F403234

General Info

Members Datasets Scaffolds Average Seq Length
315 221 298 212

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10049321|Ga0265325_100493212
Length 256
Sequence MCQPTQRAAWRCRDWQGNTAHSRHTEFLQEPIRENNYRKHCTERGMDLKPLVTLLAIVNPLAIVPFFIHYTQGFSEAQRKRTIRTAAFSAFCVIAACALLGLQILEFFNISLPSFQVGGGMLLLISSMNMLNAKPAEAKPATNELEEGAEKAAAGASIAVVPLTIPLLTGPASMSTVVIYADRAQNWLQLAALVGYGVVIGLATAVCFSLADPIARVLGKTGINVMTRLMGLILAALAVEVMAEGLGQLFPVLVAH

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221652 Acidovorax sp. Root402 Isolate Unclassified
8 2643221717 Acidovorax sp. Root267 Isolate Unclassified
9 2738543012 Acidovorax sp. CF301 Isolate Unclassified
10 2816332133 Acidovorax radicis 2721A Isolate Unclassified
11 2842733646 Variovorax sp. R-72446 Isolate Unclassified
12 2842747753 Variovorax sp. R-72060 Isolate Unclassified
13 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
14 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
15 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
16 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
17 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
18 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
217 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.6
Metatranscriptomes 0
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.89
Nodule 0.32
Rhizoplane 5.71
Rhizosphere 53.97
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000009 3300002704 Bacteria 224358
2 JGI25156J39149_1000009 3300002705 Bacteria 224379
3 JGI25154J39366_1000024 3300002738 Bacteria 211372
4 JGI25157J39369_1000007 3300002741 Bacteria 224377
5 JGI25150J39212_1014521 3300002774 Bacteria 1337
6 JGI25150J39212_1016887 3300002774 Bacteria 1189
7 JGI25159J45721_1002132 3300002987 Bacteria 7743
8 JGI25159J45721_1007537 3300002987 Bacteria 3107
9 JGI25151J46595_10009583 3300003187 Bacteria 4570
10 JGI25151J46595_10014827 3300003187 Bacteria 3459
11 JGI25151J46595_10047819 3300003187 Bacteria 1484
12 rootH1_10036068 3300003323 Bacteria 1586
13 JGI25160J50197_1000242 3300003354 Bacteria 42399
14 JGI25161J50226_1000009 3300003374 Bacteria 224699
15 Ga0055526_1007972 3300003771 Bacteria 5374
16 Ga0055526_1023301 3300003771 Bacteria 2071
17 Ga0055537_1000235 3300003773 Bacteria 40558
18 Ga0055524_1000143 3300003775 Bacteria 84686
19 Ga0055534_1003551 3300003784 Bacteria 4857
20 Ga0055528_1002737 3300003790 Bacteria 9237
21 Ga0055530_10000474 3300003791 Bacteria 34978
22 Ga0055530_10022181 3300003791 Bacteria 1853
23 Ga0055540_1000027 3300003792 Bacteria 187454
24 Ga0055540_1008286 3300003792 Bacteria 3761
25 Ga0055531_10001125 3300003794 Bacteria 20709
26 Ga0055531_10001147 3300003794 Bacteria 20492
27 Ga0055543_1002618 3300004625 Bacteria 5809
28 Ga0065165_1017661 3300005262 Bacteria 2617
29 Ga0065165_1019556 3300005262 Bacteria 2411
30 Ga0065165_1035560 3300005262 Bacteria 1529
31 Ga0070658_10296187 3300005327 Bacteria 1379
32 Ga0070658_10679125 3300005327 Bacteria 894
33 Ga0068868_100142057 3300005338 Bacteria 1971
34 Ga0070660_100977575 3300005339 Bacteria 715
35 Ga0070667_100011146 3300005367 Bacteria 7435
36 Ga0070708_100350732 3300005445 Bacteria 1391
37 Ga0068867_100219628 3300005459 Bacteria 1531
38 Ga0070707_100606903 3300005468 Bacteria 1057
39 Ga0068853_100277741 3300005539 Bacteria 1544
40 Ga0070672_100525908 3300005543 Bacteria 1025
41 Ga0070665_100031544 3300005548 Bacteria 5334
42 Ga0070665_100068584 3300005548 Bacteria 3556
43 Ga0075365_10003037 3300006038 Bacteria 8512
44 Ga0075363_100019356 3300006048 Bacteria 3403
45 Ga0075363_100054130 3300006048 Bacteria 2147
46 Ga0075364_10013705 3300006051 Bacteria 4993
47 Ga0075432_10020334 3300006058 Bacteria 2270
48 Ga0075362_10012503 3300006177 Bacteria 3374
49 Ga0075362_10063645 3300006177 Bacteria 1673
50 Ga0075362_10102001 3300006177 Bacteria 1342
51 Ga0075362_10102470 3300006177 Bacteria 1340
52 Ga0075367_10089370 3300006178 Bacteria 1873
53 Ga0075367_10113858 3300006178 Bacteria 1662
54 Ga0075367_10154530 3300006178 Bacteria 1425
55 Ga0075367_10500257 3300006178 Bacteria 771
56 Ga0075366_10063799 3300006195 Bacteria 2190
57 Ga0075366_10211426 3300006195 Bacteria 1181
58 Ga0075370_10097110 3300006353 Bacteria 1703
59 Ga0075370_10355357 3300006353 Bacteria 876
60 Ga0075430_100047838 3300006846 Bacteria 3612
61 Ga0075430_100250008 3300006846 Bacteria 1469
62 Ga0075429_100023715 3300006880 Bacteria 5324
63 Ga0114129_10061456 3300009147 Bacteria 5249
64 Ga0105242_10000638 3300009176 Bacteria 27494
65 Ga0105242_10664342 3300009176 Bacteria 1015
66 Ga0105248_10793205 3300009177 Bacteria 1069
67 Ga0105238_10809452 3300009551 Bacteria 953
68 Ga0105249_10772097 3300009553 Bacteria 1024
69 Ga0105239_10406945 3300010375 Bacteria 1540
70 Ga0157326_1002224 3300012513 Bacteria 2091
71 Ga0163162_10400577 3300013306 Bacteria 1505
72 Ga0182008_10001313 3300014497 Bacteria 16982
73 Ga0182008_10001772 3300014497 Bacteria 14134
74 Ga0157376_10011667 3300014969 Bacteria 6488
75 Ga0182006_1029518 3300015261 Bacteria 2221
76 Ga0182007_10000714 3300015262 Bacteria 18864
77 Ga0182007_10093156 3300015262 Bacteria 993
78 Ga0183362_10004 3300015683 Bacteria 569303
79 Ga0163161_10059759 3300017792 Bacteria 2773
80 Ga0213872_10004534 3300021361 Bacteria 7351
81 Ga0209435_100051 3300025206 Bacteria 90866
82 Ga0209436_102651 3300025208 Bacteria 5205
83 Ga0207425_1003880 3300025245 Bacteria 4643
84 Ga0207425_1031811 3300025245 Bacteria 1048
85 Ga0209646_1000029 3300025246 Bacteria 386414
86 Ga0209026_1000016 3300025250 Bacteria 386457
87 Ga0209759_1000016 3300025256 Bacteria 386414
88 Ga0209565_1000122 3300025263 Bacteria 111132
89 Ga0209565_1000373 3300025263 Bacteria 38291
90 Ga0209673_1000302 3300025273 Bacteria 91221
91 Ga0209130_1000014 3300025284 Bacteria 412039
92 Ga0209130_1000487 3300025284 Bacteria 40823
93 Ga0209130_1000495 3300025284 Bacteria 40276
94 Ga0209130_1017774 3300025284 Bacteria 1686
95 Ga0209675_1000098 3300025291 Bacteria 130512
96 Ga0209675_1002425 3300025291 Bacteria 9605
97 Ga0209675_1010612 3300025291 Bacteria 3129
98 Ga0209676_1000013 3300025292 Bacteria 816080
99 Ga0209025_1003515 3300025294 Bacteria 14708
100 Ga0209025_1019888 3300025294 Bacteria 3707
101 Ga0209025_1027938 3300025294 Bacteria 2780
102 Ga0209025_1051301 3300025294 Bacteria 1641
103 Ga0209564_1001169 3300025295 Bacteria 30538
104 Ga0209564_1001202 3300025295 Bacteria 29560
105 Ga0209758_1038458 3300025297 Bacteria 1835
106 Ga0209050_1000008 3300025298 Bacteria 1144179
107 Ga0209050_1005076 3300025298 Bacteria 8500
108 Ga0209256_1000039 3300025299 Bacteria 372337
109 Ga0209256_1041886 3300025299 Bacteria 1160
110 Ga0207426_1000224 3300025302 Bacteria 130233
111 Ga0209051_1000005 3300025303 Bacteria 1142353
112 Ga0209051_1000172 3300025303 Bacteria 117180
113 Ga0209257_1000015 3300025304 Bacteria 908141
114 Ga0209257_1000031 3300025304 Bacteria 688770
115 Ga0209257_1000108 3300025304 Bacteria 240229
116 Ga0207705_10144981 3300025909 Bacteria 1776
117 Ga0207705_10310872 3300025909 Bacteria 1210
118 Ga0207646_10822157 3300025922 Bacteria 827
119 Ga0207694_10568117 3300025924 Bacteria 953
120 Ga0207686_10230980 3300025934 Bacteria 1341
121 Ga0207691_10417152 3300025940 Bacteria 1144
122 Ga0207691_10569047 3300025940 Bacteria 960
123 Ga0207651_10193894 3300025960 Bacteria 1623
124 Ga0207658_10016326 3300025986 Bacteria 5107
125 Ga0207677_10021038 3300026023 Bacteria 3977
126 Ga0207639_10125625 3300026041 Bacteria 2115
127 Ga0207639_10360941 3300026041 Bacteria 1300
128 Ga0207648_10207997 3300026089 Bacteria 1736
129 Ga0207674_10145524 3300026116 Bacteria 2328
130 Ga0209984_1019840 3300027424 Bacteria 916
131 Ga0209999_1015174 3300027543 Bacteria 1401
132 Ga0209970_1000627 3300027614 Bacteria 6117
133 Ga0209974_10049569 3300027876 Bacteria 1409
134 Ga0209974_10059088 3300027876 Bacteria 1297
135 Ga0209974_10105499 3300027876 Bacteria 988
136 Ga0207428_10649923 3300027907 Bacteria 757
137 Ga0268266_10051508 3300028379 Bacteria 3534
138 Ga0268266_10683367 3300028379 Bacteria 989
139 Ga0307515_10000322 3300028794 Bacteria 118563
140 Ga0307515_10005091 3300028794 Bacteria 26710
141 Ga0307515_10052038 3300028794 Bacteria 6085
142 Ga0265330_10000037 3300031235 Bacteria 120957
143 Ga0265330_10020871 3300031235 Bacteria 2993
144 Ga0265332_10000008 3300031238 Bacteria 301609
145 Ga0265332_10001541 3300031238 Bacteria 12709
146 Ga0265332_10002902 3300031238 Bacteria 8468
147 Ga0265325_10049321 3300031241 Bacteria 2173
148 Ga0307513_10000013 3300031456 Bacteria 325682
149 Ga0307513_10002374 3300031456 Bacteria 26130
150 Ga0307513_10011271 3300031456 Bacteria 11126
151 Ga0307513_10171217 3300031456 Bacteria 2049
152 Ga0307513_10270650 3300031456 Bacteria 1482
153 Ga0307408_100000298 3300031548 Bacteria 47947
154 Ga0307408_100274259 3300031548 Bacteria 1402
155 Ga0307408_100600713 3300031548 Bacteria 978
156 Ga0307408_101300413 3300031548 Bacteria 681
157 Ga0307514_10000842 3300031649 Bacteria 49580
158 Ga0265314_10000065 3300031711 Bacteria 158383
159 Ga0265314_10001612 3300031711 Bacteria 24767
160 Ga0307516_10004775 3300031730 Bacteria 16523
161 Ga0307406_10000234 3300031901 Bacteria 33721
162 Ga0307416_100278858 3300032002 Bacteria 1647
163 Ga0373931_0225337 3300035691 Bacteria 1130
164 Ga0395900_0000981 3300037418 Bacteria 37107
165 Ga0395900_0378057 3300037418 Bacteria 1385
166 Ga0395898_0010261 3300037466 Bacteria 9804
167 Ga0395905_0047933 3300037471 Bacteria 4003
168 Ga0395905_0125746 3300037471 Bacteria 2411
169 Ga0395905_0150618 3300037471 Bacteria 2189
170 Ga0395905_0199400 3300037471 Bacteria 1876
171 Ga0395905_0232778 3300037471 Bacteria 1722
172 Ga0395905_0689156 3300037471 Bacteria 924
173 Ga0395901_0018806 3300038443 Bacteria 7061
174 Ga0436361_0877383 3300039447 Bacteria 24154
175 Ga0439436_0012609 3300041404 Bacteria 2565
176 Ga0439447_021413 3300041407 Bacteria 1703
177 Ga0439461_0004552 3300041410 Bacteria 2322
178 Ga0439465_0001335 3300041413 Bacteria 7923
179 Ga0451795_1361580 3300041456 Bacteria 753
180 Ga0451807_2545934 3300041486 Bacteria 791
181 Ga0451837_1780556 3300041494 Bacteria 1086
182 Ga0451853_3975492 3300041512 Bacteria 1011
183 Ga0439431_0047674 3300041997 Bacteria 1105
184 Ga0439431_0092138 3300041997 Bacteria 826
185 Ga0439433_0000797 3300041999 Bacteria 6226
186 Ga0439433_0079742 3300041999 Bacteria 795
187 Ga0439442_031518 3300042002 Bacteria 1107
188 Ga0439432_024095 3300042006 Bacteria 2001
189 Ga0439449_0000564 3300042007 Bacteria 13934
190 Ga0439449_0000933 3300042007 Bacteria 11413
191 Ga0439452_015881 3300042010 Bacteria 2055
192 Ga0439455_0016751 3300042012 Bacteria 1699
193 Ga0439457_009722 3300042014 Bacteria 2230
194 Ga0439462_0001005 3300042015 Bacteria 6037
195 Ga0439462_0009729 3300042015 Bacteria 2430
196 Ga0450890_026531 3300042127 Bacteria 807
197 Ga0439446_0059793 3300042156 Bacteria 1150
198 Ga0450909_006287 3300042185 Bacteria 1712
199 Ga0439434_0003398 3300042435 Bacteria 4659
200 Ga0439435_0101099 3300042436 Bacteria 886
201 Ga0439460_0027581 3300042461 Bacteria 1596
202 Ga0450893_0002626 3300042532 Bacteria 2811
203 Ga0451577_0009761 3300042876 Bacteria 9202
204 Ga0451577_0026405 3300042876 Bacteria 5260
205 Ga0466969_0040142 3300044656 Bacteria 2346
206 Ga0466972_0143009 3300044658 Bacteria 1125
207 Ga0453683_0002883 3300044673 Bacteria 13004
208 Ga0453683_0016392 3300044673 Bacteria 4781
209 Ga0466965_0138290 3300044683 Bacteria 1267
210 Ga0466965_0224477 3300044683 Bacteria 1002
211 Ga0466965_0317938 3300044683 Bacteria 847
212 Ga0466966_0007654 3300044684 Bacteria 7159
213 Ga0466966_0093129 3300044684 Bacteria 1869
214 Ga0466966_0114140 3300044684 Bacteria 1663
215 Ga0466966_0378868 3300044684 Bacteria 850
216 Ga0466961_0022129 3300044693 Bacteria 4090
217 Ga0466961_0386607 3300044693 Bacteria 850
218 Ga0453684_0448446 3300044712 Bacteria 1436
219 Ga0453684_0667381 3300044712 Bacteria 1133
220 Ga0453684_1130383 3300044712 Bacteria 826
221 Ga0466971_0026223 3300044719 Bacteria 2603
222 Ga0466970_0058735 3300044765 Bacteria 2059
223 Ga0466970_0090126 3300044765 Bacteria 1664
224 Ga0466957_0354328 3300044842 Bacteria 996
225 Ga0466960_0076011 3300044901 Bacteria 1681
226 Ga0466959_0005371 3300045049 Bacteria 8772
227 Ga0466959_0069954 3300045049 Bacteria 2542
228 Ga0451576_0004677 3300045051 Bacteria 17627
229 Ga0451576_0010171 3300045051 Bacteria 10823
230 Ga0451576_0010398 3300045051 Bacteria 10682
231 Ga0466958_0181297 3300045836 Bacteria 1336
232 Ga0466967_0137994 3300045976 Bacteria 2269
233 Ga0466967_0218062 3300045976 Bacteria 1812
234 Ga0495629_0147621 3300046459 Bacteria 1635
235 Ga0495639_0001440 3300046475 Bacteria 10645
236 Ga0495663_0022328 3300046525 Bacteria 1827
237 Ga0495652_0169481 3300046529 Bacteria 1687
238 Ga0495654_0000679 3300046530 Bacteria 26810
239 Ga0495621_0099613 3300046539 Bacteria 1105
240 Ga0495597_0000060 3300046542 Bacteria 92172
241 Ga0495645_0059766 3300046543 Bacteria 2763
242 Ga0495633_0176343 3300046558 Bacteria 984
243 Ga0495656_0005942 3300046615 Bacteria 4247
244 Ga0495588_0026637 3300046674 Bacteria 2888
245 Ga0495657_0170333 3300046675 Bacteria 1341
246 Ga0495636_0192271 3300047318 Bacteria 929
247 Ga0495676_0184287 3300047321 Bacteria 1461
248 Ga0495677_0074907 3300047445 Bacteria 1264
249 Ga0495685_024703 3300047447 Bacteria 2068
250 Ga0495681_0171691 3300047470 Bacteria 897
251 Ga0495615_0001472 3300048090 Bacteria 3524
252 Ga0496101_0015240 3300048904 Bacteria 5174
253 Ga0496102_0026628 3300048905 Bacteria 5160
254 Ga0496103_0008155 3300048906 Bacteria 6219
255 Ga0496104_0072044 3300048907 Bacteria 3285
256 Ga0496105_0002366 3300048908 Bacteria 13662
257 Ga0496107_0113441 3300048910 Bacteria 1993
258 Ga0496108_0245500 3300048911 Bacteria 1557
259 Ga0496109_0040817 3300048912 Bacteria 4203
260 Ga0496109_0574998 3300048912 Bacteria 1062
261 Ga0496110_0022097 3300048913 Bacteria 5396
262 Ga0496110_0055916 3300048913 Bacteria 3472
263 Ga0496111_0085067 3300048914 Bacteria 2312
264 Ga0496111_0533290 3300048914 Bacteria 863
265 Ga0496111_0599453 3300048914 Bacteria 806
266 Ga0496113_0410703 3300048916 Bacteria 1087
267 Ga0496114_0033738 3300048917 Bacteria 4219
268 Ga0496122_0004785 3300048925 Bacteria 16556
269 Ga0496123_0000329 3300048926 Bacteria 90380
270 Ga0501031_0239749 3300049568 Bacteria 1179
271 Ga0501032_0063817 3300049569 Bacteria 2466
272 Ga0501034_0039877 3300049571 Bacteria 4756
273 Ga0501083_0161433 3300049744 Bacteria 1466
274 Ga0501035_0028086 3300049822 Bacteria 5138
275 Ga0501044_0025733 3300049823 Bacteria 6238
276 nmdc:mga03683_112397_c1 3300050489 Bacteria 1205
277 nmdc:mga03683_41990_c1 3300050489 Bacteria 1880
278 nmdc:mga03n38_71289_c1 3300050490 Bacteria 1609
279 nmdc:mga00v17_474596_c1 3300050491 Bacteria 812
280 nmdc:mga0yw44_54356_c2 3300050492 Bacteria 2126
281 nmdc:mga0k408_173368_c1 3300050493 Bacteria 1286
282 nmdc:mga0k408_39903_c1 3300050493 Bacteria 2699
283 nmdc:mga06z11_219643_c1 3300050494 Bacteria 1110
284 nmdc:mga06z11_502750_c1 3300050494 Bacteria 734
285 nmdc:mga09592_1261_c2 3300050508 Bacteria 15739
286 nmdc:mga0qj67_147903_c1 3300050509 Bacteria 1905
287 nmdc:mga0qj67_776655_c1 3300050509 Bacteria 759
288 Ga0500644_0001368 3300053088 Bacteria 6506
289 Ga0500650_0073644 3300053098 Bacteria 1597
290 Ga0500562_003439 3300053108 Bacteria 3966
291 Ga0500593_002388 3300053117 Bacteria 6875
292 Ga0500628_022276 3300053129 Bacteria 1294
293 Ga0500604_0094718 3300053151 Bacteria 979
294 Ga0500627_0234417 3300053158 Bacteria 816
295 Ga0500645_000169 3300053730 Bacteria 51576
296 Ga0500645_002502 3300053730 Bacteria 8142
297 Ga0500661_018061 3300055283 Bacteria 1258
298 Ga0466962_0017932 3300061719 Bacteria 3406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0199400 Ga0395905_0199400_1098_1739 191
2 3300044684 Ga0466966_0114140 Ga0466966_0114140_745_1386 194
3 3300044693 Ga0466961_0022129 Ga0466961_0022129_3080_3721 194
4 3300044719 Ga0466971_0026223 Ga0466971_0026223_1418_2059 194
5 3300045049 Ga0466959_0005371 Ga0466959_0005371_5314_5955 194
6 3300045836 Ga0466958_0181297 Ga0466958_0181297_113_754 194
7 3300061719 Ga0466962_0017932 Ga0466962_0017932_2244_2885 194
8 3300027543 Ga0209999_1015174 Ga0209999_10151742 196
9 3300027614 Ga0209970_1000627 Ga0209970_10006273 196
10 3300027876 Ga0209974_10049569 Ga0209974_100495692 196
11 3300041494 Ga0451837_1780556 Ga0451837_1780556_349_969 197
12 3300048925 Ga0496122_0004785 Ga0496122_0004785_5522_6181 198
13 3300048926 Ga0496123_0000329 Ga0496123_0000329_10419_11078 198
14 3300049822 Ga0501035_0028086 Ga0501035_0028086_3612_4244 198
15 3300025940 Ga0207691_10417152 Ga0207691_104171522 199
16 3300049568 Ga0501031_0239749 Ga0501031_0239749_219_848 201
17 iso_pu_bacteria 2919704043 2919708572 202
18 3300045976 Ga0466967_0218062 Ga0466967_0218062_88_735 205
19 3300003323 rootH1_10036068 rootH1_100360682 206
20 3300021361 Ga0213872_10004534 Ga0213872_1000453410 206
21 3300039447 Ga0436361_0877383 Ga0436361_0877383_15916_16539 206
22 3300042015 Ga0439462_0001005 Ga0439462_0001005_1777_2403 206
23 3300042876 Ga0451577_0009761 Ga0451577_0009761_7803_8534 206
24 3300044673 Ga0453683_0016392 Ga0453683_0016392_2335_3066 206
25 3300044712 Ga0453684_0448446 Ga0453684_0448446_96_716 206
26 3300045051 Ga0451576_0010398 Ga0451576_0010398_2630_3361 206
27 iso_pu_bacteria 2511231002 2511246041 206
28 iso_pu_bacteria 2547132374 2548501850 206
29 iso_pu_bacteria 2643221570 2643864039 206
30 iso_pu_bacteria 2643221596 2643992350 206
31 iso_pu_bacteria 2643221609 2644060016 206
32 iso_pu_bacteria 2643221611 2644072620 206
33 iso_pu_bacteria 2643221652 2644292305 206
34 iso_pu_bacteria 2643221717 2644646424 206
35 iso_pu_bacteria 2738543012 2739245644 206
36 iso_pu_bacteria 2816332133 2816470452 206
37 iso_pu_bacteria 2894023352 2894023506 206
38 iso_pu_bacteria 2990710928 2990714569 206
39 3300005339 Ga0070660_100977575 Ga0070660_1009775751 208
40 3300005445 Ga0070708_100350732 Ga0070708_1003507322 208
41 3300006846 Ga0075430_100047838 Ga0075430_1000478383 208
42 3300006880 Ga0075429_100023715 Ga0075429_1000237153 208
43 3300009147 Ga0114129_10061456 Ga0114129_100614564 208
44 3300037418 Ga0395900_0000981 Ga0395900_0000981_34487_35122 208
45 3300037466 Ga0395898_0010261 Ga0395898_0010261_1537_2166 208
46 3300042012 Ga0439455_0016751 Ga0439455_0016751_480_1163 208
47 3300050508 nmdc:mga09592_1261_c2 nmdc:mga09592_1261_c2_13449_14084 208
48 3300050509 nmdc:mga0qj67_147903_c1 nmdc:mga0qj67_147903_c1_1211_1846 208
49 3300006177 Ga0075362_10063645 Ga0075362_100636452 209
50 3300046529 Ga0495652_0169481 Ga0495652_0169481_310_939 209
51 3300002704 JGI25155J39150_1000009 JGI25155J39150_1000009200 210
52 3300002705 JGI25156J39149_1000009 JGI25156J39149_100000920 210
53 3300002738 JGI25154J39366_1000024 JGI25154J39366_100002420 210
54 3300002741 JGI25157J39369_1000007 JGI25157J39369_100000720 210
55 3300002774 JGI25150J39212_1014521 JGI25150J39212_10145211 210
56 3300002774 JGI25150J39212_1016887 JGI25150J39212_10168871 210
57 3300002987 JGI25159J45721_1002132 JGI25159J45721_10021329 210
58 3300002987 JGI25159J45721_1007537 JGI25159J45721_10075372 210
59 3300003187 JGI25151J46595_10009583 JGI25151J46595_100095835 210
60 3300003187 JGI25151J46595_10014827 JGI25151J46595_100148273 210
61 3300003187 JGI25151J46595_10047819 JGI25151J46595_100478192 210
62 3300003354 JGI25160J50197_1000242 JGI25160J50197_100024219 210
63 3300003374 JGI25161J50226_1000009 JGI25161J50226_1000009208 210
64 3300003771 Ga0055526_1007972 Ga0055526_10079725 210
65 3300003771 Ga0055526_1023301 Ga0055526_10233013 210
66 3300003773 Ga0055537_1000235 Ga0055537_100023518 210
67 3300003775 Ga0055524_1000143 Ga0055524_100014373 210
68 3300003784 Ga0055534_1003551 Ga0055534_10035515 210
69 3300003790 Ga0055528_1002737 Ga0055528_10027374 210
70 3300003791 Ga0055530_10000474 Ga0055530_1000047410 210
71 3300003791 Ga0055530_10022181 Ga0055530_100221813 210
72 3300003792 Ga0055540_1000027 Ga0055540_1000027162 210
73 3300003792 Ga0055540_1008286 Ga0055540_10082864 210
74 3300003794 Ga0055531_10001125 Ga0055531_100011253 210
75 3300003794 Ga0055531_10001147 Ga0055531_100011477 210
76 3300004625 Ga0055543_1002618 Ga0055543_10026187 210
77 3300005262 Ga0065165_1017661 Ga0065165_10176613 210
78 3300005262 Ga0065165_1019556 Ga0065165_10195562 210
79 3300005262 Ga0065165_1035560 Ga0065165_10355602 210
80 3300005327 Ga0070658_10296187 Ga0070658_102961872 210
81 3300005327 Ga0070658_10679125 Ga0070658_106791252 210
82 3300005338 Ga0068868_100142057 Ga0068868_1001420573 210
83 3300005367 Ga0070667_100011146 Ga0070667_1000111467 210
84 3300005459 Ga0068867_100219628 Ga0068867_1002196282 210
85 3300005468 Ga0070707_100606903 Ga0070707_1006069031 210
86 3300005539 Ga0068853_100277741 Ga0068853_1002777412 210
87 3300005543 Ga0070672_100525908 Ga0070672_1005259082 210
88 3300005548 Ga0070665_100031544 Ga0070665_1000315442 210
89 3300005548 Ga0070665_100068584 Ga0070665_1000685843 210
90 3300006038 Ga0075365_10003037 Ga0075365_100030372 210
91 3300006048 Ga0075363_100019356 Ga0075363_1000193565 210
92 3300006048 Ga0075363_100054130 Ga0075363_1000541302 210
93 3300006051 Ga0075364_10013705 Ga0075364_100137052 210
94 3300006058 Ga0075432_10020334 Ga0075432_100203343 210
95 3300006177 Ga0075362_10012503 Ga0075362_100125034 210
96 3300006177 Ga0075362_10102001 Ga0075362_101020011 210
97 3300006177 Ga0075362_10102470 Ga0075362_101024702 210
98 3300006178 Ga0075367_10089370 Ga0075367_100893703 210
99 3300006178 Ga0075367_10113858 Ga0075367_101138581 210
100 3300006178 Ga0075367_10154530 Ga0075367_101545302 210
101 3300006178 Ga0075367_10500257 Ga0075367_105002571 210
102 3300006195 Ga0075366_10063799 Ga0075366_100637992 210
103 3300006195 Ga0075366_10211426 Ga0075366_102114262 210
104 3300006353 Ga0075370_10097110 Ga0075370_100971102 210
105 3300006353 Ga0075370_10355357 Ga0075370_103553572 210
106 3300006846 Ga0075430_100250008 Ga0075430_1002500083 210
107 3300009176 Ga0105242_10000638 Ga0105242_1000063824 210
108 3300009176 Ga0105242_10664342 Ga0105242_106643422 210
109 3300009177 Ga0105248_10793205 Ga0105248_107932052 210
110 3300009551 Ga0105238_10809452 Ga0105238_108094521 210
111 3300009553 Ga0105249_10772097 Ga0105249_107720971 210
112 3300010375 Ga0105239_10406945 Ga0105239_104069452 210
113 3300012513 Ga0157326_1002224 Ga0157326_10022242 210
114 3300013306 Ga0163162_10400577 Ga0163162_104005772 210
115 3300014497 Ga0182008_10001313 Ga0182008_100013137 210
116 3300014497 Ga0182008_10001772 Ga0182008_1000177216 210
117 3300014969 Ga0157376_10011667 Ga0157376_100116678 210
118 3300015261 Ga0182006_1029518 Ga0182006_10295182 210
119 3300015262 Ga0182007_10000714 Ga0182007_1000071419 210
120 3300015262 Ga0182007_10093156 Ga0182007_100931561 210
121 3300015683 Ga0183362_10004 Ga0183362_10004530 210
122 3300017792 Ga0163161_10059759 Ga0163161_100597594 210
123 3300025206 Ga0209435_100051 Ga0209435_10005176 210
124 3300025208 Ga0209436_102651 Ga0209436_1026514 210
125 3300025245 Ga0207425_1003880 Ga0207425_10038805 210
126 3300025245 Ga0207425_1031811 Ga0207425_10318111 210
127 3300025246 Ga0209646_1000029 Ga0209646_1000029352 210
128 3300025250 Ga0209026_1000016 Ga0209026_1000016352 210
129 3300025256 Ga0209759_1000016 Ga0209759_1000016352 210
130 3300025263 Ga0209565_1000122 Ga0209565_100012291 210
131 3300025263 Ga0209565_1000373 Ga0209565_100037326 210
132 3300025273 Ga0209673_1000302 Ga0209673_100030277 210
133 3300025284 Ga0209130_1000014 Ga0209130_100001420 210
134 3300025284 Ga0209130_1000487 Ga0209130_100048719 210
135 3300025284 Ga0209130_1000495 Ga0209130_100049525 210
136 3300025284 Ga0209130_1017774 Ga0209130_10177741 210
137 3300025291 Ga0209675_1000098 Ga0209675_1000098118 210
138 3300025291 Ga0209675_1002425 Ga0209675_10024253 210
139 3300025291 Ga0209675_1010612 Ga0209675_10106124 210
140 3300025292 Ga0209676_1000013 Ga0209676_1000013735 210
141 3300025294 Ga0209025_1003515 Ga0209025_100351513 210
142 3300025294 Ga0209025_1019888 Ga0209025_10198885 210
143 3300025294 Ga0209025_1027938 Ga0209025_10279383 210
144 3300025294 Ga0209025_1051301 Ga0209025_10513012 210
145 3300025295 Ga0209564_1001169 Ga0209564_10011695 210
146 3300025295 Ga0209564_1001202 Ga0209564_10012025 210
147 3300025297 Ga0209758_1038458 Ga0209758_10384583 210
148 3300025298 Ga0209050_1000008 Ga0209050_1000008735 210
149 3300025298 Ga0209050_1005076 Ga0209050_100507610 210
150 3300025299 Ga0209256_1000039 Ga0209256_1000039334 210
151 3300025299 Ga0209256_1041886 Ga0209256_10418862 210
152 3300025302 Ga0207426_1000224 Ga0207426_100022420 210
153 3300025303 Ga0209051_1000005 Ga0209051_1000005735 210
154 3300025303 Ga0209051_1000172 Ga0209051_100017220 210
155 3300025304 Ga0209257_1000015 Ga0209257_1000015567 210
156 3300025304 Ga0209257_1000031 Ga0209257_1000031325 210
157 3300025304 Ga0209257_1000108 Ga0209257_1000108143 210
158 3300025909 Ga0207705_10144981 Ga0207705_101449812 210
159 3300025909 Ga0207705_10310872 Ga0207705_103108722 210
160 3300025922 Ga0207646_10822157 Ga0207646_108221571 210
161 3300025924 Ga0207694_10568117 Ga0207694_105681171 210
162 3300025934 Ga0207686_10230980 Ga0207686_102309802 210
163 3300025940 Ga0207691_10569047 Ga0207691_105690472 210
164 3300025960 Ga0207651_10193894 Ga0207651_101938942 210
165 3300025986 Ga0207658_10016326 Ga0207658_100163267 210
166 3300026023 Ga0207677_10021038 Ga0207677_100210383 210
167 3300026041 Ga0207639_10125625 Ga0207639_101256252 210
168 3300026041 Ga0207639_10360941 Ga0207639_103609412 210
169 3300026089 Ga0207648_10207997 Ga0207648_102079972 210
170 3300026116 Ga0207674_10145524 Ga0207674_101455243 210
171 3300027424 Ga0209984_1019840 Ga0209984_10198402 210
172 3300027876 Ga0209974_10059088 Ga0209974_100590881 210
173 3300027876 Ga0209974_10105499 Ga0209974_101054991 210
174 3300027907 Ga0207428_10649923 Ga0207428_106499231 210
175 3300028379 Ga0268266_10051508 Ga0268266_100515084 210
176 3300028379 Ga0268266_10683367 Ga0268266_106833672 210
177 3300028794 Ga0307515_10000322 Ga0307515_1000032218 210
178 3300028794 Ga0307515_10005091 Ga0307515_1000509115 210
179 3300028794 Ga0307515_10052038 Ga0307515_100520387 210
180 3300031235 Ga0265330_10000037 Ga0265330_1000003755 210
181 3300031235 Ga0265330_10020871 Ga0265330_100208714 210
182 3300031238 Ga0265332_10000008 Ga0265332_1000000857 210
183 3300031238 Ga0265332_10001541 Ga0265332_1000154114 210
184 3300031238 Ga0265332_10002902 Ga0265332_100029028 210
185 3300031241 Ga0265325_10049321 Ga0265325_100493212 210
186 3300031456 Ga0307513_10000013 Ga0307513_1000001332 210
187 3300031456 Ga0307513_10002374 Ga0307513_1000237419 210
188 3300031456 Ga0307513_10011271 Ga0307513_100112717 210
189 3300031456 Ga0307513_10171217 Ga0307513_101712173 210
190 3300031456 Ga0307513_10270650 Ga0307513_102706501 210
191 3300031548 Ga0307408_100000298 Ga0307408_10000029816 210
192 3300031548 Ga0307408_100274259 Ga0307408_1002742592 210
193 3300031548 Ga0307408_100600713 Ga0307408_1006007132 210
194 3300031548 Ga0307408_101300413 Ga0307408_1013004131 210
195 3300031649 Ga0307514_10000842 Ga0307514_1000084228 210
196 3300031711 Ga0265314_10000065 Ga0265314_1000006589 210
197 3300031711 Ga0265314_10001612 Ga0265314_100016127 210
198 3300031730 Ga0307516_10004775 Ga0307516_100047752 210
199 3300031901 Ga0307406_10000234 Ga0307406_100002348 210
200 3300032002 Ga0307416_100278858 Ga0307416_1002788583 210
201 3300035691 Ga0373931_0225337 Ga0373931_0225337_217_852 210
202 3300037418 Ga0395900_0378057 Ga0395900_0378057_666_1301 210
203 3300037471 Ga0395905_0047933 Ga0395905_0047933_977_1612 210
204 3300037471 Ga0395905_0125746 Ga0395905_0125746_1764_2396 210
205 3300037471 Ga0395905_0150618 Ga0395905_0150618_896_1531 210
206 3300037471 Ga0395905_0232778 Ga0395905_0232778_96_731 210
207 3300037471 Ga0395905_0689156 Ga0395905_0689156_205_861 210
208 3300038443 Ga0395901_0018806 Ga0395901_0018806_6303_6938 210
209 3300041404 Ga0439436_0012609 Ga0439436_0012609_1299_1940 210
210 3300041407 Ga0439447_021413 Ga0439447_021413_72_713 210
211 3300041410 Ga0439461_0004552 Ga0439461_0004552_709_1350 210
212 3300041413 Ga0439465_0001335 Ga0439465_0001335_5990_6631 210
213 3300041456 Ga0451795_1361580 Ga0451795_1361580_22_654 210
214 3300041486 Ga0451807_2545934 Ga0451807_2545934_82_714 210
215 3300041512 Ga0451853_3975492 Ga0451853_3975492_333_965 210
216 3300041997 Ga0439431_0047674 Ga0439431_0047674_21_653 210
217 3300041997 Ga0439431_0092138 Ga0439431_0092138_110_751 210
218 3300041999 Ga0439433_0000797 Ga0439433_0000797_5142_5783 210
219 3300041999 Ga0439433_0079742 Ga0439433_0079742_16_648 210
220 3300042002 Ga0439442_031518 Ga0439442_031518_356_997 210
221 3300042006 Ga0439432_024095 Ga0439432_024095_707_1363 210
222 3300042007 Ga0439449_0000564 Ga0439449_0000564_272_904 210
223 3300042007 Ga0439449_0000933 Ga0439449_0000933_3083_3739 210
224 3300042010 Ga0439452_015881 Ga0439452_015881_1298_1939 210
225 3300042014 Ga0439457_009722 Ga0439457_009722_1146_1787 210
226 3300042015 Ga0439462_0009729 Ga0439462_0009729_1281_1922 210
227 3300042127 Ga0450890_026531 Ga0450890_026531_152_790 210
228 3300042156 Ga0439446_0059793 Ga0439446_0059793_437_1078 210
229 3300042185 Ga0450909_006287 Ga0450909_006287_932_1573 210
230 3300042435 Ga0439434_0003398 Ga0439434_0003398_3893_4534 210
231 3300042436 Ga0439435_0101099 Ga0439435_0101099_184_816 210
232 3300042461 Ga0439460_0027581 Ga0439460_0027581_114_761 210
233 3300042532 Ga0450893_0002626 Ga0450893_0002626_1653_2291 210
234 3300042876 Ga0451577_0026405 Ga0451577_0026405_1547_2179 210
235 3300044656 Ga0466969_0040142 Ga0466969_0040142_607_1245 210
236 3300044658 Ga0466972_0143009 Ga0466972_0143009_389_1030 210
237 3300044673 Ga0453683_0002883 Ga0453683_0002883_465_1112 210
238 3300044683 Ga0466965_0138290 Ga0466965_0138290_388_1029 210
239 3300044683 Ga0466965_0224477 Ga0466965_0224477_276_917 210
240 3300044683 Ga0466965_0317938 Ga0466965_0317938_155_796 210
241 3300044684 Ga0466966_0007654 Ga0466966_0007654_557_1195 210
242 3300044684 Ga0466966_0093129 Ga0466966_0093129_969_1610 210
243 3300044684 Ga0466966_0378868 Ga0466966_0378868_161_799 210
244 3300044693 Ga0466961_0386607 Ga0466961_0386607_43_681 210
245 3300044712 Ga0453684_0667381 Ga0453684_0667381_212_844 210
246 3300044712 Ga0453684_1130383 Ga0453684_1130383_122_766 210
247 3300044765 Ga0466970_0058735 Ga0466970_0058735_1207_1845 210
248 3300044765 Ga0466970_0090126 Ga0466970_0090126_80_721 210
249 3300044842 Ga0466957_0354328 Ga0466957_0354328_239_877 210
250 3300044901 Ga0466960_0076011 Ga0466960_0076011_103_744 210
251 3300045049 Ga0466959_0069954 Ga0466959_0069954_1642_2280 210
252 3300045051 Ga0451576_0004677 Ga0451576_0004677_7371_8018 210
253 3300045051 Ga0451576_0010171 Ga0451576_0010171_5081_5713 210
254 3300045976 Ga0466967_0137994 Ga0466967_0137994_1497_2135 210
255 3300046459 Ga0495629_0147621 Ga0495629_0147621_709_1365 210
256 3300046475 Ga0495639_0001440 Ga0495639_0001440_5144_5800 210
257 3300046525 Ga0495663_0022328 Ga0495663_0022328_794_1426 210
258 3300046530 Ga0495654_0000679 Ga0495654_0000679_17248_17886 210
259 3300046539 Ga0495621_0099613 Ga0495621_0099613_346_990 210
260 3300046542 Ga0495597_0000060 Ga0495597_0000060_76619_77254 210
261 3300046543 Ga0495645_0059766 Ga0495645_0059766_19_675 210
262 3300046558 Ga0495633_0176343 Ga0495633_0176343_42_674 210
263 3300046615 Ga0495656_0005942 Ga0495656_0005942_1955_2587 210
264 3300046674 Ga0495588_0026637 Ga0495588_0026637_1541_2197 210
265 3300046675 Ga0495657_0170333 Ga0495657_0170333_640_1296 210
266 3300047318 Ga0495636_0192271 Ga0495636_0192271_46_678 210
267 3300047321 Ga0495676_0184287 Ga0495676_0184287_18_674 210
268 3300047445 Ga0495677_0074907 Ga0495677_0074907_181_813 210
269 3300047447 Ga0495685_024703 Ga0495685_024703_968_1600 210
270 3300047470 Ga0495681_0171691 Ga0495681_0171691_205_861 210
271 3300048090 Ga0495615_0001472 Ga0495615_0001472_2284_2916 210
272 3300048904 Ga0496101_0015240 Ga0496101_0015240_98_754 210
273 3300048905 Ga0496102_0026628 Ga0496102_0026628_4358_5014 210
274 3300048906 Ga0496103_0008155 Ga0496103_0008155_1443_2099 210
275 3300048907 Ga0496104_0072044 Ga0496104_0072044_2504_3160 210
276 3300048908 Ga0496105_0002366 Ga0496105_0002366_3456_4112 210
277 3300048910 Ga0496107_0113441 Ga0496107_0113441_900_1556 210
278 3300048911 Ga0496108_0245500 Ga0496108_0245500_240_896 210
279 3300048912 Ga0496109_0040817 Ga0496109_0040817_753_1409 210
280 3300048912 Ga0496109_0574998 Ga0496109_0574998_276_932 210
281 3300048913 Ga0496110_0022097 Ga0496110_0022097_4033_4689 210
282 3300048913 Ga0496110_0055916 Ga0496110_0055916_1940_2596 210
283 3300048914 Ga0496111_0085067 Ga0496111_0085067_180_836 210
284 3300048914 Ga0496111_0533290 Ga0496111_0533290_134_790 210
285 3300048914 Ga0496111_0599453 Ga0496111_0599453_97_753 210
286 3300048916 Ga0496113_0410703 Ga0496113_0410703_254_910 210
287 3300048917 Ga0496114_0033738 Ga0496114_0033738_1247_1903 210
288 3300049569 Ga0501032_0063817 Ga0501032_0063817_894_1529 210
289 3300049571 Ga0501034_0039877 Ga0501034_0039877_2287_2922 210
290 3300049744 Ga0501083_0161433 Ga0501083_0161433_131_766 210
291 3300049823 Ga0501044_0025733 Ga0501044_0025733_764_1399 210
292 3300050489 nmdc:mga03683_112397_c1 nmdc:mga03683_112397_c1_519_1160 210
293 3300050489 nmdc:mga03683_41990_c1 nmdc:mga03683_41990_c1_1232_1864 210
294 3300050490 nmdc:mga03n38_71289_c1 nmdc:mga03n38_71289_c1_199_840 210
295 3300050491 nmdc:mga00v17_474596_c1 nmdc:mga00v17_474596_c1_158_790 210
296 3300050492 nmdc:mga0yw44_54356_c2 nmdc:mga0yw44_54356_c2_789_1421 210
297 3300050493 nmdc:mga0k408_173368_c1 nmdc:mga0k408_173368_c1_495_1139 210
298 3300050493 nmdc:mga0k408_39903_c1 nmdc:mga0k408_39903_c1_757_1389 210
299 3300050494 nmdc:mga06z11_219643_c1 nmdc:mga06z11_219643_c1_143_775 210
300 3300050494 nmdc:mga06z11_502750_c1 nmdc:mga06z11_502750_c1_68_712 210
301 3300050509 nmdc:mga0qj67_776655_c1 nmdc:mga0qj67_776655_c1_89_736 210
302 3300053088 Ga0500644_0001368 Ga0500644_0001368_126_758 210
303 3300053098 Ga0500650_0073644 Ga0500650_0073644_630_1262 210
304 3300053108 Ga0500562_003439 Ga0500562_003439_2511_3143 210
305 3300053117 Ga0500593_002388 Ga0500593_002388_6222_6854 210
306 3300053129 Ga0500628_022276 Ga0500628_022276_412_1044 210
307 3300053151 Ga0500604_0094718 Ga0500604_0094718_291_923 210
308 3300053158 Ga0500627_0234417 Ga0500627_0234417_70_702 210
309 3300053730 Ga0500645_000169 Ga0500645_000169_12683_13315 210
310 3300053730 Ga0500645_002502 Ga0500645_002502_1506_2138 210
311 3300055283 Ga0500661_018061 Ga0500661_018061_252_884 210
312 iso_pu_bacteria 2842733646 2842738236 210
313 iso_pu_bacteria 2842747753 2842750768 210
314 iso_pu_bacteria 2885192300 2885194627 210
315 iso_pu_bacteria 2928115317 2928118922 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01914

MarC

MarC family integral membrane protein

47

250

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.5171 5 198
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.4893 4 194
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.4816 4 196
4d2b-assembly1.cif.gz_A structure of a ligand free pot family peptide transporter 0.4768 4 203
5oxp-assembly1.cif.gz_A peptst in occluded conformation with phosphate ion bound 0.4764 5 203
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5401 35 196 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5257 35 196 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5248 4 200 1.20.1250.20
af_Q54QF0_99_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5106 5 197 1.20.1250.20
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.5088 6 196 1.20.1720.10
ID Description Score Start End GO Terms
AF-A0A4V1UU27-F1-model_v4 UPF0056 membrane protein 0.8929 3 207 GO:0005886
AF-A0A2M8UUJ9-F1-model_v4 UPF0056 membrane protein 0.8903 5 206 GO:0005886
AF-A0A2U0SQD3-F1-model_v4 UPF0056 membrane protein 0.8884 3 206 GO:0005886
AF-B2KBR5-F1-model_v4 UPF0056 inner membrane protein 0.8881 3 203 GO:0005886
AF-A0A842LZF1-F1-model_v4 UPF0056 membrane protein 0.8878 3 204 GO:0005886

Feature Viewer

pLDDT pTM Quality
74.41 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map