236336 | 531 |
| 109 | 3300005539 | Ga0068853_100022991 | Ga0068853_1000229912 | 531 |
| 110 | 3300005539 | Ga0068853_100109891 | Ga0068853_1001098912 | 531 |
| 111 | 3300005547 | Ga0070693_100036415 | Ga0070693_1000364153 | 531 |
| 112 | 3300005563 | Ga0068855_100266866 | Ga0068855_1002668661 | 531 |
| 113 | 3300005564 | Ga0070664_100020902 | Ga0070664_1000209023 | 531 |
| 114 | 3300005578 | Ga0068854_100055938 | Ga0068854_1000559382 | 531 |
| 115 | 3300005614 | Ga0068856_100021750 | Ga0068856_1000217505 | 531 |
| 116 | 3300005616 | Ga0068852_100000371 | Ga0068852_10000037117 | 531 |
| 117 | 3300005616 | Ga0068852_100037389 | Ga0068852_1000373894 | 531 |
| 118 | 3300005618 | Ga0068864_100022080 | Ga0068864_1000220804 | 531 |
| 119 | 3300005719 | Ga0068861_100019659 | Ga0068861_1000196594 | 531 |
| 120 | 3300005834 | Ga0068851_10027267 | Ga0068851_100272672 | 531 |
| 121 | 3300005843 | Ga0068860_100000289 | Ga0068860_1000002899 | 531 |
| 122 | 3300005983 | Ga0081540_1022473 | Ga0081540_10224732 | 531 |
| 123 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003279 | 531 |
| 124 | 3300006028 | Ga0070717_10155683 | Ga0070717_101556832 | 531 |
| 125 | 3300006038 | Ga0075365_10033796 | Ga0075365_100337962 | 531 |
| 126 | 3300006175 | Ga0070712_100001472 | Ga0070712_1000014728 | 531 |
| 127 | 3300006175 | Ga0070712_100011985 | Ga0070712_1000119854 | 531 |
| 128 | 3300006178 | Ga0075367_10001332 | Ga0075367_100013329 | 531 |
| 129 | 3300006358 | Ga0068871_100031425 | Ga0068871_1000314251 | 531 |
| 130 | 3300006844 | Ga0075428_100262139 | Ga0075428_1002621391 | 531 |
| 131 | 3300006847 | Ga0075431_100061347 | Ga0075431_1000613472 | 531 |
| 132 | 3300006942 | Ga0099824_1021223 | Ga0099824_10212232 | 531 |
| 133 | 3300006943 | Ga0099822_1002451 | Ga0099822_100245118 | 531 |
| 134 | 3300006944 | Ga0099823_1000008 | Ga0099823_100000826 | 531 |
| 135 | 3300007788 | Ga0099795_10015236 | Ga0099795_100152362 | 531 |
| 136 | 3300009093 | Ga0105240_10003803 | Ga0105240_1000380314 | 531 |
| 137 | 3300009101 | Ga0105247_10068655 | Ga0105247_100686551 | 531 |
| 138 | 3300009148 | Ga0105243_10038453 | Ga0105243_100384532 | 531 |
| 139 | 3300009174 | Ga0105241_10035230 | Ga0105241_100352303 | 531 |
| 140 | 3300009174 | Ga0105241_10081972 | Ga0105241_100819722 | 531 |
| 141 | 3300009545 | Ga0105237_10032643 | Ga0105237_100326434 | 531 |
| 142 | 3300009545 | Ga0105237_10148929 | Ga0105237_101489293 | 531 |
| 143 | 3300009551 | Ga0105238_10000556 | Ga0105238_1000055625 | 531 |
| 144 | 3300009553 | Ga0105249_10027163 | Ga0105249_100271633 | 531 |
| 145 | 3300010375 | Ga0105239_10191322 | Ga0105239_101913222 | 531 |
| 146 | 3300011119 | Ga0105246_10037493 | Ga0105246_100374932 | 531 |
| 147 | 3300013100 | Ga0157373_10028652 | Ga0157373_100286523 | 531 |
| 148 | 3300013102 | Ga0157371_10047983 | Ga0157371_100479832 | 531 |
| 149 | 3300013104 | Ga0157370_10005227 | Ga0157370_1000522718 | 531 |
| 150 | 3300013104 | Ga0157370_10023145 | Ga0157370_100231451 | 531 |
| 151 | 3300013104 | Ga0157370_10077152 | Ga0157370_100771523 | 531 |
| 152 | 3300013104 | Ga0157370_10141221 | Ga0157370_101412212 | 531 |
| 153 | 3300013105 | Ga0157369_10005626 | Ga0157369_100056263 | 531 |
| 154 | 3300013296 | Ga0157374_10077215 | Ga0157374_100772153 | 531 |
| 155 | 3300013307 | Ga0157372_10007555 | Ga0157372_100075554 | 531 |
| 156 | 3300013307 | Ga0157372_10009605 | Ga0157372_100096056 | 531 |
| 157 | 3300013307 | Ga0157372_10235660 | Ga0157372_102356602 | 531 |
| 158 | 3300014325 | Ga0163163_10002739 | Ga0163163_100027397 | 531 |
| 159 | 3300014326 | Ga0157380_10028619 | Ga0157380_100286193 | 531 |
| 160 | 3300014326 | Ga0157380_10063531 | Ga0157380_100635312 | 531 |
| 161 | 3300014969 | Ga0157376_10093759 | Ga0157376_100937592 | 531 |
| 162 | 3300017792 | Ga0163161_10033327 | Ga0163161_100333272 | 531 |
| 163 | 3300021384 | Ga0213876_10001443 | Ga0213876_100014438 | 531 |
| 164 | 3300025297 | Ga0209758_1000838 | Ga0209758_100083813 | 531 |
| 165 | 3300025898 | Ga0207692_10002847 | Ga0207692_100028479 | 531 |
| 166 | 3300025906 | Ga0207699_10001240 | Ga0207699_100012407 | 531 |
| 167 | 3300025906 | Ga0207699_10013006 | Ga0207699_100130063 | 531 |
| 168 | 3300025911 | Ga0207654_10011066 | Ga0207654_100110661 | 531 |
| 169 | 3300025912 | Ga0207707_10015206 | Ga0207707_100152062 | 531 |
| 170 | 3300025912 | Ga0207707_10050260 | Ga0207707_100502602 | 531 |
| 171 | 3300025912 | Ga0207707_10055662 | Ga0207707_100556622 | 531 |
| 172 | 3300025914 | Ga0207671_10074465 | Ga0207671_100744652 | 531 |
| 173 | 3300025915 | Ga0207693_10003335 | Ga0207693_1000333514 | 531 |
| 174 | 3300025915 | Ga0207693_10020057 | Ga0207693_100200571 | 531 |
| 175 | 3300025919 | Ga0207657_10001312 | Ga0207657_100013128 | 531 |
| 176 | 3300025919 | Ga0207657_10001491 | Ga0207657_1000149114 | 531 |
| 177 | 3300025920 | Ga0207649_10052228 | Ga0207649_100522282 | 531 |
| 178 | 3300025920 | Ga0207649_10064829 | Ga0207649_100648291 | 531 |
| 179 | 3300025924 | Ga0207694_10006006 | Ga0207694_100060068 | 531 |
| 180 | 3300025928 | Ga0207700_10005496 | Ga0207700_100054966 | 531 |
| 181 | 3300025928 | Ga0207700_10023639 | Ga0207700_100236393 | 531 |
| 182 | 3300025928 | Ga0207700_10053279 | Ga0207700_100532792 | 531 |
| 183 | 3300025933 | Ga0207706_10004262 | Ga0207706_1000426211 | 531 |
| 184 | 3300025942 | Ga0207689_10004916 | Ga0207689_1000491611 | 531 |
| 185 | 3300025972 | Ga0207668_10026654 | Ga0207668_100266543 | 531 |
| 186 | 3300026041 | Ga0207639_10198888 | Ga0207639_101988881 | 531 |
| 187 | 3300026067 | Ga0207678_10005947 | Ga0207678_100059476 | 531 |
| 188 | 3300026078 | Ga0207702_10114789 | Ga0207702_101147892 | 531 |
| 189 | 3300026088 | Ga0207641_10081993 | Ga0207641_100819932 | 531 |
| 190 | 3300026116 | Ga0207674_10005327 | Ga0207674_100053278 | 531 |
| 191 | 3300026118 | Ga0207675_100007890 | Ga0207675_10000789010 | 531 |
| 192 | 3300026118 | Ga0207675_100008391 | Ga0207675_1000083918 | 531 |
| 193 | 3300026142 | Ga0207698_10001704 | Ga0207698_100017042 | 531 |
| 194 | 3300027296 | Ga0209389_1000032 | Ga0209389_100003287 | 531 |
| 195 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001600 | 531 |
| 196 | 3300027361 | Ga0209489_100001 | Ga0209489_100001600 | 531 |
| 197 | 3300027361 | Ga0209489_100035 | Ga0209489_10003592 | 531 |
| 198 | 3300027363 | Ga0209700_100001 | Ga0209700_100001600 | 531 |
| 199 | 3300027363 | Ga0209700_100005 | Ga0209700_10000595 | 531 |
| 200 | 3300028380 | Ga0268265_10122791 | Ga0268265_101227912 | 531 |
| 201 | 3300028381 | Ga0268264_10000065 | Ga0268264_1000006559 | 531 |
| 202 | 3300028381 | Ga0268264_10224921 | Ga0268264_102249211 | 531 |
| 203 | 3300031852 | Ga0307410_10000909 | Ga0307410_100009094 | 531 |
| 204 | 3300031901 | Ga0307406_10003664 | Ga0307406_100036642 | 531 |
| 205 | 3300031901 | Ga0307406_10134058 | Ga0307406_101340581 | 531 |
| 206 | 3300031903 | Ga0307407_10002869 | Ga0307407_100028695 | 531 |
| 207 | 3300031911 | Ga0307412_10009500 | Ga0307412_100095003 | 531 |
| 208 | 3300031995 | Ga0307409_100005569 | Ga0307409_1000055696 | 531 |
| 209 | 3300032002 | Ga0307416_100041775 | Ga0307416_1000417753 | 531 |
| 210 | 3300033442 | Ga0315911_1000007 | Ga0315911_1000007290 | 531 |
| 211 | 3300035113 | Ga0373936_0011351 | Ga0373936_0011351_1539_3140 | 531 |
| 212 | 3300037418 | Ga0395900_0001627 | Ga0395900_0001627_23855_25450 | 531 |
| 213 | 3300037466 | Ga0395898_0089028 | Ga0395898_0089028_1024_2619 | 531 |
| 214 | 3300038443 | Ga0395901_0002678 | Ga0395901_0002678_15328_16923 | 531 |
| 215 | 3300038443 | Ga0395901_0024265 | Ga0395901_0024265_4352_5998 | 531 |
| 216 | 3300039437 | Ga0436365_1095754 | Ga0436365_1095754_14575_16179 | 531 |
| 217 | 3300039453 | Ga0436362_0811936 | Ga0436362_0811936_7121_8722 | 531 |
| 218 | 3300045976 | Ga0466967_0018209 | Ga0466967_0018209_2677_4275 | 531 |
| 219 | 3300045976 | Ga0466967_0084705 | Ga0466967_0084705_1070_2665 | 531 |
| 220 | 3300048905 | Ga0496102_0118809 | Ga0496102_0118809_25_1620 | 531 |
| 221 | 3300048907 | Ga0496104_0001601 | Ga0496104_0001601_2714_4357 | 531 |
| 222 | 3300048907 | Ga0496104_0002148 | Ga0496104_0002148_10744_12375 | 531 |
| 223 | 3300048907 | Ga0496104_0072073 | Ga0496104_0072073_1271_2866 | 531 |
| 224 | 3300048908 | Ga0496105_0000763 | Ga0496105_0000763_12075_13718 | 531 |
| 225 | 3300048911 | Ga0496108_0001146 | Ga0496108_0001146_14473_16116 | 531 |
| 226 | 3300048911 | Ga0496108_0147882 | Ga0496108_0147882_365_1975 | 531 |
| 227 | 3300048912 | Ga0496109_0000698 | Ga0496109_0000698_9463_11106 | 531 |
| 228 | 3300048912 | Ga0496109_0096073 | Ga0496109_0096073_599_2209 | 531 |
| 229 | 3300048913 | Ga0496110_0002949 | Ga0496110_0002949_8408_10051 | 531 |
| 230 | 3300048913 | Ga0496110_0092873 | Ga0496110_0092873_759_2354 | 531 |
| 231 | 3300048914 | Ga0496111_0002486 | Ga0496111_0002486_5032_6675 | 531 |
| 232 | 3300048915 | Ga0496112_0003373 | Ga0496112_0003373_6905_8548 | 531 |
| 233 | 3300048915 | Ga0496112_0006407 | Ga0496112_0006407_3881_5491 | 531 |
| 234 | 3300048915 | Ga0496112_0135726 | Ga0496112_0135726_48_1643 | 531 |
| 235 | 3300048916 | Ga0496113_0003929 | Ga0496113_0003929_2841_4484 | 531 |
| 236 | 3300048920 | Ga0496117_0018182 | Ga0496117_0018182_2053_3669 | 531 |
| 237 | 3300048920 | Ga0496117_0024082 | Ga0496117_0024082_2096_3700 | 531 |
| 238 | 3300048921 | Ga0496118_0013173 | Ga0496118_0013173_1044_2660 | 531 |
| 239 | 3300048924 | Ga0496121_0000285 | Ga0496121_0000285_32937_34532 | 531 |
| 240 | 3300048924 | Ga0496121_0018022 | Ga0496121_0018022_2165_3781 | 531 |
| 241 | 3300048924 | Ga0496121_0051030 | Ga0496121_0051030_298_1902 | 531 |
| 242 | 3300048924 | Ga0496121_0071445 | Ga0496121_0071445_854_2449 | 531 |
| 243 | 3300048929 | Ga0496126_0050365 | Ga0496126_0050365_750_2354 | 531 |
| 244 | 3300048929 | Ga0496126_0091295 | Ga0496126_0091295_70_1665 | 531 |
| 245 | 3300049568 | Ga0501031_0000106 | Ga0501031_0000106_24532_26127 | 531 |
| 246 | 3300049568 | Ga0501031_0000160 | Ga0501031_0000160_16163_17776 | 531 |
| 247 | 3300049569 | Ga0501032_0000068 | Ga0501032_0000068_56417_58030 | 531 |
| 248 | 3300049569 | Ga0501032_0000086 | Ga0501032_0000086_48047_49642 | 531 |
| 249 | 3300049570 | Ga0501033_0000274 | Ga0501033_0000274_32887_34500 | 531 |
| 250 | 3300049570 | Ga0501033_0002698 | Ga0501033_0002698_5625_7220 | 531 |
| 251 | 3300049571 | Ga0501034_0000108 | Ga0501034_0000108_14646_16241 | 531 |
| 252 | 3300049571 | Ga0501034_0000790 | Ga0501034_0000790_14706_16319 | 531 |
| 253 | 3300049571 | Ga0501034_0012201 | Ga0501034_0012201_1267_2883 | 531 |
| 254 | 3300049572 | Ga0501036_0000065 | Ga0501036_0000065_2857_4452 | 531 |
| 255 | 3300049572 | Ga0501036_0000203 | Ga0501036_0000203_31487_33100 | 531 |
| 256 | 3300049572 | Ga0501036_0058915 | Ga0501036_0058915_1320_2921 | 531 |
| 257 | 3300049573 | Ga0501037_0000109 | Ga0501037_0000109_32742_34355 | 531 |
| 258 | 3300049573 | Ga0501037_0000173 | Ga0501037_0000173_53183_54778 | 531 |
| 259 | 3300049574 | Ga0501038_0000028 | Ga0501038_0000028_106556_108169 | 531 |
| 260 | 3300049574 | Ga0501038_0000076 | Ga0501038_0000076_59178_60773 | 531 |
| 261 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_258269_259882 | 531 |
| 262 | 3300049575 | Ga0501039_0006739 | Ga0501039_0006739_1982_3577 | 531 |
| 263 | 3300049579 | Ga0501043_0000122 | Ga0501043_0000122_38757_40370 | 531 |
| 264 | 3300049579 | Ga0501043_0000459 | Ga0501043_0000459_24369_25964 | 531 |
| 265 | 3300049579 | Ga0501043_0028558 | Ga0501043_0028558_2233_3834 | 531 |
| 266 | 3300049580 | Ga0501046_0000032 | Ga0501046_0000032_35142_36755 | 531 |
| 267 | 3300049580 | Ga0501046_0000744 | Ga0501046_0000744_12735_14330 | 531 |
| 268 | 3300049581 | Ga0501047_0000543 | Ga0501047_0000543_32918_34531 | 531 |
| 269 | 3300049581 | Ga0501047_0001887 | Ga0501047_0001887_8041_9636 | 531 |
| 270 | 3300049581 | Ga0501047_0084367 | Ga0501047_0084367_301_1917 | 531 |
| 271 | 3300049582 | Ga0501048_0000271 | Ga0501048_0000271_28804_30399 | 531 |
| 272 | 3300049582 | Ga0501048_0002235 | Ga0501048_0002235_2597_4210 | 531 |
| 273 | 3300049583 | Ga0501067_0000176 | Ga0501067_0000176_29334_30929 | 531 |
| 274 | 3300049583 | Ga0501067_0001783 | Ga0501067_0001783_8571_10184 | 531 |
| 275 | 3300049584 | Ga0501068_0000517 | Ga0501068_0000517_9233_10846 | 531 |
| 276 | 3300049585 | Ga0501069_0006051 | Ga0501069_0006051_2784_4379 | 531 |
| 277 | 3300049585 | Ga0501069_0013561 | Ga0501069_0013561_1413_3026 | 531 |
| 278 | 3300049586 | Ga0501070_0000152 | Ga0501070_0000152_31830_33443 | 531 |
| 279 | 3300049586 | Ga0501070_0026936 | Ga0501070_0026936_569_2164 | 531 |
| 280 | 3300049586 | Ga0501070_0027625 | Ga0501070_0027625_1597_3207 | 531 |
| 281 | 3300049586 | Ga0501070_0070730 | Ga0501070_0070730_308_1987 | 531 |
| 282 | 3300049588 | Ga0501072_0014497 | Ga0501072_0014497_3106_4701 | 531 |
| 283 | 3300049588 | Ga0501072_0131675 | Ga0501072_0131675_158_1771 | 531 |
| 284 | 3300049589 | Ga0501073_0000058 | Ga0501073_0000058_44458_46053 | 531 |
| 285 | 3300049589 | Ga0501073_0001066 | Ga0501073_0001066_14505_16118 | 531 |
| 286 | 3300049589 | Ga0501073_0041047 | Ga0501073_0041047_130_1746 | 531 |
| 287 | 3300049590 | Ga0501074_0005950 | Ga0501074_0005950_296_1891 | 531 |
| 288 | 3300049590 | Ga0501074_0048452 | Ga0501074_0048452_603_2198 | 531 |
| 289 | 3300049742 | Ga0501080_0000104 | Ga0501080_0000104_40496_42109 | 531 |
| 290 | 3300049742 | Ga0501080_0002986 | Ga0501080_0002986_6121_7716 | 531 |
| 291 | 3300049742 | Ga0501080_0003379 | Ga0501080_0003379_2513_4129 | 531 |
| 292 | 3300049742 | Ga0501080_0024886 | Ga0501080_0024886_2243_3838 | 531 |
| 293 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_200252_201865 | 531 |
| 294 | 3300049822 | Ga0501035_0000079 | Ga0501035_0000079_13428_15023 | 531 |
| 295 | 3300049823 | Ga0501044_0000085 | Ga0501044_0000085_105343_106938 | 531 |
| 296 | 3300049823 | Ga0501044_0000657 | Ga0501044_0000657_35831_37444 | 531 |
| 297 | 3300049823 | Ga0501044_0120443 | Ga0501044_0120443_889_2499 | 531 |
| 298 | 3300050494 | nmdc:mga06z11_14578_c1 | nmdc:mga06z11_14578_c1_990_2606 | 531 |
| 299 | 3300050510 | nmdc:mga06r32_112967_c1 | nmdc:mga06r32_112967_c1_285_1904 | 531 |
| 300 | 3300053094 | Ga0500566_0000227 | Ga0500566_0000227_2125_3726 | 531 |
| 301 | 3300053111 | Ga0500572_000023 | Ga0500572_000023_23006_24649 | 531 |
| 302 | 3300053111 | Ga0500572_001565 | Ga0500572_001565_2349_3950 | 531 |
| 303 | 3300053119 | Ga0500595_001362 | Ga0500595_001362_6630_8225 | 531 |
| 304 | 3300053119 | Ga0500595_001888 | Ga0500595_001888_5026_6630 | 531 |
| 305 | 3300053119 | Ga0500595_009136 | Ga0500595_009136_659_2257 | 531 |
| 306 | 3300053130 | Ga0500642_0048502 | Ga0500642_0048502_179_1777 | 531 |
| 307 | 3300053136 | Ga0500559_0001416 | Ga0500559_0001416_2316_3959 | 531 |
| 308 | 3300053150 | Ga0500603_000274 | Ga0500603_000274_5540_7141 | 531 |
| 309 | 3300053159 | Ga0500630_000387 | Ga0500630_000387_15020_16621 | 531 |
| 310 | 3300053163 | Ga0500639_000022 | Ga0500639_000022_39507_41108 | 531 |
| 311 | 3300053163 | Ga0500639_035382 | Ga0500639_035382_911_2542 | 531 |
| 312 | 3300053735 | Ga0500596_001209 | Ga0500596_001209_2015_3616 | 531 |
| 313 | 3300053735 | Ga0500596_001335 | Ga0500596_001335_92_1735 | 531 |
| 314 | 3300053737 | Ga0500601_001119 | Ga0500601_001119_556_2157 | 531 |
| 315 | 3300054114 | Ga0501084_0026023 | Ga0501084_0026023_2010_3605 | 531 |
| 316 | 3300060353 | Ga0501082_0039902 | Ga0501082_0039902_1082_2677 | 531 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r36-assembly1.cif.gz_A | difference-refined structure of fatty acid photodecarboxylase 2 microsecond following 400-nm laser irradiation of the dark-state determined by sfx | 0.9506 | 3 | 530 |
| 6yrz-assembly1.cif.gz_AAA | crystal structure of fap et ph 8.5 after illumination at 150k | 0.95 | 2 | 530 |
| 6yru-assembly1.cif.gz_AAA | crystal structure of fap in the dark at 100k | 0.9492 | 2 | 530 |
| 6ys1-assembly1.cif.gz_AAA | crystal structure of fap r451k mutant in the dark at 100k | 0.9481 | 2 | 530 |
| 6yrx-assembly1.cif.gz_AAA | low-dose crystal structure of fap at room temperature | 0.9469 | 2 | 530 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6UPE0_47_576_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9628 | 8 | 528 | 3.50.50.60 |
| af_P17444_4_531_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9586 | 7 | 527 | 3.50.50.60 |
| af_Q2FV11_9_533_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9477 | 7 | 525 | 3.50.50.60 |
| af_P9WMV5_6_524_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9468 | 7 | 526 | 3.40.50.2000 |
| af_Q6UPE0_47_576_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.945 | 8 | 528 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S8YTK6-F1-model_v4 | Choline dehydrogenase | 0.99 | 6 | 530 |
GO:0016614
GO:0050660 |
| AF-A0A2G4J7R9-F1-model_v4 | Choline dehydrogenase | 0.9888 | 6 | 530 |
GO:0016614
GO:0050660 |
| AF-A0A351NU01-F1-model_v4 | Choline dehydrogenase | 0.9848 | 95 | 530 |
GO:0016614
GO:0050660 |
| AF-A0A537T8Z9-F1-model_v4 | Choline dehydrogenase | 0.9824 | 6 | 294 |
GO:0016614
GO:0050660 |
| AF-A0A2W4NRR9-F1-model_v4 | deleted | 0.9817 | 6 | 263 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar